Citrus Sinensis ID: 038528

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MSWADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAVLLLGY
ccccccccccEEEcccccEEEEccccEEEEEEccHHHHcEEEEEEEEEcccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHcc
cccccccccEEEEEEEccEEEccccEEEEEEccccHHHcEEEEEEEEccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHcc
mswadeddirtldirrgdvyrlqpgsvfyIESNLEQEREKLRIYAIFSnteddsyfepvigAYTSISDLILGFDRKVLQSAFKRAVLLLGY
mswadeddirtldirrgdvyrlqpGSVFYIESNLEQEREKLRIYAIFSnteddsyfePVIGAYTSISDLILGFDRKVLQSAFKRAVLLLGY
MSWADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAVLLLGY
********IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAVLLL**
MSW******R***IRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAVLLLGY
MSWADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAVLLLGY
MSWADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAVLLLGY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAVLLLGY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
224094719 613 predicted protein [Populus trichocarpa] 0.901 0.133 0.650 2e-26
17221648 685 preproMP73 [Cucurbita maxima] 0.890 0.118 0.573 4e-24
359476587 612 PREDICTED: vicilin-like antimicrobial pe 0.912 0.135 0.623 4e-23
357483349 735 Vicilin-like antimicrobial peptides 2-3 0.901 0.111 0.602 7e-23
297735192 478 unnamed protein product [Vitis vinifera] 0.912 0.173 0.627 8e-23
356538162 696 PREDICTED: allergen Ara h 1, clone P41B- 0.901 0.117 0.554 3e-21
356495423 614 PREDICTED: vicilin GC72-A-like [Glycine 0.901 0.133 0.554 1e-20
156070784 750 unknown [Petunia integrifolia subsp. inf 0.901 0.109 0.536 9e-20
156070762 814 unknown [Solanum melongena] 0.890 0.099 0.536 4e-19
156070799 734 unknown [Solanum bulbocastanum] 0.890 0.110 0.5 7e-18
>gi|224094719|ref|XP_002310206.1| predicted protein [Populus trichocarpa] gi|222853109|gb|EEE90656.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 72/83 (86%), Gaps = 1/83 (1%)

Query: 1   MSWADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVI 60
           +SW D  +++ +++RRGDVYRLQ GSVF++ SNL+ ER+K+RI+AIFSNT++D Y EP I
Sbjct: 101 LSWTDGREMKRMNLRRGDVYRLQAGSVFFVRSNLDSERQKMRIHAIFSNTDEDIY-EPSI 159

Query: 61  GAYTSISDLILGFDRKVLQSAFK 83
           GAY+S+SDL+LGFDRKVLQ AFK
Sbjct: 160 GAYSSVSDLVLGFDRKVLQEAFK 182

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|17221648|dbj|BAB78478.1| preproMP73 [Cucurbita maxima] Back     alignment and taxonomy information
>gi|359476587|ref|XP_002268407.2| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357483349|ref|XP_003611961.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula] gi|358344413|ref|XP_003636284.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula] gi|355502219|gb|AES83422.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula] gi|355513296|gb|AES94919.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297735192|emb|CBI17554.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356538162|ref|XP_003537573.1| PREDICTED: allergen Ara h 1, clone P41B-like [Glycine max] Back     alignment and taxonomy information
>gi|356495423|ref|XP_003516577.1| PREDICTED: vicilin GC72-A-like [Glycine max] Back     alignment and taxonomy information
>gi|156070784|gb|ABU45197.1| unknown [Petunia integrifolia subsp. inflata] Back     alignment and taxonomy information
>gi|156070762|gb|ABU45177.1| unknown [Solanum melongena] Back     alignment and taxonomy information
>gi|156070799|gb|ABU45211.1| unknown [Solanum bulbocastanum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
TAIR|locus:2115390 522 AT4G36700 "AT4G36700" [Arabido 0.879 0.153 0.511 2.9e-16
TAIR|locus:2046273 707 AT2G18540 "AT2G18540" [Arabido 0.824 0.106 0.5 2.3e-15
TAIR|locus:2115390 AT4G36700 "AT4G36700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 210 (79.0 bits), Expect = 2.9e-16, P = 2.9e-16
 Identities = 43/84 (51%), Positives = 60/84 (71%)

Query:     1 MSWADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQE--REKLRIYAIFSNTEDDSYFEP 58
             ++W DE+  ++ +IR GDVYRL+PGSVFY++S         KL++YAIFSN  D+   +P
Sbjct:   113 LNWVDEE-AKSTEIRLGDVYRLRPGSVFYLQSKPVDIFLGTKLKLYAIFSNN-DECLHDP 170

Query:    59 VIGAYTSISDLILGFDRKVLQSAF 82
               GAY+SI+DL+ GFD  +LQSAF
Sbjct:   171 CFGAYSSITDLMFGFDETILQSAF 194
GO:0008150 "biological_process" evidence=ND
GO:0045735 "nutrient reservoir activity" evidence=IEA;ISS
TAIR|locus:2046273 AT2G18540 "AT2G18540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00071055
hypothetical protein (613 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
PLN00212 493 glutelin; Provisional 99.93
smart00835146 Cupin_1 Cupin. This family represents the conserve 99.32
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 99.25
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 98.43
PLN00212493 glutelin; Provisional 98.08
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 97.99
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 97.82
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 97.66
COG1917131 Uncharacterized conserved protein, contains double 97.26
PRK04190191 glucose-6-phosphate isomerase; Provisional 97.09
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 97.07
PRK13290125 ectC L-ectoine synthase; Reviewed 96.59
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 96.52
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 96.18
PRK11171266 hypothetical protein; Provisional 95.95
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 95.93
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 95.76
COG3837161 Uncharacterized conserved protein, contains double 95.64
PF12852186 Cupin_6: Cupin 95.55
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 95.49
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 95.47
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 94.98
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 94.95
PRK11171266 hypothetical protein; Provisional 94.55
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 94.02
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 93.51
COG1791181 Uncharacterized conserved protein, contains double 93.05
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 93.01
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 91.26
PF1169985 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. 91.21
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 90.78
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 90.58
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 90.53
PF06052151 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte 90.01
PRK15457233 ethanolamine utilization protein EutQ; Provisional 89.18
COG3450116 Predicted enzyme of the cupin superfamily [General 88.88
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 88.79
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 88.45
TIGR00218302 manA mannose-6-phosphate isomerase, class I. The n 85.72
PF06249152 EutQ: Ethanolamine utilisation protein EutQ; Inter 84.53
PRK10296 278 DNA-binding transcriptional regulator ChbR; Provis 81.82
PRK10572 290 DNA-binding transcriptional regulator AraC; Provis 81.13
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 80.52
COG4297163 Uncharacterized protein containing double-stranded 80.27
>PLN00212 glutelin; Provisional Back     alignment and domain information 
Probab=99.93  E-value=6.1e-26  Score=183.90  Aligned_cols=82  Identities=13%  Similarity=0.246  Sum_probs=73.5

Q ss_pred             CCCceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCC---C--CCCceeecCCCc--------------c
Q 038528            6 EDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTED---D--SYFEPVIGAYTS--------------I   66 (91)
Q Consensus         6 ~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~---~--~~~~~flag~~~--------------~   66 (91)
                      +++||+++||+||||+||||++||+||+||+   +|++++++|++|.   +  .+++|||||+++              +
T Consensus       144 d~hqkv~~lr~GDViaiPaG~~hw~yN~Gd~---~~v~v~~~d~~n~~Nqld~~~r~F~LaG~~~~~~~~~~~~~~~~~~  220 (493)
T PLN00212        144 DEHQKIHQFRQGDVVALPAGVAHWFYNDGDA---PVVALYVYDINNNANQLEPRQREFLLAGNNNRQQQVYGRSIEQHSG  220 (493)
T ss_pred             cccccceEeccCCEEEECCCCeEEEEeCCCC---cEEEEEEEeccccccccCCCcceeeccCCCcccccccccccccccc
Confidence            4588999999999999999999999999986   8999999999984   3  447889999864              3


Q ss_pred             CceecccCHHHHHHHhCCCccccc
Q 038528           67 SDLILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        67 ~ni~~GF~~~iL~~Af~v~~~~i~   90 (91)
                      +|||+|||+++|++||||+.++++
T Consensus       221 ~nifsGF~~e~La~Afnv~~e~~~  244 (493)
T PLN00212        221 QNIFSGFSTELLSEALGINAQVAK  244 (493)
T ss_pred             CchhhcCCHHHHHHHHCCCHHHHH
Confidence            689999999999999999999886

>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information
>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 3e-13
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 1e-12
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 2e-12
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 2e-10
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 3e-10
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 1e-09
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 5e-06
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 3e-05
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 6e-05
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 2e-04
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 Back     alignment and structure
 Score = 60.8 bits (147), Expect = 3e-13
 Identities = 12/83 (14%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 1   MSWADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVI 60
           +   + D   T  + +GD  ++Q G+ FY+ +    +  ++  +AI       +  +  +
Sbjct: 74  LVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRR-PGTVEDFFL 132

Query: 61  GAYTSISDLILGFDRKVLQSAFK 83
            +   +   +  F +  L++++ 
Sbjct: 133 SSTKRLPSYLSAFSKNFLEASYD 155
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466 Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465 Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
3fz3_A 531 Prunin; TREE NUT allergen, allergy, amandin, almon 99.92
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 99.91
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 99.9
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 99.89
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 99.88
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 99.86
3c3v_A 510 Arachin ARAH3 isoform; peanut allergen, allergy, g 99.86
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 99.85
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 99.85
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 99.83
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 99.8
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 99.8
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 99.8
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 99.78
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 99.34
1dgw_Y93 Canavalin; duplicated swiss-roll beta barrels, loo 99.3
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 99.14
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 99.06
1uij_A416 Beta subunit of beta conglycinin; double-stranded 99.04
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 99.02
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 99.02
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 98.99
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 98.98
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 98.92
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 98.9
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 98.87
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 98.83
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 98.83
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 98.81
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 98.74
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 98.69
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 98.63
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 98.62
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 97.87
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 97.81
3h8u_A125 Uncharacterized conserved protein with double-STR 97.8
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 97.74
1v70_A105 Probable antibiotics synthesis protein; structural 97.64
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 97.51
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 97.5
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 97.41
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 97.39
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 97.37
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 97.36
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 97.24
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 97.22
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 97.13
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 97.12
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 97.09
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 97.08
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 97.03
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 97.01
1vj2_A126 Novel manganese-containing cupin TM1459; structura 97.01
4i4a_A128 Similar to unknown protein; structural genomics, P 97.0
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 96.99
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 96.92
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 96.91
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 96.88
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 96.87
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 96.79
3lwc_A119 Uncharacterized protein; structural genomics, unkn 96.77
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 96.76
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 96.76
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 96.73
1sef_A274 Conserved hypothetical protein; structural genomic 96.69
1sfn_A246 Conserved hypothetical protein; structural genomic 96.67
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 96.65
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 96.64
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 96.6
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 96.58
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 96.56
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 96.56
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 96.47
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 96.43
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 96.36
2q30_A110 Uncharacterized protein; double-stranded beta-heli 96.35
4axo_A151 EUTQ, ethanolamine utilization protein; structural 96.3
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 96.26
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 96.18
3d82_A102 Cupin 2, conserved barrel domain protein; structur 95.93
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 95.86
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 95.82
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 95.81
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 95.78
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 95.78
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 95.76
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 95.7
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 95.66
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 95.64
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 95.6
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 95.53
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 95.52
3rns_A227 Cupin 2 conserved barrel domain protein; structura 95.41
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 95.33
1sef_A274 Conserved hypothetical protein; structural genomic 95.11
3bcw_A123 Uncharacterized protein; structural genomics, join 95.04
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 94.69
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 93.64
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 93.39
3rns_A227 Cupin 2 conserved barrel domain protein; structura 92.81
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 92.42
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 92.01
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 91.89
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 91.68
1sfn_A246 Conserved hypothetical protein; structural genomic 91.07
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 88.67
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 88.38
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 87.79
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 87.45
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro 86.79
1zx5_A300 Mannosephosphate isomerase, putative; STRU genomic 86.01
1qwr_A319 Mannose-6-phosphate isomerase; structural genomics 85.09
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 84.6
4diq_A 489 Lysine-specific demethylase NO66; structural genom 83.83
3al5_A338 HTYW5, JMJC domain-containing protein C2ORF60; tRN 83.74
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 82.42
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 82.37
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 81.97
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 81.78
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 80.22
2wfp_A394 Mannose-6-phosphate isomerase; APO-structure, meta 80.03
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
Probab=99.92  E-value=2.3e-25  Score=180.59  Aligned_cols=82  Identities=18%  Similarity=0.269  Sum_probs=72.3

Q ss_pred             CCCceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCC---CC--CCceeecCCCcc--------------
Q 038528            6 EDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTED---DS--YFEPVIGAYTSI--------------   66 (91)
Q Consensus         6 ~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~---~~--~~~~flag~~~~--------------   66 (91)
                      +.+||+++||+|||++||||+++|+||+|+.   +|++++++||+|.   +|  ++.|||||+..+              
T Consensus       168 d~hqkv~~vr~GDviaiPaG~~~w~yN~G~~---~l~iv~~~Dt~n~~NQld~~~r~F~LAGn~~~~~~~~~~~~~~~~~  244 (531)
T 3fz3_A          168 DRHQKTRRIREGDVVAIPAGVAYWSYNDGDQ---ELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQG  244 (531)
T ss_dssp             CEESCCEEEETTEEEEECTTCCEEEECCSSS---CEEEEEEEETTCTTCCSCSSCCEEESSSCCCCTTCC----------
T ss_pred             ccceeeecccCCcEEEECCCCeEEEEeCCCc---eEEEEEEEccccccccCCCccceeEEcCCCcccccccccccccccc
Confidence            3479999999999999999999999999986   8999999999885   44  377899998422              


Q ss_pred             ------------------------CceecccCHHHHHHHhCCCccccc
Q 038528           67 ------------------------SDLILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        67 ------------------------~ni~~GF~~~iL~~Af~v~~~~i~   90 (91)
                                              +|||+|||+++|++||||+.++++
T Consensus       245 ~~~~~~~~~~~~~~~~~~~~~~~~~nifsGFs~e~La~A~~v~~~~a~  292 (531)
T 3fz3_A          245 EQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETAR  292 (531)
T ss_dssp             ----------------------CCSSGGGGSCHHHHHHHHTSCHHHHH
T ss_pred             cccccccccccccccchhhhcccCCCeeecCCHHHHHHHHCCCHHHHH
Confidence                                    489999999999999999999875
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Back     alignment and structure
>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 91
d1uija1170 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea 2e-10
d1uika1203 b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb 4e-10
d2phla1200 b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc 5e-10
d1dgwa_178 b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( 5e-09
d2phla2162 b.82.1.2 (A:220-381) Seed storage 7S protein {Fren 1e-05
d1uika2185 b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb 0.003
g1dgw.1168 b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea 0.003
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Seed storage 7S protein
species: Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]

 Score = 51.8 bits (124), Expect = 2e-10
 Identities = 16/83 (19%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 1   MSWADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVI 60
           ++  + DD  + ++  GD  R+  G+ +Y+ +  + +  K+   AI  N     Y +  +
Sbjct: 77  LTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKMIWLAIPVNK-PGRYDDFFL 135

Query: 61  GAYTSISDLILGFDRKVLQSAFK 83
            +  +    + GF   +L+++F 
Sbjct: 136 SSTQAQQSYLQGFSHNILETSFH 158
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 99.95
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 99.94
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 99.93
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 99.92
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 99.91
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 99.9
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 99.75
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 99.67
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 99.67
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 99.6
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 99.46
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 99.25
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 99.22
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 98.69
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 98.06
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 97.94
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 97.85
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 97.85
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 97.82
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 97.77
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 97.44
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 97.3
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 97.28
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 97.27
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 97.03
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 96.97
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 96.92
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 96.86
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 96.75
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 96.63
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 96.55
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 96.42
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 96.28
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 96.12
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 96.03
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 95.83
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 95.81
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 95.7
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 95.48
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 95.04
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 94.84
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 94.29
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 94.27
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 94.13
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 93.82
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 93.58
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 93.19
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 89.66
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 88.2
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 87.73
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 86.31
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 84.87
d1pmia_440 Phosphomannose isomerase {Yeast (Candida albicans) 80.64
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Seed storage 7S protein
species: Soybean (Glycine max), proglycinin [TaxId: 3847]

Probab=99.95  E-value=1.1e-28  Score=182.02  Aligned_cols=82  Identities=13%  Similarity=0.261  Sum_probs=72.6

Q ss_pred             CCCceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCCC---C--CCceeecCCCcc--------------
Q 038528            6 EDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDD---S--YFEPVIGAYTSI--------------   66 (91)
Q Consensus         6 ~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~~---~--~~~~flag~~~~--------------   66 (91)
                      +.++|+++||+||||+||||+++|+||++|.   +|++|+|+|++|..   |  .++|||||+..+              
T Consensus       100 d~~qk~~~lr~GDVi~iPAG~~~w~~N~gn~---~Lv~v~~~d~~n~~NQLd~~~r~F~laG~~~~e~~~~~~~~~~~~~  176 (239)
T d1fxza1         100 DRHQKIYNFREGDLIAVPTGVAWWMYNNEDT---PVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQS  176 (239)
T ss_dssp             -CCCCEEEECTTEEEEECTTCEEEEEECSSS---CEEEEEEECTTCTTCCSCSSCCEEESSSSCCCTTHHHHC-------
T ss_pred             hhhhhhhccccCCEEEecCCceEEEEeCCCC---cEEEEEEeccccccccccccceeeeccCCccccccccccccccccc
Confidence            5689999999999999999999999999875   89999999999863   4  367899998544              


Q ss_pred             -------------CceecccCHHHHHHHhCCCccccc
Q 038528           67 -------------SDLILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        67 -------------~ni~~GF~~~iL~~Af~v~~~~i~   90 (91)
                                   .|||+|||+++||+||||+.|+|+
T Consensus       177 ~~~~~~~~~~~~~~ni~~gFs~~~La~Afnv~~e~~~  213 (239)
T d1fxza1         177 QKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAK  213 (239)
T ss_dssp             ------------CCCGGGGSCHHHHHHHHTCCHHHHH
T ss_pred             ccccccccccccCCCcccccCHHHHHHHHCcCHHHHH
Confidence                         399999999999999999999875
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure