Citrus Sinensis ID: 038601

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MGRKCSHCGNTGHNSRTCSSYDNNLKGGSCSTSTLAGGLRLFGVQLAISSNSSSSSSSQLLPLKKSLSTDSFPAIPSPSSSASSSSSTGVTINIDQHSNKLSNGYISDSLIAPTQDRKKGVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKNLYKRKRRPSLFDVMPWAWFLLVLLGLY
ccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccc
ccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccHHHHHHHHHHHHHHccccccccccccEEcccHHHHHHHHHHHHHHHcccccHccccHHHHHcHHHHHHHHHHccc
mgrkcshcgntghnsrtcssydnnlkggscststlagGLRLFGVQLAIssnsssssssqllplkkslstdsfpaipspsssassssstgvtinidqhsnklsngyisdsliaptqdrkkgvpwteEEHRVFLMGLeklgrgdwrgisknfvttrtptqvASHAQKYFLRQKnlykrkrrpslfdvmPWAWFLLVLLGLY
mgrkcshcgntghnsrtcssydnnLKGGSCSTSTLAGGLRLFGVQLAISSnsssssssqlLPLKKSLSTDSFPAIpspsssassssstGVTINIDQHSNKLSNgyisdsliaptqdrkkgvpwTEEEHRVFLMgleklgrgdwRGISKNFvttrtptqvashaqkyflrqknlykrkrrpslfdvmpwAWFLLVLLGLY
MGRKCSHCGNTGHNSRTCSSYDNNLKGGSCSTSTLAGGLRLFGVQLAIssnsssssssqllplkkslsTDsfpaipspsssasssssTGVTINIDQHSNKLSNGYISDSLIAPTQDRKKGVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKNLYKRKRRPSLFDVMPWAWFLLVLLGLY
********************************STLAGGLRLFGVQLA**********************************************************I*************GVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKNLYKRKRRPSLFDVMPWAWFLLVLLGL*
*GRKCSHCGNTGHNSRTC*******************GLRLFGVQ********************************************************************************EEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQK*******************VMPWAWFLLVLLGLY
*************NSRTCSSYDNNLKGGSCSTSTLAGGLRLFGVQLAI****************KSLSTD*******************VTINIDQHSNKLSNGYISDSLIAPTQDRKKGVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKNLYKRKRRPSLFDVMPWAWFLLVLLGLY
***********************************AGGLRLFGVQLAIS*********************************************************************KGVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKN****KRRPSLFDVMPWAWFLLVLLGLY
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRKCSHCGNTGHNSRTCSSYDNNLKGGSCSTSTLAGGLRLFGVQLAISSNSSSSSSSQLLPLKKSLSTDSFPAIPSPSSSASSSSSTGVTINIDQHSNKLSNGYISDSLIAPTQDRKKGVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKNLYKRKRRPSLFDVMPWAWFLLVLLGLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q8S9H7307 Transcription factor DIVA N/A no 0.356 0.231 0.732 4e-26
Q2V9B0 297 Transcription factor MYB1 N/A no 0.668 0.447 0.436 2e-22
Q869R9 734 Myb-like protein J OS=Dic yes no 0.276 0.074 0.589 5e-13
Q54HX6 977 Myb-like protein I OS=Dic no no 0.276 0.056 0.5 7e-09
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.261 0.042 0.418 7e-07
Q6R0H0 287 Transcription factor ASG4 no no 0.512 0.355 0.363 2e-06
Q54IF9 423 Myb-like protein G OS=Dic no no 0.241 0.113 0.509 3e-06
P92973 608 Protein CCA1 OS=Arabidops no no 0.216 0.070 0.488 9e-05
Q86HX9 894 Myb-like protein K OS=Dic no no 0.241 0.053 0.428 0.0001
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.226 0.069 0.446 0.0002
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function desciption
 Score =  117 bits (294), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%)

Query: 115 QDRKKGVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKNLY 174
           Q+RKKGVPWTEEEH++FLMGL+K G+GDWR IS+NFV TRTPTQVASHAQKYF+RQ +  
Sbjct: 126 QERKKGVPWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKYFIRQLSGG 185

Query: 175 KRKRRPSLFDV 185
           K KRR S+ D+
Sbjct: 186 KDKRRASIHDI 196
Involved in the dorsovental asymmetry of flowers. Promotes ventral identity.
Antirrhinum majus (taxid: 4151)
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function description
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description
>sp|Q86HX9|MYBK_DICDI Myb-like protein K OS=Dictyostelium discoideum GN=mybK PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
147841179297 hypothetical protein VITISV_041371 [Viti 0.839 0.562 0.629 5e-52
225444961297 PREDICTED: uncharacterized protein LOC10 0.839 0.562 0.629 6e-52
225429476211 PREDICTED: transcription factor MYB1R1 [ 0.909 0.857 0.607 4e-51
125551147287 hypothetical protein OsI_18777 [Oryza sa 0.894 0.620 0.556 1e-48
156481280260 putative MYB transcription factor [Avice 0.849 0.65 0.620 9e-48
351721742267 MYB transcription factor MYB127 [Glycine 0.814 0.606 0.575 2e-47
115462527287 Os05g0195700 [Oryza sativa Japonica Grou 0.894 0.620 0.551 5e-47
388517307279 unknown [Lotus japonicus] 0.814 0.580 0.591 1e-46
356513215266 PREDICTED: transcription factor MYB1R1 [ 0.798 0.597 0.586 2e-46
388512427277 unknown [Lotus japonicus] 0.829 0.595 0.580 2e-46
>gi|147841179|emb|CAN66264.1| hypothetical protein VITISV_041371 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 117/186 (62%), Positives = 140/186 (75%), Gaps = 19/186 (10%)

Query: 1   MGRKCSHCGNTGHNSRTCSSYDNNLKGGSCSTSTLAGGLRLFGVQLAISSNSSSSSSSQL 60
           MGRKCSHCGN GHNSRTC SY    KG      T+ GGLRLFGVQL +SS+S        
Sbjct: 1   MGRKCSHCGNIGHNSRTCISY----KG------TVVGGLRLFGVQLDLSSSS-------- 42

Query: 61  LPLKKSLSTDSFPAIPSPSSSASSSSSTGVTINIDQHSNKLSNGYISDSLIAPTQDRKKG 120
           + +KKS S +S P+  + SS + SSS     +++D++S+K  NGY+SD LIA +Q+RKKG
Sbjct: 43  IAMKKSFSMESLPSSLA-SSPSPSSSLCSSRVSMDENSDKAMNGYLSDGLIARSQERKKG 101

Query: 121 VPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKNLYKRKRRP 180
           VPWTEEEHR FL GLEKLG+GDWRGIS+NFVTTRTPTQVASHAQKYFLRQ  L K+KRR 
Sbjct: 102 VPWTEEEHRTFLAGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQATLSKKKRRS 161

Query: 181 SLFDVM 186
           SLFD++
Sbjct: 162 SLFDMV 167

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225444961|ref|XP_002282498.1| PREDICTED: uncharacterized protein LOC100247499 [Vitis vinifera] gi|297738685|emb|CBI27930.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225429476|ref|XP_002277676.1| PREDICTED: transcription factor MYB1R1 [Vitis vinifera] gi|296081626|emb|CBI20631.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|125551147|gb|EAY96856.1| hypothetical protein OsI_18777 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|156481280|gb|ABU68406.1| putative MYB transcription factor [Avicennia marina] Back     alignment and taxonomy information
>gi|351721742|ref|NP_001235940.1| MYB transcription factor MYB127 [Glycine max] gi|110931712|gb|ABH02855.1| MYB transcription factor MYB127 [Glycine max] Back     alignment and taxonomy information
>gi|115462527|ref|NP_001054863.1| Os05g0195700 [Oryza sativa Japonica Group] gi|47777439|gb|AAT38072.1| putative Myb-related transcription factor [Oryza sativa Japonica Group] gi|113578414|dbj|BAF16777.1| Os05g0195700 [Oryza sativa Japonica Group] gi|215686728|dbj|BAG89578.1| unnamed protein product [Oryza sativa Japonica Group] gi|215692499|dbj|BAG87919.1| unnamed protein product [Oryza sativa Japonica Group] gi|222630506|gb|EEE62638.1| hypothetical protein OsJ_17441 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|388517307|gb|AFK46715.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356513215|ref|XP_003525309.1| PREDICTED: transcription factor MYB1R1 [Glycine max] Back     alignment and taxonomy information
>gi|388512427|gb|AFK44275.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
TAIR|locus:2165106233 AT5G56840 [Arabidopsis thalian 0.417 0.356 0.714 4.6e-40
TAIR|locus:2171519 365 AT5G47390 [Arabidopsis thalian 0.427 0.232 0.681 4.5e-38
TAIR|locus:2020653261 AT1G70000 [Arabidopsis thalian 0.422 0.321 0.655 5.1e-37
TAIR|locus:2094942 387 AT3G16350 [Arabidopsis thalian 0.457 0.235 0.602 5.7e-36
TAIR|locus:2151621 317 AT5G61620 [Arabidopsis thalian 0.422 0.264 0.654 5.5e-32
TAIR|locus:2011216 285 AT1G19000 [Arabidopsis thalian 0.427 0.298 0.617 1.4e-27
TAIR|locus:2027181265 AT1G74840 [Arabidopsis thalian 0.457 0.343 0.587 1.2e-26
TAIR|locus:2042872298 AT2G38090 [Arabidopsis thalian 0.351 0.234 0.757 1.8e-25
UNIPROTKB|Q8S9H7307 DIVARICATA "Transcription fact 0.356 0.231 0.732 3.6e-25
TAIR|locus:2154508288 AT5G58900 [Arabidopsis thalian 0.371 0.256 0.702 3.6e-25
TAIR|locus:2165106 AT5G56840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 324 (119.1 bits), Expect = 4.6e-40, Sum P(2) = 4.6e-40
 Identities = 60/84 (71%), Positives = 71/84 (84%)

Query:   104 GYISDSLIAPTQDRKKGVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHA 163
             GY+SD L   T DRKKGVPWT EEHR FL+GLEKLG+GDWRGIS+NFV T++PTQVASHA
Sbjct:    74 GYLSDGLAHKTPDRKKGVPWTAEEHRTFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHA 133

Query:   164 QKYFLRQKN-LYKRKRRPSLFDVM 186
             QKYFLRQ   L+ ++RR SLFD++
Sbjct:   134 QKYFLRQTTTLHHKRRRTSLFDMV 157
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2171519 AT5G47390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020653 AT1G70000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094942 AT3G16350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151621 AT5G61620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011216 AT1G19000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027181 AT1G74840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2154508 AT5G58900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 6e-19
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 5e-09
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 2e-04
COG5114 432 COG5114, COG5114, Histone acetyltransferase comple 0.002
PLN03162 526 PLN03162, PLN03162, golden-2 like transcription fa 0.003
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 76.3 bits (188), Expect = 6e-19
 Identities = 26/57 (45%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 118 KKGVPWTEEEHRVFLMGLEKLGRGDW---RGISKNFVTTR-TPTQVASHAQKYFLRQ 170
           K  V WTE+ H  FL  ++KLG  DW   + I +  V    T  QVASH QKY L+Q
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|227445 COG5114, COG5114, Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|178707 PLN03162, PLN03162, golden-2 like transcription factor; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.73
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.6
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.34
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.33
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.15
PLN03212 249 Transcription repressor MYB5; Provisional 98.99
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.94
PLN03091 459 hypothetical protein; Provisional 98.86
PLN03212249 Transcription repressor MYB5; Provisional 98.75
KOG0048 238 consensus Transcription factor, Myb superfamily [T 98.66
PLN03091 459 hypothetical protein; Provisional 98.66
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.54
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 98.36
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.22
KOG0049 939 consensus Transcription factor, Myb superfamily [T 98.18
KOG0724335 consensus Zuotin and related molecular chaperones 98.1
KOG1279 506 consensus Chromatin remodeling factor subunit and 98.03
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.69
KOG4329445 consensus DNA-binding protein [General function pr 97.42
PLN03162 526 golden-2 like transcription factor; Provisional 97.13
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.88
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.64
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 95.79
KOG3841 455 consensus TEF-1 and related transcription factor, 95.71
KOG4468 782 consensus Polycomb-group transcriptional regulator 95.7
KOG4167 907 consensus Predicted DNA-binding protein, contains 95.64
COG5147 512 REB1 Myb superfamily proteins, including transcrip 95.62
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 95.51
smart0042668 TEA TEA domain. 95.39
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 95.27
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 95.11
KOG0051 607 consensus RNA polymerase I termination factor, Myb 95.08
KOG0051607 consensus RNA polymerase I termination factor, Myb 94.78
COG5147 512 REB1 Myb superfamily proteins, including transcrip 94.41
PF1439249 zf-CCHC_4: Zinc knuckle 94.16
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 94.11
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.96
PF1528840 zf-CCHC_6: Zinc knuckle 93.9
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 93.89
KOG0724 335 consensus Zuotin and related molecular chaperones 93.81
KOG4282 345 consensus Transcription factor GT-2 and related pr 93.63
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 92.56
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 92.41
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 90.22
PLN031421033 Probable chromatin-remodeling complex ATPase chain 88.3
smart0034326 ZnF_C2HC zinc finger. 87.55
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 87.07
PRK13923170 putative spore coat protein regulator protein YlbO 86.54
KOG1194 534 consensus Predicted DNA-binding protein, contains 85.94
PF0450498 DUF573: Protein of unknown function, DUF573; Inter 81.0
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.73  E-value=5.3e-18  Score=119.17  Aligned_cols=53  Identities=49%  Similarity=0.717  Sum_probs=47.4

Q ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCCh---hhhhhhhcCCC-CHHHHHHHHHHHHHHh
Q 038601          118 KKGVPWTEEEHRVFLMGLEKLGRGDW---RGISKNFVTTR-TPTQVASHAQKYFLRQ  170 (199)
Q Consensus       118 kk~~~WTeEEh~~FLegL~kyGkGdW---k~IAr~~V~TR-T~~QVrsHaQKYf~rl  170 (199)
                      |++..||+|||.+||+||+.||.|+|   +.|++.++.++ |+.||++|+||||+++
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k~   57 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ   57 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHccC
Confidence            45789999999999999999999999   99996445578 9999999999999863

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF04504 DUF573: Protein of unknown function, DUF573; InterPro: IPR007592 This is a family of uncharacterised proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
2cu7_A72 Solution Structure Of The Sant Domain Of Human Kiaa 6e-04
>pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 Back     alignment and structure 
Iteration: 1

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
Query: 121 VPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYF 167
           V WT EE  +F  GL K GR  W  ISK  + +RT  QV S+A++YF
Sbjct: 10  VKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYF 54

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 2e-26
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 2e-20
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 1e-16
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 4e-15
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-12
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 6e-11
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 9e-10
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 7e-09
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 9e-09
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 1e-08
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-08
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 1e-06
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-06
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 6e-06
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 2e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 6e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 9e-05
2crg_A70 Metastasis associated protein MTA3; transcription 4e-04
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 6e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 95.6 bits (238), Expect = 2e-26
 Identities = 25/70 (35%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 112 APTQDRKKGVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQK 171
             +      V WT EE  +F  GL K GR  W  ISK  + +RT  QV S+A++YF  + 
Sbjct: 1   GSSGSSGYSVKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYFKNKV 58

Query: 172 NLYKRKRRPS 181
                K  P+
Sbjct: 59  KCGLDKETPN 68
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Length = 374 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.74
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.65
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.64
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.64
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.61
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.6
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.58
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.55
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.52
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.51
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.49
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.49
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.48
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.46
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.41
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.41
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.06
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.34
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.31
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.31
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.31
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.3
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.28
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.27
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.26
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.26
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.25
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.25
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.24
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.23
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.23
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.22
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.22
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.18
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.17
2crg_A70 Metastasis associated protein MTA3; transcription 99.16
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.15
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.12
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.11
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.06
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.02
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.9
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.84
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.83
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.74
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.11
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.58
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.55
1ofc_X 304 ISWI protein; nuclear protein, chromatin remodelin 97.54
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 97.46
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.34
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.05
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.94
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.83
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.55
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.22
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 95.91
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.56
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 95.03
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 94.46
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.0
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 93.7
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 91.44
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 90.46
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 87.6
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 87.08
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 86.91
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 86.61
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 85.93
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 85.17
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 84.86
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 84.18
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 83.52
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 83.37
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 82.5
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 80.7
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.74  E-value=4.5e-18  Score=121.13  Aligned_cols=65  Identities=37%  Similarity=0.551  Sum_probs=60.6

Q ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCChhhhhhhhcCCCCHHHHHHHHHHHHHHhhhhccCCCCCCccc
Q 038601          118 KKGVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKNLYKRKRRPSLFD  184 (199)
Q Consensus       118 kk~~~WTeEEh~~FLegL~kyGkGdWk~IAr~~V~TRT~~QVrsHaQKYf~rl~~~~K~krr~Sl~D  184 (199)
                      .+..+||+|||++|++++++||. +|..|| .+|++||+.||++||++||.+..+....+++++|++
T Consensus         7 ~~~~~WT~eEd~~l~~~~~~~G~-~W~~Ia-~~~~~Rt~~q~k~r~~~~l~~~~~~g~~~~~~si~s   71 (72)
T 2cu7_A            7 GYSVKWTIEEKELFEQGLAKFGR-RWTKIS-KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKT   71 (72)
T ss_dssp             SCCCCCCHHHHHHHHHHHHHTCS-CHHHHH-HHHSSSCHHHHHHHHHHHHHHHSCSCTTCCCSCCCC
T ss_pred             cCCCCCCHHHHHHHHHHHHHHCc-CHHHHH-HHcCCCCHHHHHHHHHHHHHHHHhcCCCCCcccccc
Confidence            45789999999999999999999 999999 599999999999999999999988788899999886
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 1e-19
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 8e-17
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-13
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 4e-09
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-07
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-05
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-05
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-04
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 5e-04
d1ofcx152 a.4.1.3 (X:799-850) SANT domain of the nucleosome 9e-04
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.001
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 76.5 bits (188), Expect = 1e-19
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 3/63 (4%)

Query: 114 TQDRKKGVPWTEEEHRVFLMGLEKLGRGDWR--GISKN-FVTTRTPTQVASHAQKYFLRQ 170
           T  +K  V WT E H  FL  ++ LG        I     V   T   VASH QK+ +  
Sbjct: 1   TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVAL 60

Query: 171 KNL 173
           K +
Sbjct: 61  KKV 63
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.7
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.63
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.59
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.57
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.57
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.51
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.46
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.46
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.46
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.46
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.45
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.44
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.38
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.21
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.19
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.77
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.65
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 98.0
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.32
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.46
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 94.47
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 92.89
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 90.03
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 88.22
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 86.72
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Transcriptional adaptor 2-like, TADA2L, isoform b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.70  E-value=6.6e-18  Score=111.23  Aligned_cols=45  Identities=31%  Similarity=0.657  Sum_probs=43.5

Q ss_pred             CCCHHHHHHHHHHHHHhCCCChhhhhhhhcCCCCHHHHHHHHHHHH
Q 038601          122 PWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYF  167 (199)
Q Consensus       122 ~WTeEEh~~FLegL~kyGkGdWk~IAr~~V~TRT~~QVrsHaQKYf  167 (199)
                      .||+|||.+|+++|++||.++|..|| ++|++||+.||+.||++||
T Consensus         3 ~Wt~eEd~~L~~~v~~~G~~nW~~Ia-~~~~~Rt~~Qcr~r~~~~f   47 (47)
T d1x41a1           3 SWTAQEEMALLEAVMDCGFGNWQDVA-NQMCTKTKEECEKHYMKYF   47 (47)
T ss_dssp             SSCHHHHHHHHHHHHHTCTTCHHHHH-HHHTTSCHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHCCccHHHHH-HHcCCCCHHHHHHHHHHhC
Confidence            59999999999999999999999999 6999999999999999997
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure