Citrus Sinensis ID: 038643


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--
NVGVVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASLMERKHTFRMN
ccHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHcccccccccccc
cccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHccccccccEEEcc
NVGVVADISASVDWLKangskkvgmVGYCMGSALTIACSASLMErkhtfrmn
NVGVVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASLMERKHTFRMN
NVGVVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASLMERKHTFRMN
***VVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASL**********
***V**DISASVDWLKANGSKKVGMVGYCMGSALTIACSASLMER*******
NVGVVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASLMERKHTFRMN
NVGVVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASLMERKHTF***
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooo
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NVGVVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASLMERKHTFRMN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query52
359485615 277 PREDICTED: putative uncharacterized prot 0.807 0.151 0.690 6e-08
147809484 243 hypothetical protein VITISV_041925 [Viti 0.807 0.172 0.690 6e-08
125526269 282 hypothetical protein OsI_02273 [Oryza sa 0.807 0.148 0.666 1e-07
115437234 281 Os01g0531500 [Oryza sativa Japonica Grou 0.807 0.149 0.666 1e-07
449453509 280 PREDICTED: protein usf-like isoform 1 [C 0.711 0.132 0.756 2e-07
388516257 276 unknown [Medicago truncatula] 0.711 0.134 0.729 2e-07
449453511 241 PREDICTED: protein usf-like isoform 2 [C 0.711 0.153 0.756 2e-07
388498450 240 unknown [Lotus japonicus] 0.807 0.175 0.642 2e-07
255629231 162 unknown [Glycine max] 0.807 0.259 0.666 2e-07
449532176 224 PREDICTED: protein usf-like, partial [Cu 0.711 0.165 0.756 2e-07
>gi|359485615|ref|XP_002269740.2| PREDICTED: putative uncharacterized protein yghX-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 61.6 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (78%)

Query: 3   GVVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASLME 44
           G V DI ASV+WLKANGS+KVG+ GYCMG AL+IA S  L E
Sbjct: 125 GAVKDICASVNWLKANGSQKVGVTGYCMGGALSIASSVLLPE 166




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147809484|emb|CAN60148.1| hypothetical protein VITISV_041925 [Vitis vinifera] Back     alignment and taxonomy information
>gi|125526269|gb|EAY74383.1| hypothetical protein OsI_02273 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115437234|ref|NP_001043244.1| Os01g0531500 [Oryza sativa Japonica Group] gi|20521349|dbj|BAB91862.1| carboxymethylenebutenolidase-like protein [Oryza sativa Japonica Group] gi|113532775|dbj|BAF05158.1| Os01g0531500 [Oryza sativa Japonica Group] gi|215741146|dbj|BAG97641.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|449453509|ref|XP_004144499.1| PREDICTED: protein usf-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|388516257|gb|AFK46190.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449453511|ref|XP_004144500.1| PREDICTED: protein usf-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|388498450|gb|AFK37291.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255629231|gb|ACU14960.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449532176|ref|XP_004173058.1| PREDICTED: protein usf-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query52
TAIR|locus:2060257 239 AT2G32520 [Arabidopsis thalian 0.807 0.175 0.619 8e-09
TAIR|locus:2060257 AT2G32520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 134 (52.2 bits), Expect = 8.0e-09, P = 8.0e-09
 Identities = 26/42 (61%), Positives = 31/42 (73%)

Query:     3 GVVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASLME 44
             G + DI ASV+WLK+NGSKKVG+ G CMG AL IA S  + E
Sbjct:    88 GAIKDIRASVNWLKSNGSKKVGVTGMCMGGALAIASSVLVPE 129


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.128   0.383    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       52        52   0.00091  102 3  11 22  0.37    27
                                                     29  0.47    26


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  481 (51 KB)
  Total size of DFA:  81 KB (2063 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  5.27u 0.24s 5.51t   Elapsed:  00:00:01
  Total cpu time:  5.27u 0.24s 5.51t   Elapsed:  00:00:01
  Start:  Mon May 20 19:18:20 2013   End:  Mon May 20 19:18:21 2013


GO:0005737 "cytoplasm" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016747 "transferase activity, transferring acyl groups other than amino-acyl groups" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=IDA
GO:0010043 "response to zinc ion" evidence=IEP
GO:0005829 "cytosol" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query52
pfam01738215 pfam01738, DLH, Dienelactone hydrolase family 2e-06
COG0412236 COG0412, COG0412, Dienelactone hydrolase and relat 5e-06
>gnl|CDD|216672 pfam01738, DLH, Dienelactone hydrolase family Back     alignment and domain information
 Score = 41.6 bits (98), Expect = 2e-06
 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 3/40 (7%)

Query: 4   VVADISASVDWLKANG---SKKVGMVGYCMGSALTIACSA 40
           VV D+ A++++L+      +KKVG+VG+C+G  L    +A
Sbjct: 78  VVDDLLAAINYLRGQPYVDTKKVGVVGFCLGGRLAFLLAA 117


Length = 215

>gnl|CDD|223489 COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 52
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.21
PF00561 230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 99.21
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.18
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.16
PLN02298 330 hydrolase, alpha/beta fold family protein 99.13
PLN02824 294 hydrolase, alpha/beta fold family protein 99.09
PF08840 213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 99.08
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.07
PF00326 213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.07
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.06
PRK10749 330 lysophospholipase L2; Provisional 99.06
PRK10673 255 acyl-CoA esterase; Provisional 99.06
PHA02857 276 monoglyceride lipase; Provisional 99.06
PLN02965 255 Probable pheophorbidase 99.05
PRK10566 249 esterase; Provisional 99.04
PLN02385 349 hydrolase; alpha/beta fold family protein 99.02
PRK00870 302 haloalkane dehalogenase; Provisional 99.0
PRK03592 295 haloalkane dehalogenase; Provisional 98.99
PRK13604 307 luxD acyl transferase; Provisional 98.99
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.97
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 98.96
PRK08775 343 homoserine O-acetyltransferase; Provisional 98.95
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.95
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 98.94
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 98.93
PRK10349 256 carboxylesterase BioH; Provisional 98.93
PRK07581 339 hypothetical protein; Validated 98.92
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 98.92
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.9
PLN02211 273 methyl indole-3-acetate methyltransferase 98.89
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 98.89
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 98.88
PLN02894 402 hydrolase, alpha/beta fold family protein 98.88
COG1647 243 Esterase/lipase [General function prediction only] 98.86
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 98.86
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.85
PLN02578 354 hydrolase 98.84
PLN02511 388 hydrolase 98.84
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.84
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.84
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 98.82
KOG4409 365 consensus Predicted hydrolase/acyltransferase (alp 98.81
PRK05077 414 frsA fermentation/respiration switch protein; Revi 98.8
PRK10985 324 putative hydrolase; Provisional 98.8
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 98.8
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.8
PRK06489 360 hypothetical protein; Provisional 98.8
PF12715 390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 98.78
PRK03204 286 haloalkane dehalogenase; Provisional 98.78
PF09752 348 DUF2048: Uncharacterized conserved protein (DUF204 98.76
PRK06765 389 homoserine O-acetyltransferase; Provisional 98.76
PLN02679 360 hydrolase, alpha/beta fold family protein 98.76
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 98.75
PRK11460232 putative hydrolase; Provisional 98.74
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.73
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 98.73
PLN02652 395 hydrolase; alpha/beta fold family protein 98.69
KOG1455 313 consensus Lysophospholipase [Lipid transport and m 98.68
KOG1552258 consensus Predicted alpha/beta hydrolase [General 98.67
TIGR02821 275 fghA_ester_D S-formylglutathione hydrolase. This m 98.66
PF10503220 Esterase_phd: Esterase PHB depolymerase 98.66
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 98.66
COG2945210 Predicted hydrolase of the alpha/beta superfamily 98.66
PRK11071190 esterase YqiA; Provisional 98.66
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 98.65
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.65
PF02129 272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 98.63
KOG2564 343 consensus Predicted acetyltransferases and hydrola 98.6
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.6
KOG3043242 consensus Predicted hydrolase related to dienelact 98.6
PLN02442 283 S-formylglutathione hydrolase 98.58
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.58
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 98.54
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 98.53
PLN02872 395 triacylglycerol lipase 98.52
PLN00021 313 chlorophyllase 98.5
KOG1454 326 consensus Predicted hydrolase/acyltransferase (alp 98.49
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.49
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.48
PF07819 225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.47
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 98.46
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 98.45
PF06500 411 DUF1100: Alpha/beta hydrolase of unknown function 98.45
PRK07868 994 acyl-CoA synthetase; Validated 98.43
KOG4178 322 consensus Soluble epoxide hydrolase [Lipid transpo 98.42
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 98.42
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.41
PF00756 251 Esterase: Putative esterase; InterPro: IPR000801 T 98.39
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 98.37
PF06028 255 DUF915: Alpha/beta hydrolase of unknown function ( 98.37
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 98.33
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 98.29
KOG1838 409 consensus Alpha/beta hydrolase [General function p 98.27
PF10230 266 DUF2305: Uncharacterised conserved protein (DUF230 98.27
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 98.26
PF11187 224 DUF2974: Protein of unknown function (DUF2974); In 98.25
PRK10115 686 protease 2; Provisional 98.23
PRK10162 318 acetyl esterase; Provisional 98.23
PF07859 211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 98.2
PF00975 229 Thioesterase: Thioesterase domain; InterPro: IPR00 98.19
KOG2382 315 consensus Predicted alpha/beta hydrolase [General 98.18
KOG4391 300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 98.17
KOG3724 973 consensus Negative regulator of COPII vesicle form 98.16
COG2021 368 MET2 Homoserine acetyltransferase [Amino acid tran 98.16
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 98.15
PF08538 303 DUF1749: Protein of unknown function (DUF1749); In 98.12
COG3208 244 GrsT Predicted thioesterase involved in non-riboso 98.11
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 98.06
PRK05855 582 short chain dehydrogenase; Validated 98.02
PF01674 219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 98.01
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 98.0
PRK04940180 hypothetical protein; Provisional 97.98
KOG2984 277 consensus Predicted hydrolase [General function pr 97.96
PF03403 379 PAF-AH_p_II: Platelet-activating factor acetylhydr 97.94
PF05677 365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 97.92
COG3243 445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 97.89
COG3509 312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 97.86
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 97.86
PLN02454 414 triacylglycerol lipase 97.82
PLN02310 405 triacylglycerol lipase 97.81
PLN03037 525 lipase class 3 family protein; Provisional 97.8
KOG2281 867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 97.78
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 97.78
COG0400207 Predicted esterase [General function prediction on 97.77
PLN02162 475 triacylglycerol lipase 97.76
COG2936 563 Predicted acyl esterases [General function predict 97.76
COG3458 321 Acetyl esterase (deacetylase) [Secondary metabolit 97.75
COG3319 257 Thioesterase domains of type I polyketide synthase 97.75
PF05990 233 DUF900: Alpha/beta hydrolase of unknown function ( 97.73
COG0657 312 Aes Esterase/lipase [Lipid metabolism] 97.72
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 97.72
KOG2100 755 consensus Dipeptidyl aminopeptidase [Posttranslati 97.71
PLN00413 479 triacylglycerol lipase 97.71
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 97.7
PLN02571 413 triacylglycerol lipase 97.69
KOG1553 517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 97.66
PLN02934 515 triacylglycerol lipase 97.65
COG0627 316 Predicted esterase [General function prediction on 97.62
PF05057 217 DUF676: Putative serine esterase (DUF676); InterPr 97.61
PF00151 331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.61
PF07224 307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 97.6
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 97.58
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.57
PF12740 259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 97.53
TIGR01849 406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 97.52
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 97.51
PLN02408 365 phospholipase A1 97.51
COG4814 288 Uncharacterized protein with an alpha/beta hydrola 97.51
COG4188 365 Predicted dienelactone hydrolase [General function 97.5
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 97.48
PLN02753 531 triacylglycerol lipase 97.46
KOG2369 473 consensus Lecithin:cholesterol acyltransferase (LC 97.46
PLN02324 415 triacylglycerol lipase 97.44
COG4782 377 Uncharacterized protein conserved in bacteria [Fun 97.39
COG4099387 Predicted peptidase [General function prediction o 97.39
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 97.37
PLN02761 527 lipase class 3 family protein 97.37
PLN02719 518 triacylglycerol lipase 97.3
PLN02802 509 triacylglycerol lipase 97.3
COG1075 336 LipA Predicted acetyltransferases and hydrolases w 97.29
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 97.28
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 97.27
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 97.25
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 97.24
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 97.21
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 97.2
smart00824 212 PKS_TE Thioesterase. Peptide synthetases are invol 97.17
KOG3847 399 consensus Phospholipase A2 (platelet-activating fa 97.14
KOG4569 336 consensus Predicted lipase [Lipid transport and me 97.14
PLN02847 633 triacylglycerol lipase 97.11
KOG2624 403 consensus Triglyceride lipase-cholesterol esterase 97.07
KOG2112206 consensus Lysophospholipase [Lipid transport and m 97.01
KOG4667 269 consensus Predicted esterase [Lipid transport and 97.0
KOG3101 283 consensus Esterase D [General function prediction 96.99
PF00135 535 COesterase: Carboxylesterase family The prints ent 96.95
PF06342 297 DUF1057: Alpha/beta hydrolase of unknown function 96.93
KOG1551 371 consensus Uncharacterized conserved protein [Funct 96.92
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 96.87
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 96.84
COG1770 682 PtrB Protease II [Amino acid transport and metabol 96.79
KOG2237 712 consensus Predicted serine protease [Posttranslati 96.74
PF07082 250 DUF1350: Protein of unknown function (DUF1350); In 96.68
COG4757 281 Predicted alpha/beta hydrolase [General function p 96.66
KOG4627 270 consensus Kynurenine formamidase [Amino acid trans 96.58
PF11144 403 DUF2920: Protein of unknown function (DUF2920); In 96.47
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 96.37
COG5153 425 CVT17 Putative lipase essential for disintegration 96.33
KOG4540 425 consensus Putative lipase essential for disintegra 96.33
KOG1516 545 consensus Carboxylesterase and related proteins [G 96.23
PF02273 294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 96.19
COG3150 191 Predicted esterase [General function prediction on 96.18
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 96.14
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 96.09
KOG1515 336 consensus Arylacetamide deacetylase [Defense mecha 96.05
PF04301 213 DUF452: Protein of unknown function (DUF452); Inte 95.96
PF03583 290 LIP: Secretory lipase ; InterPro: IPR005152 This e 95.9
COG3673 423 Uncharacterized conserved protein [Function unknow 95.83
KOG3975 301 consensus Uncharacterized conserved protein [Funct 95.81
PF09994 277 DUF2235: Uncharacterized alpha/beta hydrolase doma 95.78
PF03096 283 Ndr: Ndr family; InterPro: IPR004142 This family c 95.75
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 95.72
PF08237 225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 95.7
COG1505 648 Serine proteases of the peptidase family S9A [Amin 95.69
KOG2931 326 consensus Differentiation-related gene 1 protein ( 95.66
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 95.58
PLN02606 306 palmitoyl-protein thioesterase 95.5
PLN02633 314 palmitoyl protein thioesterase family protein 95.46
PF10340 374 DUF2424: Protein of unknown function (DUF2424); In 95.22
PF02089 279 Palm_thioest: Palmitoyl protein thioesterase; Inte 95.11
KOG2029 697 consensus Uncharacterized conserved protein [Funct 94.77
KOG4840 299 consensus Predicted hydrolases or acyltransferases 94.54
KOG2541 296 consensus Palmitoyl protein thioesterase [Lipid tr 94.54
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 94.17
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 93.83
PF10142 367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 93.64
smart00827 298 PKS_AT Acyl transferase domain in polyketide synth 93.41
PF00698 318 Acyl_transf_1: Acyl transferase domain; InterPro: 93.39
cd07198 172 Patatin Patatin-like phospholipase. Patatin is a s 93.29
cd07225 306 Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domai 93.23
cd07207 194 Pat_ExoU_VipD_like ExoU and VipD-like proteins; ho 93.19
PRK10279 300 hypothetical protein; Provisional 93.06
PF03283 361 PAE: Pectinacetylesterase 93.06
TIGR03131 295 malonate_mdcH malonate decarboxylase, epsilon subu 92.99
TIGR03712 511 acc_sec_asp2 accessory Sec system protein Asp2. Th 92.95
KOG2565 469 consensus Predicted hydrolases or acyltransferases 92.92
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 92.85
cd07210 221 Pat_hypo_W_succinogenes_WS1459_like Hypothetical p 92.81
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 91.89
cd07209 215 Pat_hypo_Ecoli_Z1214_like Hypothetical patatin sim 91.74
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 91.57
cd07228 175 Pat_NTE_like_bacteria Bacterial patatin-like phosp 91.55
cd07227 269 Pat_Fungal_NTE1 Fungal patatin-like phospholipase 91.43
cd07205 175 Pat_PNPLA6_PNPLA7_NTE1_like Patatin-like phospholi 91.4
COG1752 306 RssA Predicted esterase of the alpha-beta hydrolas 91.29
TIGR00128 290 fabD malonyl CoA-acyl carrier protein transacylase 91.17
PLN02213 319 sinapoylglucose-malate O-sinapoyltransferase/ carb 91.0
KOG3967297 consensus Uncharacterized conserved protein [Funct 90.99
KOG2385 633 consensus Uncharacterized conserved protein [Funct 90.74
PRK05368 302 homoserine O-succinyltransferase; Provisional 90.44
COG4947227 Uncharacterized protein conserved in bacteria [Fun 90.33
PLN02209 437 serine carboxypeptidase 90.06
cd07208 266 Pat_hypo_Ecoli_yjju_like Hypothetical patatin simi 89.89
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 89.48
cd07230 421 Pat_TGL4-5_like Triacylglycerol lipase 4 and 5. TG 89.27
cd07224 233 Pat_like Patatin-like phospholipase. Patatin-like 89.15
cd07212 312 Pat_PNPLA9 Patatin-like phospholipase domain conta 89.12
KOG4372 405 consensus Predicted alpha/beta hydrolase [General 88.99
PLN03016 433 sinapoylglucose-malate O-sinapoyltransferase 88.92
PF05576 448 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 88.62
PF04263123 TPK_catalytic: Thiamin pyrophosphokinase, catalyti 86.09
cd07232 407 Pat_PLPL Patain-like phospholipase. Patatin-like p 86.04
PF14253270 AbiH: Bacteriophage abortive infection AbiH 85.14
cd07204 243 Pat_PNPLA_like Patatin-like phospholipase domain c 85.11
cd07229 391 Pat_TGL3_like Triacylglycerol lipase 3. Triacylgly 85.05
cd07222 246 Pat_PNPLA4 Patatin-like phospholipase domain conta 84.36
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 84.33
cd07211 308 Pat_PNPLA8 Patatin-like phospholipase domain conta 83.86
cd07220 249 Pat_PNPLA2 Patatin-like phospholipase domain conta 83.4
PRK05809 260 3-hydroxybutyryl-CoA dehydratase; Validated 83.16
PF04204 298 HTS: Homoserine O-succinyltransferase ; InterPro: 83.13
PF00378 245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 83.03
cd07218 245 Pat_iPLA2 Calcium-independent phospholipase A2; Cl 82.78
COG0331 310 FabD (acyl-carrier-protein) S-malonyltransferase [ 82.64
PRK08139 266 enoyl-CoA hydratase; Validated 82.45
PRK08150 255 enoyl-CoA hydratase; Provisional 82.24
PRK09076 258 enoyl-CoA hydratase; Provisional 82.2
PRK05981 266 enoyl-CoA hydratase; Provisional 82.19
cd07221 252 Pat_PNPLA3 Patatin-like phospholipase domain conta 81.65
PHA0173576 hypothetical protein 81.64
PF10081 289 Abhydrolase_9: Alpha/beta-hydrolase family; InterP 81.34
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 81.28
COG0084 256 TatD Mg-dependent DNase [DNA replication, recombin 81.18
PRK06142 272 enoyl-CoA hydratase; Provisional 81.11
cd07231 323 Pat_SDP1-like Sugar-Dependent 1 like lipase. Sugar 81.1
TIGR02802104 Pal_lipo peptidoglycan-associated lipoprotein. Mem 80.98
cd07995208 TPK Thiamine pyrophosphokinase. Thiamine pyrophosp 80.73
cd07206 298 Pat_TGL3-4-5_SDP1 Triacylglycerol lipase 3, 4, and 80.25
cd01819155 Patatin_and_cPLA2 Patatins and Phospholipases. Pat 80.2
COG1564212 THI80 Thiamine pyrophosphokinase [Coenzyme metabol 80.14
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 80.08
PRK06143 256 enoyl-CoA hydratase; Provisional 80.05
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
Probab=99.21  E-value=6.5e-11  Score=66.10  Aligned_cols=49  Identities=35%  Similarity=0.670  Sum_probs=44.5

Q ss_pred             hHHHHHHHHHHHHHhcC---CCcEEEEEEchHHHHHHHHHhhcCCceeEeee
Q 038643            3 GVVADISASVDWLKANG---SKKVGMVGYCMGSALTIACSASLMERKHTFRM   51 (52)
Q Consensus         3 ~~~~d~~~~~~~l~~~~---~~~i~l~G~S~GG~~a~~~a~~~p~~~~~~~~   51 (52)
                      ....|+.++++||++++   .++|+++|+||||.+++.++.+.|+..++++|
T Consensus        91 ~~~~d~~a~~~~L~~~~~~~~~~ig~~GfC~GG~~a~~~a~~~~~v~a~v~f  142 (236)
T COG0412          91 EVLADIDAALDYLARQPQVDPKRIGVVGFCMGGGLALLAATRAPEVKAAVAF  142 (236)
T ss_pred             HHHHHHHHHHHHHHhCCCCCCceEEEEEEcccHHHHHHhhcccCCccEEEEe
Confidence            56889999999999886   68899999999999999999998888888876



>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>COG3673 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09994 DUF2235: Uncharacterized alpha/beta hydrolase domain (DUF2235); InterPro: IPR018712 This domain has no known function Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>KOG2029 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>smart00827 PKS_AT Acyl transferase domain in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF00698 Acyl_transf_1: Acyl transferase domain; InterPro: IPR014043 Enzymes like bacterial malonyl CoA-acly carrier protein transacylase (2 Back     alignment and domain information
>cd07198 Patatin Patatin-like phospholipase Back     alignment and domain information
>cd07225 Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domain containing protein 6 and protein 7 Back     alignment and domain information
>cd07207 Pat_ExoU_VipD_like ExoU and VipD-like proteins; homologus to patatin, cPLA2, and iPLA2 Back     alignment and domain information
>PRK10279 hypothetical protein; Provisional Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>TIGR03131 malonate_mdcH malonate decarboxylase, epsilon subunit Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>cd07210 Pat_hypo_W_succinogenes_WS1459_like Hypothetical patatin similar to WS1459 of Wolinella succinogenes Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>cd07209 Pat_hypo_Ecoli_Z1214_like Hypothetical patatin similar to Z1214 protein of Escherichia coli Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07228 Pat_NTE_like_bacteria Bacterial patatin-like phospholipase domain containing protein 6 Back     alignment and domain information
>cd07227 Pat_Fungal_NTE1 Fungal patatin-like phospholipase domain containing protein 6 Back     alignment and domain information
>cd07205 Pat_PNPLA6_PNPLA7_NTE1_like Patatin-like phospholipase domain containing protein 6, protein 7, and fungal NTE1 Back     alignment and domain information
>COG1752 RssA Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only] Back     alignment and domain information
>TIGR00128 fabD malonyl CoA-acyl carrier protein transacylase Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2385 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>cd07208 Pat_hypo_Ecoli_yjju_like Hypothetical patatin similar to yjju protein of Escherichia coli Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>cd07230 Pat_TGL4-5_like Triacylglycerol lipase 4 and 5 Back     alignment and domain information
>cd07224 Pat_like Patatin-like phospholipase Back     alignment and domain information
>cd07212 Pat_PNPLA9 Patatin-like phospholipase domain containing protein 9 Back     alignment and domain information
>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04263 TPK_catalytic: Thiamin pyrophosphokinase, catalytic domain; InterPro: IPR007371 Thiamin pyrophosphokinase (TPK, 2 Back     alignment and domain information
>cd07232 Pat_PLPL Patain-like phospholipase Back     alignment and domain information
>PF14253 AbiH: Bacteriophage abortive infection AbiH Back     alignment and domain information
>cd07204 Pat_PNPLA_like Patatin-like phospholipase domain containing protein family Back     alignment and domain information
>cd07229 Pat_TGL3_like Triacylglycerol lipase 3 Back     alignment and domain information
>cd07222 Pat_PNPLA4 Patatin-like phospholipase domain containing protein 4 Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>cd07211 Pat_PNPLA8 Patatin-like phospholipase domain containing protein 8 Back     alignment and domain information
>cd07220 Pat_PNPLA2 Patatin-like phospholipase domain containing protein 2 Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>cd07218 Pat_iPLA2 Calcium-independent phospholipase A2; Classified as Group IVA-1 PLA2 Back     alignment and domain information
>COG0331 FabD (acyl-carrier-protein) S-malonyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07221 Pat_PNPLA3 Patatin-like phospholipase domain containing protein 3 Back     alignment and domain information
>PHA01735 hypothetical protein Back     alignment and domain information
>PF10081 Abhydrolase_9: Alpha/beta-hydrolase family; InterPro: IPR012037 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07231 Pat_SDP1-like Sugar-Dependent 1 like lipase Back     alignment and domain information
>TIGR02802 Pal_lipo peptidoglycan-associated lipoprotein Back     alignment and domain information
>cd07995 TPK Thiamine pyrophosphokinase Back     alignment and domain information
>cd07206 Pat_TGL3-4-5_SDP1 Triacylglycerol lipase 3, 4, and 5 and Sugar-Dependent 1 lipase Back     alignment and domain information
>cd01819 Patatin_and_cPLA2 Patatins and Phospholipases Back     alignment and domain information
>COG1564 THI80 Thiamine pyrophosphokinase [Coenzyme metabolism] Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query52
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 1e-08
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 1e-08
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 6e-04
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Length = 236 Back     alignment and structure
 Score = 47.3 bits (113), Expect = 1e-08
 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 4   VVADISASVDWLKANG--SKKVGMVGYCMGSALTIACSA 40
            V D+ A++ + +     + KVG+VGY +G AL    ++
Sbjct: 96  GVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAS 134


>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Length = 241 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Length = 305 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query52
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.32
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.3
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 99.3
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 99.26
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.25
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 99.25
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.25
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 99.24
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.24
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 99.24
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.24
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 99.24
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.23
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.23
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.23
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.23
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 99.22
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 99.22
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.22
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.22
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.21
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.21
1iup_A 282 META-cleavage product hydrolase; aromatic compound 99.21
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.2
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.2
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.19
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 99.19
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 99.19
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.19
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.19
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.18
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.18
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.18
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 99.18
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.18
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.17
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.17
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.17
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.17
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.16
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.16
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.16
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.16
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.15
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.15
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.15
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.15
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.15
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.14
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.14
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.14
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.12
3ds8_A 254 LIN2722 protein; unkonwn function, structural geno 99.12
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 99.11
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.11
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 99.11
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.11
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 99.11
1r3d_A 264 Conserved hypothetical protein VC1974; structural 99.11
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.1
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.1
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.1
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.1
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.09
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.09
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.09
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.09
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 99.09
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 99.08
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.08
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.08
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 99.08
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.08
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.08
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.07
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.07
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.07
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 99.07
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 99.07
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.07
3h04_A 275 Uncharacterized protein; protein with unknown func 99.06
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.06
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.06
3lp5_A 250 Putative cell surface hydrolase; structural genom 99.06
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 99.05
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 99.05
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.05
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.04
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.04
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 99.04
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 99.04
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.04
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 99.04
3llc_A 270 Putative hydrolase; structural genomics, joint cen 99.03
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.03
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 99.03
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 99.03
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 99.02
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.02
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.02
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.02
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 99.02
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.01
3fle_A 249 SE_1780 protein; structural genomics, APC61035.1, 99.01
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 99.0
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.0
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 99.0
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.0
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.0
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.99
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.99
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.99
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 98.98
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.98
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.98
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.98
4fle_A 202 Esterase; structural genomics, PSI-biology, northe 98.97
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 98.97
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 98.97
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.97
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.97
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.96
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.96
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.96
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.95
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.95
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 98.95
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 98.94
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 98.94
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.94
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.94
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 98.94
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.93
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.92
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 98.91
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.91
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.9
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 98.9
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.9
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.9
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 98.89
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 98.89
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 98.89
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 98.89
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 98.89
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 98.4
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.88
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.88
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.88
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 98.87
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 98.86
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 98.86
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 98.86
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.86
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.86
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.86
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 98.85
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.85
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 98.85
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.85
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 98.84
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.84
1ei9_A 279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.84
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 98.84
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 98.83
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.83
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.83
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 98.82
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.82
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 98.81
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 98.8
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.8
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.79
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 98.79
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.79
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.78
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 98.78
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 98.78
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 98.78
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.78
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.77
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.77
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.77
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 98.76
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 98.76
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 98.76
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.76
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.75
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.75
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.74
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 98.74
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 98.74
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 98.73
2uz0_A 263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.73
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 98.72
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.72
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 98.72
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.72
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 98.72
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 98.71
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.71
4b6g_A 283 Putative esterase; hydrolase, formaldehyde detoxif 98.68
3pic_A 375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 98.68
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 98.67
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 98.66
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.65
3lcr_A 319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 98.64
4g4g_A 433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 98.61
1ycd_A 243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.61
1kez_A 300 Erythronolide synthase; polyketide synthase, modul 98.6
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 98.58
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 98.58
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 98.57
1lgy_A 269 Lipase, triacylglycerol lipase; hydrolase (carboxy 98.57
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 98.56
4f21_A246 Carboxylesterase/phospholipase family protein; str 98.55
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 98.51
1gkl_A 297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 98.51
1tia_A 279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 98.5
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.5
2k2q_B 242 Surfactin synthetase thioesterase subunit; A/B-hyd 98.47
1tgl_A 269 Triacyl-glycerol acylhydrolase; carboxylic esteras 98.45
1uwc_A 261 Feruloyl esterase A; hydrolase, serine esterase, x 98.41
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 98.37
2cb9_A 244 Fengycin synthetase; thioesterase, non-ribosomal p 98.35
2hfk_A 319 Pikromycin, type I polyketide synthase pikaiv; alp 98.34
1jmk_C 230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.32
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 98.3
2gzs_A 278 IROE protein; enterobactin, salmochelin, DFP, hydr 98.24
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 98.24
3g7n_A 258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 98.22
3uue_A 279 LIP1, secretory lipase (family 3); LID-domain, hyd 98.18
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 98.18
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 98.18
3ngm_A 319 Extracellular lipase; secret lipase, hydrolase; 2. 98.16
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.08
3gff_A 331 IROE-like serine hydrolase; NP_718593.1, structura 98.06
3o0d_A 301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 98.02
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 97.97
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 97.95
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 97.76
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 97.73
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 97.72
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 97.72
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 97.61
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 97.61
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 97.58
4fol_A 299 FGH, S-formylglutathione hydrolase; D-type esteras 97.57
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 97.56
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 97.5
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 97.5
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 97.47
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 97.42
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 97.41
2ory_A 346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 97.36
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 97.34
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 97.34
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 97.29
3hc7_A 254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 97.22
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 97.21
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 97.13
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 97.09
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 97.09
3aja_A 302 Putative uncharacterized protein; alpha-beta hydro 97.09
2yij_A 419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 95.67
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 96.15
1ivy_A 452 Human protective protein; carboxypeptidase, serine 95.89
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 95.88
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 95.27
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 94.14
2qub_A 615 Extracellular lipase; beta roll, alpha/beta hydrol 93.83
3im8_A 307 Malonyl acyl carrier protein transacylase; fatty a 92.7
2qc3_A 303 MCT, malonyl COA-acyl carrier protein transacylase 92.69
2cuy_A 305 Malonyl COA-[acyl carrier protein] transacylase; t 92.01
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 92.01
1mla_A 309 Malonyl-coenzyme A acyl carrier protein transacyla 91.95
3ptw_A 336 Malonyl COA-acyl carrier protein transacylase; str 91.59
2h1y_A 321 Malonyl coenzyme A-acyl carrier protein transacyl; 91.47
3k89_A 314 Malonyl COA-ACP transacylase; bacterial blight, XO 91.24
3qat_A 318 Malonyl COA-acyl carrier protein transacylase; sea 90.92
4amm_A 401 DYNE8; transferase; 1.40A {Micromonospora chersina 90.68
3g87_A 394 Malonyl COA-acyl carrier protein transacylase; ssg 90.47
3tqe_A 316 Malonyl-COA-[acyl-carrier-protein] transacylase; f 90.18
3ezo_A 318 Malonyl COA-acyl carrier protein transacylase; ssg 90.14
3sbm_A 281 DISD protein, DSZD; transferase; HET: P6G; 1.35A { 90.09
3tzy_A 491 Polyketide synthase PKS13; acyltransferase, long f 89.83
4az3_A 300 Lysosomal protective protein 32 kDa chain; hydrola 89.67
2vdj_A 301 Homoserine O-succinyltransferase; methionine biosy 89.52
2h2w_A 312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 89.42
1nm2_A 317 Malonyl COA:acyl carrier protein malonyltransfera; 88.59
2z8x_A 617 Lipase; beta roll, calcium binding protein, RTX pr 87.25
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 84.96
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 84.79
3kqf_A 265 Enoyl-COA hydratase/isomerase family protein; IDP0 84.55
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 83.94
3l3s_A 263 Enoyl-COA hydratase/isomerase family protein; crot 83.9
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 83.65
1wz8_A 264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 82.89
3qk8_A 272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 82.84
3hrx_A 254 Probable enoyl-COA hydratase; the spiral fold, the 82.52
1hzd_A 272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 82.47
1nzy_A 269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 82.11
3ot6_A 232 Enoyl-COA hydratase/isomerase family protein; stru 81.73
3sll_A 290 Probable enoyl-COA hydratase/isomerase; structural 81.54
3myb_A 286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 81.47
4hdt_A 353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 81.39
2vx2_A 287 Enoyl-COA hydratase domain-containing protein 3; i 80.7
4di1_A 277 Enoyl-COA hydratase ECHA17; structural genomics, s 80.55
3g64_A 279 Putative enoyl-COA hydratase; alpha-beta structure 80.44
3i47_A 268 Enoyl COA hydratase/isomerase (crotonase); structu 80.39
3p5m_A 255 Enoyl-COA hydratase/isomerase; seattle structural 80.3
3td3_A123 Outer membrane protein OMP38; OMPA-like fold, cell 80.23
3im9_A 316 MCAT, MCT, malonyl COA-acyl carrier protein transa 80.08
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
Probab=99.32  E-value=1.3e-11  Score=66.07  Aligned_cols=48  Identities=25%  Similarity=0.332  Sum_probs=40.2

Q ss_pred             HHHHHHHHHHHHHhcCCCcEEEEEEchHHHHHHHHHhhcCCceeEeee
Q 038643            4 VVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASLMERKHTFRM   51 (52)
Q Consensus         4 ~~~d~~~~~~~l~~~~~~~i~l~G~S~GG~~a~~~a~~~p~~~~~~~~   51 (52)
                      ..+|++.++++++..+.+++.++||||||.+++.+|.++|++++++.+
T Consensus        77 ~~~~~~~~~~~l~~l~~~~~~l~GhS~Gg~ia~~~a~~~p~~v~~lvl  124 (254)
T 2ocg_A           77 FERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVI  124 (254)
T ss_dssp             HHHHHHHHHHHHHHTTCSSEEEEEETHHHHHHHHHHHHCTTTEEEEEE
T ss_pred             HHHHHHHHHHHHHHhCCCCEEEEEECHhHHHHHHHHHHChHHhhheeE
Confidence            345677777888777678999999999999999999999998877654



>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Back     alignment and structure
>3im8_A Malonyl acyl carrier protein transacylase; fatty acid synthesis, malonyl-COA, acyl carrier protein TRAN (MCAT), FABD, acyltransferase; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>2qc3_A MCT, malonyl COA-acyl carrier protein transacylase; malonyl-COA:ACP transacylase, , nucleophili fatty acids biosynthesis; 2.30A {Mycobacterium tuberculosis} PDB: 2qj3_A Back     alignment and structure
>2cuy_A Malonyl COA-[acyl carrier protein] transacylase; transferase, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1mla_A Malonyl-coenzyme A acyl carrier protein transacylase; acyltransferase; 1.50A {Escherichia coli} SCOP: c.19.1.1 d.58.23.1 PDB: 2g2o_A 2g1h_A 2g2y_A 2g2z_A* 3h0p_A 3hjv_A* Back     alignment and structure
>3ptw_A Malonyl COA-acyl carrier protein transacylase; structural genomics, protein structure initiative; 2.10A {Clostridium perfringens} Back     alignment and structure
>2h1y_A Malonyl coenzyme A-acyl carrier protein transacyl; FABD, MCAT, transferase; 2.50A {Helicobacter pylori} Back     alignment and structure
>3k89_A Malonyl COA-ACP transacylase; bacterial blight, XOO0880, FABD, xanthomonas oryzae PV. ORYZ KACC10331, transferase; 1.60A {Xanthomonas oryzae PV} PDB: 3een_A 3r97_A* Back     alignment and structure
>3qat_A Malonyl COA-acyl carrier protein transacylase; seattle structural genomics center for infectious disease, S bartonella, CAT-scratch disease; 1.60A {Bartonella henselae} Back     alignment and structure
>4amm_A DYNE8; transferase; 1.40A {Micromonospora chersina} PDB: 4amn_A 4amp_A 4amo_A Back     alignment and structure
>3g87_A Malonyl COA-acyl carrier protein transacylase; ssgcid, niaid, decode biostructures, dried seaweed, acyltran transferase; 2.30A {Burkholderia pseudomallei} Back     alignment and structure
>3tqe_A Malonyl-COA-[acyl-carrier-protein] transacylase; fatty acid/phospholipid metabolism, transferase; HET: MSE; 1.50A {Coxiella burnetii} Back     alignment and structure
>3ezo_A Malonyl COA-acyl carrier protein transacylase; ssgcid, acyl-carrier-protein S-malonyltransferase, acyltransferase, transferase; 2.05A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3sbm_A DISD protein, DSZD; transferase; HET: P6G; 1.35A {Sorangium cellulosum} PDB: 3rgi_A Back     alignment and structure
>3tzy_A Polyketide synthase PKS13; acyltransferase, long fatty acid chain transferase, acyl CAR protein, transferase; HET: PLM; 2.20A {Mycobacterium tuberculosis} PDB: 3tzw_A 3tzx_A* 3tzz_A* Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>1nm2_A Malonyl COA:acyl carrier protein malonyltransfera; alpha/beta hydrolase-like core; 2.00A {Streptomyces coelicolor} SCOP: c.19.1.1 d.58.23.1 PDB: 2cdh_4 2cf2_B Back     alignment and structure
>2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>3td3_A Outer membrane protein OMP38; OMPA-like fold, cell-WALL attachment, peptidoglycan-binding, protein,peptide binding protein; 1.59A {Acinetobacter baumannii} PDB: 3td4_A* 3td5_A* Back     alignment and structure
>3im9_A MCAT, MCT, malonyl COA-acyl carrier protein transacylase; fatty acid synthesis, malonyl-COA: acyl carrier protein TRAN (MCAT), FABD; 1.46A {Staphylococcus aureus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query52
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.18
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.18
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.16
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.12
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.12
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.1
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.08
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.06
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 99.05
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.02
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.01
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.0
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.99
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 98.97
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.96
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 98.95
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.95
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 98.93
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.93
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.9
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 98.89
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 98.89
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.88
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 98.88
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.86
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 98.83
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.83
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.83
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.81
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.81
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 98.78
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 98.78
d1jfra_ 260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.78
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.77
d1dqza_ 280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 98.76
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.75
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 98.74
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 98.74
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 98.74
d1r88a_ 267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 98.73
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 98.73
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 98.71
d2b61a1 357 Homoserine O-acetyltransferase {Haemophilus influe 98.69
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 98.68
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.68
d2pl5a1 362 Homoserine O-acetyltransferase {Leptospira interro 98.66
d2vata1 376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.64
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 98.61
d1xfda2 258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.6
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 98.57
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.56
d1ufoa_ 238 Hypothetical protein TT1662 {Thermus thermophilus 98.53
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 98.53
d2bgra2 258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.51
d2pbla1 261 Uncharacterized protein TM1040_2492 {Silicibacter 98.5
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 98.49
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.47
d2h7xa1 283 Picromycin polyketide synthase {Streptomyces venez 98.43
d1lnsa3 405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 98.39
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 98.37
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.36
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 98.34
d1mo2a_ 255 Erythromycin polyketide synthase {Saccharopolyspor 98.33
d1lgya_ 265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 98.3
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 98.27
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 98.27
d1uwca_ 261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 98.26
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 98.24
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 98.24
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 98.22
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 98.16
d1tiaa_ 271 Triacylglycerol lipase {Penicillium camembertii [T 98.12
d3tgla_ 265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 98.12
d1ei9a_ 279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 98.09
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.06
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 97.91
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 97.89
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.87
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 97.81
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 97.78
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 97.77
d1u4na_ 308 Carboxylesterase {Alicyclobacillus acidocaldarius 97.75
d1pv1a_ 299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 97.71
d1lzla_ 317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 97.65
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 97.56
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 97.52
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 97.25
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 97.05
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 96.89
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 96.88
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 96.84
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 96.83
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 96.81
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 96.8
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 96.76
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 96.76
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 96.75
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 96.73
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 96.6
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 91.97
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 91.71
d2hqsc1106 Peptidoglycan-associated lipoprotein, PAL, peripla 91.54
d2ghra1 281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 90.3
d2aizp1134 Peptidoglycan-associated lipoprotein, PAL, peripla 90.06
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 89.88
d1qfma2 280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 89.59
d1mlaa1 235 Catalytic domain of malonyl-CoA ACP transacylase F 88.81
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 86.6
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 86.47
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 85.81
d2fw2a1 258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 85.59
d1hzda_ 266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 84.13
d1nm2a1 253 Catalytic domain of malonyl-CoA ACP transacylase F 83.34
d1dcia_ 275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 81.45
d1ps9a2 162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 81.2
d2a7ka1 230 Carbapenem biosynthes protein CarB {Pectobacterium 81.19
d1uiya_ 253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 80.73
d1wz8a1 263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 80.38
d1r1ma_140 Outer membrane protein class 4, RmpM, C-terminal d 80.13
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Proline iminopeptidase-like
domain: Tricorn interacting factor F1
species: Archaeon Thermoplasma acidophilum [TaxId: 2303]
Probab=99.18  E-value=5e-11  Score=62.14  Aligned_cols=47  Identities=23%  Similarity=0.244  Sum_probs=37.3

Q ss_pred             hHHHHHHHHHHHHHhcCCCcEEEEEEchHHHHHHHHHhhcCCceeEeee
Q 038643            3 GVVADISASVDWLKANGSKKVGMVGYCMGSALTIACSASLMERKHTFRM   51 (52)
Q Consensus         3 ~~~~d~~~~~~~l~~~~~~~i~l~G~S~GG~~a~~~a~~~p~~~~~~~~   51 (52)
                      ...+|+..+++.+.  ..+++.++||||||.+++.++.++|+++.++.+
T Consensus        78 ~~~~~l~~ll~~l~--~~~~~~lvGhS~Gg~ia~~~a~~~p~~v~~lvl  124 (290)
T d1mtza_          78 YGVEEAEALRSKLF--GNEKVFLMGSSYGGALALAYAVKYQDHLKGLIV  124 (290)
T ss_dssp             HHHHHHHHHHHHHH--TTCCEEEEEETHHHHHHHHHHHHHGGGEEEEEE
T ss_pred             chhhhhhhhhcccc--cccccceecccccchhhhhhhhcChhhheeeee
Confidence            45566666666553  357899999999999999999999998877654



>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mlaa1 c.19.1.1 (A:3-127,A:198-307) Catalytic domain of malonyl-CoA ACP transacylase FabD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nm2a1 c.19.1.1 (A:0-133,A:196-314) Catalytic domain of malonyl-CoA ACP transacylase FabD {Streptomyces coelicolor A3(2) [TaxId: 100226]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure