Citrus Sinensis ID: 038758


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MELGIQVHAHLIVCGVELCAFLGSQLLEVFCNWTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMISIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHCKFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLSTACGFVICSCSVFNQLSTRDVVVWNSIISAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALPQGLGTGSFVWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMISVYG
ccHHHHHHHHHHHHccccccHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHcccccccEEHHHHHHHHccccccHHHHHHHHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHccc
ccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHEHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHcc
MELGIQVHAHLIVCGVELCAFLGSQLLEVFCNWTSMMGMYNVLGYYEEIVNLFYLMIdkgvrpdhfvcpkvykacselkdyrvgkdVYDYMISIKFegnacvkrpLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKvshckfskikqKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIqtdmqpntisLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLSTACGFvicscsvfnqlstRDVVVWNSIISAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLaalpqglgtgSFVWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMISVYG
MELGIQVHAHLIVCGVELCAFLGSQLLEVFCNWTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYkacselkdyrvGKDVYDYMISIKfegnacvkrPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHCKFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLSTACGFVICSCSVFNQLSTRDVVVWNSIISAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALPQGLGTGSFVWNALIDMYGRCGAIQKSRKIFVLmphknlvswnvmisvyg
MELGIQVHAHLIVCGVELCAFLGSQLLEVFCNWTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMISIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHCKFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLSTACGFVICSCSVFNQLSTRDVVVWNSIISAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALPQGLGTGSFVWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMISVYG
***GIQVHAHLIVCGVELCAFLGSQLLEVFCNWTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMISIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHCKFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLSTACGFVICSCSVFNQLSTRDVVVWNSIISAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALPQGLGTGSFVWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMISVY*
MELGIQVHAHLIVCGVELCAFLGSQLLEVFCNWTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMISIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHCKFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLSTACGFVICSCSVFNQLSTRDVVVWNSIISAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALPQGLGTGSFVWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMISVYG
MELGIQVHAHLIVCGVELCAFLGSQLLEVFCNWTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMISIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHCKFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLSTACGFVICSCSVFNQLSTRDVVVWNSIISAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALPQGLGTGSFVWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMISVYG
MELGIQVHAHLIVCGVELCAFLGSQLLEVFCNWTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMISIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHCKFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLSTACGFVICSCSVFNQLSTRDVVVWNSIISAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALPQGLGTGSFVWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMISVYG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELGIQVHAHLIVCGVELCAFLGSQLLEVFCNWTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMISIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHCKFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLSTACGFVICSCSVFNQLSTRDVVVWNSIISAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALPQGLGTGSFVWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMISVYG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query354 2.2.26 [Sep-21-2011]
Q9LN01 741 Pentatricopeptide repeat- yes no 0.892 0.426 0.285 2e-43
Q9LW63 715 Putative pentatricopeptid no no 0.875 0.433 0.309 3e-39
Q9LNU6 760 Pentatricopeptide repeat- no no 0.974 0.453 0.263 3e-39
O04659 691 Pentatricopeptide repeat- no no 0.822 0.421 0.304 6e-39
Q9C507 787 Putative pentatricopeptid no no 0.898 0.404 0.274 2e-38
O64705 621 Pentatricopeptide repeat- no no 0.895 0.510 0.259 2e-38
O82380 738 Pentatricopeptide repeat- no no 0.867 0.415 0.283 6e-37
Q9LTV8 694 Pentatricopeptide repeat- no no 0.895 0.456 0.248 2e-36
Q7Y211 890 Pentatricopeptide repeat- no no 0.906 0.360 0.273 3e-36
Q0WNP3617 Pentatricopeptide repeat- no no 0.901 0.517 0.284 5e-36
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function desciption
 Score =  176 bits (447), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 98/343 (28%), Positives = 188/343 (54%), Gaps = 27/343 (7%)

Query: 33  WTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMI 92
           W +M   + +       + L+  MI  G+ P+ +  P V K+C++ K ++ G+ ++ +++
Sbjct: 102 WNTMFRGHALSSDPVSALKLYVCMISLGLLPNSYTFPFVLKSCAKSKAFKEGQQIHGHVL 161

Query: 93  SIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMD-QDFLVNNSLIDFYAKCRYLKVSHC 151
            +  + +  V   L+ ++++ GR+E    +F++   +D +   +LI  YA   Y++ +  
Sbjct: 162 KLGCDLDLYVHTSLISMYVQNGRLEDAHKVFDKSPHRDVVSYTALIKGYASRGYIENAQK 221

Query: 152 KFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQV 211
            F +I  KD+VSWNAM++GYA  G  +E   L  +M  ++T+++P+  ++  V++ACAQ 
Sbjct: 222 LFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDM--MKTNVRPDESTMVTVVSACAQS 279

Query: 212 KGVKLGKAIHGYVLRHH-----------IHLSTACGFVICSCSVFNQLSTRDVVVWNSII 260
             ++LG+ +H ++  H            I L + CG +  +C +F +L  +DV+ WN++I
Sbjct: 280 GSIELGRQVHLWIDDHGFGSNLKIVNALIDLYSKCGELETACGLFERLPYKDVISWNTLI 339

Query: 261 SAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALP-------------QG 307
             +       +AL L ++++ +   PN VT++S+LPAC  L A+              +G
Sbjct: 340 GGYTHMNLYKEALLLFQEMLRSGETPNDVTMLSILPACAHLGAIDIGRWIHVYIDKRLKG 399

Query: 308 LGTGSFVWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMI 350
           +   S +  +LIDMY +CG I+ + ++F  + HK+L SWN MI
Sbjct: 400 VTNASSLRTSLIDMYAKCGDIEAAHQVFNSILHKSLSSWNAMI 442





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32 PE=3 SV=1 Back     alignment and function description
>sp|Q9LNU6|PPR53_ARATH Pentatricopeptide repeat-containing protein At1g20230 OS=Arabidopsis thaliana GN=PCMP-H21 PE=2 SV=2 Back     alignment and function description
>sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protein At5g27110 OS=Arabidopsis thaliana GN=PCMP-E14 PE=2 SV=2 Back     alignment and function description
>sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E66 PE=3 SV=1 Back     alignment and function description
>sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protein At2g34400 OS=Arabidopsis thaliana GN=PCMP-E23 PE=3 SV=2 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description
>sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protein At3g57430, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H81 PE=2 SV=2 Back     alignment and function description
>sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protein At4g18520 OS=Arabidopsis thaliana GN=PCMP-A2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
296083884 729 unnamed protein product [Vitis vinifera] 0.909 0.441 0.412 8e-83
147767942 929 hypothetical protein VITISV_016435 [Viti 0.830 0.316 0.457 1e-79
225435852 972 PREDICTED: pentatricopeptide repeat-cont 0.830 0.302 0.457 2e-79
347954542 673 organelle transcript processing 82, part 0.892 0.469 0.309 1e-45
147854092 886 hypothetical protein VITISV_041405 [Viti 0.824 0.329 0.312 8e-43
225436612 694 PREDICTED: pentatricopeptide repeat-cont 0.822 0.419 0.313 9e-43
148909481 795 unknown [Picea sitchensis] 0.816 0.363 0.309 1e-42
347954546 695 organelle transcript processing 82, part 0.838 0.427 0.299 1e-42
347954522 710 organelle transcript processing 82, part 0.838 0.418 0.299 1e-42
347954528 666 organelle transcript processing 82, part 0.892 0.474 0.285 2e-42
>gi|296083884|emb|CBI24272.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  313 bits (802), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 245/441 (55%), Gaps = 119/441 (26%)

Query: 1   MELGIQVHAHLIVCGVELCAFLGSQLLEVFC---------------------NWTSMMGM 39
           + LG QVHA L+V GV++C FLGS+LLEV+C                     +WT++M M
Sbjct: 26  LRLGFQVHAQLVVNGVDVCEFLGSRLLEVYCQTGCVEDARRMFDKMSERNVFSWTAIMEM 85

Query: 40  YNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMISIKFEGN 99
           Y  LG YEE + LFYLM+++GVRPDHFV PKV+KACSELK+YRVGKDVYDYM+SI FEGN
Sbjct: 86  YCGLGDYEETIKLFYLMVNEGVRPDHFVFPKVFKACSELKNYRVGKDVYDYMLSIGFEGN 145

Query: 100 ACVKRPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHCKFSKIKQK 159
           +CVK  +LD+FIKCGRM+I    FEE                              I+ K
Sbjct: 146 SCVKGSILDMFIKCGRMDIARRFFEE------------------------------IEFK 175

Query: 160 DLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQVKGVKLGKA 219
           D+  WN M++GY   G  ++  N+    +M+   ++PN+I+++  ++AC  +  ++ G+ 
Sbjct: 176 DVFMWNIMVSGYTSKGEFKKALNVF--RKMVLEGVKPNSITIASAVSACTNLSLLRHGRE 233

Query: 220 IHGYVLRHH------------IHLSTACGFVICSCSVFNQLSTRDVVVW----------- 256
           IHGY ++              +     C  V  +   F  +   D+V W           
Sbjct: 234 IHGYCIKVEELDSDLLVGNSLVDYYAKCRSVEVARRKFGMIKQTDLVSWNAMLAVTGFTQ 293

Query: 257 --------------------------------NSIISAFVRSGQVVDALDLLRDVIVANV 284
                                           NSIISA  +SG+ V+ALDLLR++ ++NV
Sbjct: 294 YGDGKAALEFFQRMHIACSVFSELSTRDVVVWNSIISACAQSGRSVNALDLLREMNLSNV 353

Query: 285 KPNTVTIVSVLPACLKLAALPQ-----------GLGTGSFVWNALIDMYGRCGAIQKSRK 333
           + NTVT+VS LPAC KLAAL Q           GL T +F+ N+LIDMYGRCG+IQKSR+
Sbjct: 354 EVNTVTMVSALPACSKLAALRQGKEIHQFIIRCGLDTCNFILNSLIDMYGRCGSIQKSRR 413

Query: 334 IFVLMPHKNLVSWNVMISVYG 354
           IF LMP ++LVSWNVMISVYG
Sbjct: 414 IFDLMPQRDLVSWNVMISVYG 434




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147767942|emb|CAN73397.1| hypothetical protein VITISV_016435 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225435852|ref|XP_002265253.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|347954542|gb|AEP33771.1| organelle transcript processing 82, partial [Thlaspi arvense] Back     alignment and taxonomy information
>gi|147854092|emb|CAN83391.1| hypothetical protein VITISV_041405 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225436612|ref|XP_002275537.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|148909481|gb|ABR17838.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|347954546|gb|AEP33773.1| organelle transcript processing 82, partial [Lobularia maritima] Back     alignment and taxonomy information
>gi|347954522|gb|AEP33761.1| organelle transcript processing 82, partial [Crucihimalaya wallichii] Back     alignment and taxonomy information
>gi|347954528|gb|AEP33764.1| organelle transcript processing 82, partial [Iberis amara] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
TAIR|locus:2205200 741 OTP82 "AT1G08070" [Arabidopsis 0.892 0.426 0.285 5.2e-41
TAIR|locus:2181201 691 AT5G27110 [Arabidopsis thalian 0.889 0.455 0.304 1.6e-34
TAIR|locus:2060640 738 OTP81 "ORGANELLE TRANSCRIPT PR 0.898 0.430 0.281 2.1e-34
TAIR|locus:2007116 787 AT1G69350 "AT1G69350" [Arabido 0.940 0.423 0.283 1.2e-33
TAIR|locus:2175653 677 AT5G39350 "AT5G39350" [Arabido 0.621 0.324 0.276 2.7e-33
TAIR|locus:2055919 786 AT2G22070 "AT2G22070" [Arabido 0.957 0.431 0.252 3.7e-32
TAIR|locus:2148101 850 AT5G16860 "AT5G16860" [Arabido 0.827 0.344 0.249 1.2e-19
TAIR|locus:2103483 890 OTP84 "ORGANELLE TRANSCRIPT PR 0.618 0.246 0.298 1.1e-23
TAIR|locus:2825379 681 AT1G71490 "AT1G71490" [Arabido 0.903 0.469 0.265 4.8e-31
TAIR|locus:2124603617 AT4G18520 [Arabidopsis thalian 0.935 0.536 0.300 5.5e-31
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 426 (155.0 bits), Expect = 5.2e-41, Sum P(2) = 5.2e-41
 Identities = 98/343 (28%), Positives = 188/343 (54%)

Query:    33 WTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMI 92
             W +M   + +       + L+  MI  G+ P+ +  P V K+C++ K ++ G+ ++ +++
Sbjct:   102 WNTMFRGHALSSDPVSALKLYVCMISLGLLPNSYTFPFVLKSCAKSKAFKEGQQIHGHVL 161

Query:    93 SIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMD-QDFLVNNSLIDFYAKCRYLKVSHC 151
              +  + +  V   L+ ++++ GR+E    +F++   +D +   +LI  YA   Y++ +  
Sbjct:   162 KLGCDLDLYVHTSLISMYVQNGRLEDAHKVFDKSPHRDVVSYTALIKGYASRGYIENAQK 221

Query:   152 KFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQV 211
              F +I  KD+VSWNAM++GYA  G  +E   L  +M  ++T+++P+  ++  V++ACAQ 
Sbjct:   222 LFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDM--MKTNVRPDESTMVTVVSACAQS 279

Query:   212 KGVKLGKAIHGYVLRHH-----------IHLSTACGFVICSCSVFNQLSTRDVVVWNSII 260
               ++LG+ +H ++  H            I L + CG +  +C +F +L  +DV+ WN++I
Sbjct:   280 GSIELGRQVHLWIDDHGFGSNLKIVNALIDLYSKCGELETACGLFERLPYKDVISWNTLI 339

Query:   261 SAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALP-------------QG 307
               +       +AL L ++++ +   PN VT++S+LPAC  L A+              +G
Sbjct:   340 GGYTHMNLYKEALLLFQEMLRSGETPNDVTMLSILPACAHLGAIDIGRWIHVYIDKRLKG 399

Query:   308 LGTGSFVWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMI 350
             +   S +  +LIDMY +CG I+ + ++F  + HK+L SWN MI
Sbjct:   400 VTNASSLRTSLIDMYAKCGDIEAAHQVFNSILHKSLSSWNAMI 442


GO:0003674 "molecular_function" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0031425 "chloroplast RNA processing" evidence=IMP
TAIR|locus:2181201 AT5G27110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060640 OTP81 "ORGANELLE TRANSCRIPT PROCESSING 81" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007116 AT1G69350 "AT1G69350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175653 AT5G39350 "AT5G39350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055919 AT2G22070 "AT2G22070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148101 AT5G16860 "AT5G16860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103483 OTP84 "ORGANELLE TRANSCRIPT PROCESSING 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825379 AT1G71490 "AT1G71490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124603 AT4G18520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00017247001
SubName- Full=Chromosome chr6 scaffold_15, whole genome shotgun sequence; (868 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-48
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-37
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-30
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-28
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-25
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-25
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-20
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-17
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-04
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.001
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  175 bits (444), Expect = 1e-48
 Identities = 94/342 (27%), Positives = 167/342 (48%), Gaps = 54/342 (15%)

Query: 32  NWTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYM 91
           +W  ++G Y   GY++E + L++ M+  GVRPD +  P V + C  + D   G++V+ ++
Sbjct: 154 SWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHV 213

Query: 92  ISIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHC 151
           +   FE                           ++D    V N+LI  Y KC  +  +  
Sbjct: 214 VRFGFE--------------------------LDVD----VVNALITMYVKCGDVVSARL 243

Query: 152 KFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQV 211
            F ++ ++D +SWNAM++GY   G   E   L     M +  + P+ ++++ V++AC  +
Sbjct: 244 VFDRMPRRDCISWNAMISGYFENGECLEGLELF--FTMRELSVDPDLMTITSVISACELL 301

Query: 212 KGVKLGKAIHGYVLRHH-----------IHLSTACGFVICSCSVFNQLSTRDVVVWNSII 260
              +LG+ +HGYV++             I +  + G    +  VF+++ T+D V W ++I
Sbjct: 302 GDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMI 361

Query: 261 SAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKLAALPQGLGTGSF------- 313
           S + ++G    AL+    +   NV P+ +TI SVL AC  L  L  G+            
Sbjct: 362 SGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLI 421

Query: 314 ----VWNALIDMYGRCGAIQKSRKIFVLMPHKNLVSWNVMIS 351
               V NALI+MY +C  I K+ ++F  +P K+++SW  +I+
Sbjct: 422 SYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIA 463


Length = 857

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 354
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.88
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.74
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.72
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.65
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.63
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.63
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.62
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.59
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.59
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.58
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.55
PF1304150 PPR_2: PPR repeat family 99.54
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.51
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.5
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.5
PF1304150 PPR_2: PPR repeat family 99.49
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.45
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.39
PRK14574 822 hmsH outer membrane protein; Provisional 99.38
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.37
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.37
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.34
PRK14574 822 hmsH outer membrane protein; Provisional 99.31
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.31
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.3
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.29
KOG2076 895 consensus RNA polymerase III transcription factor 99.28
KOG1126638 consensus DNA-binding cell division cycle control 99.27
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.26
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.22
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.2
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.2
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.19
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.18
KOG1126638 consensus DNA-binding cell division cycle control 99.18
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.14
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.13
KOG2003 840 consensus TPR repeat-containing protein [General f 99.11
PRK12370553 invasion protein regulator; Provisional 99.09
PRK12370553 invasion protein regulator; Provisional 99.07
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.06
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.06
KOG2076 895 consensus RNA polymerase III transcription factor 99.03
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.02
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.01
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.98
KOG2003 840 consensus TPR repeat-containing protein [General f 98.95
PF1285434 PPR_1: PPR repeat 98.93
PRK11189296 lipoprotein NlpI; Provisional 98.91
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.88
KOG1129478 consensus TPR repeat-containing protein [General f 98.87
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.87
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.85
PF1285434 PPR_1: PPR repeat 98.83
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.78
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.78
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.75
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.75
PRK11189296 lipoprotein NlpI; Provisional 98.74
KOG0547606 consensus Translocase of outer mitochondrial membr 98.73
KOG0547606 consensus Translocase of outer mitochondrial membr 98.73
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.71
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.7
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.69
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.68
KOG1129478 consensus TPR repeat-containing protein [General f 98.61
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.6
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.6
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.59
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.58
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.55
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.51
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.47
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.47
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.46
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.46
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.41
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.39
KOG1128777 consensus Uncharacterized conserved protein, conta 98.34
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.32
PRK10370198 formate-dependent nitrite reductase complex subuni 98.31
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.27
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.23
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.23
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.23
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.22
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.22
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.21
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.21
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.19
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.12
KOG1125579 consensus TPR repeat-containing protein [General f 98.1
PRK10370198 formate-dependent nitrite reductase complex subuni 98.09
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.08
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.07
PLN02789320 farnesyltranstransferase 98.05
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.04
PRK15359144 type III secretion system chaperone protein SscB; 98.01
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.0
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.0
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.0
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.99
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.99
PRK15359144 type III secretion system chaperone protein SscB; 97.99
PRK04841 903 transcriptional regulator MalT; Provisional 97.96
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.95
PLN02789320 farnesyltranstransferase 97.92
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.91
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.91
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.91
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 97.89
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.86
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.86
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.85
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.84
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.83
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.82
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.82
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.82
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.81
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.8
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.8
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.8
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.77
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.77
KOG1128777 consensus Uncharacterized conserved protein, conta 97.75
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.7
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.7
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.7
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.68
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.65
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.61
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.61
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.59
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.59
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.53
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.51
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.51
PRK04841903 transcriptional regulator MalT; Provisional 97.51
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.5
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.47
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.45
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.4
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.39
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.33
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.31
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.26
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.24
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.23
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.15
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.14
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.09
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.09
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.08
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.08
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.06
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.0
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.99
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.98
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.96
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.91
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.9
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 96.89
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.88
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.85
KOG1125579 consensus TPR repeat-containing protein [General f 96.84
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.83
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.77
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.76
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.75
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.72
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.67
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.65
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.63
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 96.58
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.51
PF12688120 TPR_5: Tetratrico peptide repeat 96.51
PF12688120 TPR_5: Tetratrico peptide repeat 96.48
smart00299140 CLH Clathrin heavy chain repeat homology. 96.47
PRK10803263 tol-pal system protein YbgF; Provisional 96.47
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.44
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.38
COG4700251 Uncharacterized protein conserved in bacteria cont 96.35
KOG3941 406 consensus Intermediate in Toll signal transduction 96.33
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.31
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.29
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.29
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.26
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.21
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.21
KOG0553 304 consensus TPR repeat-containing protein [General f 96.17
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.14
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.13
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.04
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 96.01
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.96
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 95.91
PF1337173 TPR_9: Tetratricopeptide repeat 95.91
PRK10803263 tol-pal system protein YbgF; Provisional 95.84
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.83
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.81
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.76
KOG0553304 consensus TPR repeat-containing protein [General f 95.68
PF1337173 TPR_9: Tetratricopeptide repeat 95.67
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 95.62
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.56
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.54
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.54
KOG3941406 consensus Intermediate in Toll signal transduction 95.51
smart00299140 CLH Clathrin heavy chain repeat homology. 95.36
COG3898531 Uncharacterized membrane-bound protein [Function u 95.31
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.29
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.29
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.21
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 95.2
PRK15331165 chaperone protein SicA; Provisional 95.1
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.86
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.84
COG4700251 Uncharacterized protein conserved in bacteria cont 94.83
PRK15331165 chaperone protein SicA; Provisional 94.79
KOG2041 1189 consensus WD40 repeat protein [General function pr 94.71
COG3898 531 Uncharacterized membrane-bound protein [Function u 94.5
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.22
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.17
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.09
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 93.81
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.44
PF13281374 DUF4071: Domain of unknown function (DUF4071) 93.1
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 93.05
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.97
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 92.94
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 92.8
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.54
COG3629280 DnrI DNA-binding transcriptional activator of the 92.39
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 92.36
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.33
PF13929292 mRNA_stabil: mRNA stabilisation 92.29
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 92.02
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.89
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.71
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 91.57
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 91.5
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.42
PF1342844 TPR_14: Tetratricopeptide repeat 91.22
COG3629280 DnrI DNA-binding transcriptional activator of the 91.21
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 91.03
PF13512142 TPR_18: Tetratricopeptide repeat 90.72
COG1729262 Uncharacterized protein conserved in bacteria [Fun 90.71
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.58
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 90.57
PF13762145 MNE1: Mitochondrial splicing apparatus component 90.24
PF1342844 TPR_14: Tetratricopeptide repeat 90.08
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.02
PF13512142 TPR_18: Tetratricopeptide repeat 89.96
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.77
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 89.76
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 89.68
COG3118304 Thioredoxin domain-containing protein [Posttransla 89.6
COG3118304 Thioredoxin domain-containing protein [Posttransla 89.36
KOG1585308 consensus Protein required for fusion of vesicles 89.16
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 89.11
KOG2610491 consensus Uncharacterized conserved protein [Funct 88.77
KOG4555175 consensus TPR repeat-containing protein [Function 88.68
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.62
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.47
PF1343134 TPR_17: Tetratricopeptide repeat 88.23
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.99
KOG1585308 consensus Protein required for fusion of vesicles 87.8
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 87.18
KOG0403645 consensus Neoplastic transformation suppressor Pdc 86.69
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.45
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 86.37
PRK11906458 transcriptional regulator; Provisional 86.3
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 86.05
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.04
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.34
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 84.73
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 84.63
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 84.52
KOG4555175 consensus TPR repeat-containing protein [Function 83.91
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 83.9
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 83.82
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 83.68
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 83.66
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.62
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.47
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 83.32
COG4649221 Uncharacterized protein conserved in bacteria [Fun 83.01
COG4455273 ImpE Protein of avirulence locus involved in tempe 82.74
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 81.98
KOG1586288 consensus Protein required for fusion of vesicles 81.85
PF13762145 MNE1: Mitochondrial splicing apparatus component 81.72
KOG1586288 consensus Protein required for fusion of vesicles 81.65
KOG4570 418 consensus Uncharacterized conserved protein [Funct 81.01
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 80.55
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 80.4
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.24
COG0457291 NrfG FOG: TPR repeat [General function prediction 80.12
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.8e-58  Score=432.17  Aligned_cols=347  Identities=21%  Similarity=0.342  Sum_probs=332.6

Q ss_pred             hhhHHHHHHHHHhc-cccchhhhhhHhhhhh-------------------------hHHHHHHHHHhcCChhHHHHHHHH
Q 038758            2 ELGIQVHAHLIVCG-VELCAFLGSQLLEVFC-------------------------NWTSMMGMYNVLGYYEEIVNLFYL   55 (354)
Q Consensus         2 ~~a~~~~~~~~~~g-~~~~~~~~~~li~~~~-------------------------~y~~li~~~~~~~~~~~a~~~~~~   55 (354)
                      ++|.++++.|...+ +.|+..+|+.++.+|+                         +||.|++.|++.|++++|.++|++
T Consensus       104 ~~Al~~f~~m~~~~~~~~~~~t~~~ll~a~~~~~~~~~a~~l~~~m~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~  183 (697)
T PLN03081        104 REALELFEILEAGCPFTLPASTYDALVEACIALKSIRCVKAVYWHVESSGFEPDQYMMNRVLLMHVKCGMLIDARRLFDE  183 (697)
T ss_pred             HHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCcchHHHHHHHHHHhcCCCHHHHHHHHhc
Confidence            57888999998865 7899999999999987                         999999999999999999999999


Q ss_pred             HHhCCCcCCcccHHHHHHHHhccCChhhHHHHHHHHHHhccCCCceehhhHHHHHHhcCChhHHHHHHHhh-----cccc
Q 038758           56 MIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMISIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEM-----DQDF  130 (354)
Q Consensus        56 m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~-----~~~~  130 (354)
                      |.    .||..+|+.++.+|++.|++++|.++|++|.+.|+.|+..+|+.++.++++.|+.+.+.+++..+     .++.
T Consensus       184 m~----~~~~~t~n~li~~~~~~g~~~~A~~lf~~M~~~g~~p~~~t~~~ll~a~~~~~~~~~~~~l~~~~~~~g~~~d~  259 (697)
T PLN03081        184 MP----ERNLASWGTIIGGLVDAGNYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTGVVGDT  259 (697)
T ss_pred             CC----CCCeeeHHHHHHHHHHCcCHHHHHHHHHHHHHhCCCCChhhHHHHHHHHhcCCcHHHHHHHHHHHHHhCCCccc
Confidence            96    48999999999999999999999999999999999999999999999999999999999998887     6899


Q ss_pred             chhhHHHHHHHhcCchhHHHHHhccCCCCChhhhHHHHHHHHhCCChhHHHHHHHHHHhhhcCCCCCcchHHHHHHHhhh
Q 038758          131 LVNNSLIDFYAKCRYLKVSHCKFSKIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQ  210 (354)
Q Consensus       131 ~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~p~~~t~~~ll~~~~~  210 (354)
                      .+|++|+++|++.|++++|.++|++|.++|+.+||++|.+|++.|++++|.++|++|.  ..|+.||..||+.++.+|++
T Consensus       260 ~~~n~Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~--~~g~~pd~~t~~~ll~a~~~  337 (697)
T PLN03081        260 FVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMR--DSGVSIDQFTFSIMIRIFSR  337 (697)
T ss_pred             eeHHHHHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHH--HcCCCCCHHHHHHHHHHHHh
Confidence            9999999999999999999999999999999999999999999999999999999999  99999999999999999999


Q ss_pred             hcCccccchhhhHhhhhcccccc-----------ccchhHHHHHHhcccCCCCcchHHHHHHHHHhcCCHHHHHHHHHHH
Q 038758          211 VKGVKLGKAIHGYVLRHHIHLST-----------ACGFVICSCSVFNQLSTRDVVVWNSIISAFVRSGQVVDALDLLRDV  279 (354)
Q Consensus       211 ~~~~~~a~~~~~~~~~~~~~~~~-----------~~~~~~~a~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m  279 (354)
                      .|+++.|.+++..+.+.|+.++.           ++|++++|.++|++|..||..+||+||.+|++.|+.++|+++|++|
T Consensus       338 ~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M  417 (697)
T PLN03081        338 LALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERM  417 (697)
T ss_pred             ccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHH
Confidence            99999999999999999988776           8999999999999999999999999999999999999999999999


Q ss_pred             HHcCcCCCHhhHHHHHHHhhccCcccCc------------cccchhHHHHHHHHHHhcCChhHHHHHhhcCCC-CCcccH
Q 038758          280 IVANVKPNTVTIVSVLPACLKLAALPQG------------LGTGSFVWNALIDMYGRCGAIQKSRKIFVLMPH-KNLVSW  346 (354)
Q Consensus       280 ~~~g~~p~~~t~~~li~~~~~~~~~~~~------------~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~-~~~~~~  346 (354)
                      .+.|+.||..||+.++.+|++.|.+++|            +.|+..+|++++++|++.|++++|.+++++|.. ||..+|
T Consensus       418 ~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~  497 (697)
T PLN03081        418 IAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMW  497 (697)
T ss_pred             HHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHH
Confidence            9999999999999999999999998776            789999999999999999999999999999975 999999


Q ss_pred             HHhhhhcC
Q 038758          347 NVMISVYG  354 (354)
Q Consensus       347 ~~li~~~~  354 (354)
                      ++||.+|+
T Consensus       498 ~~Ll~a~~  505 (697)
T PLN03081        498 AALLTACR  505 (697)
T ss_pred             HHHHHHHH
Confidence            99999984



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0403 consensus Neoplastic transformation suppressor Pdcd4/MA-3, contains MA3 domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.97
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.91
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.87
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.83
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.81
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.81
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.8
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.79
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.74
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.73
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.73
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.71
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.71
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.7
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.68
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.68
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.67
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.65
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.63
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.61
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.6
3u4t_A272 TPR repeat-containing protein; structural genomics 99.55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.54
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.53
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.52
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.51
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.49
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.48
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.47
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.45
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.45
3u4t_A272 TPR repeat-containing protein; structural genomics 99.45
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.44
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.44
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.44
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.42
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.41
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.41
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.41
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.37
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.37
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.35
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.33
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.32
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.3
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.29
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.29
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.28
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.27
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.25
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.25
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.25
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.25
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.25
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.24
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.22
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.2
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.19
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.18
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.18
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.13
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.12
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.1
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.09
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.07
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.05
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.02
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.99
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.98
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.98
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.94
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.92
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.9
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.9
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.89
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.88
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.78
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.78
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.76
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.76
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.69
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.68
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.68
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.66
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.63
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.62
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.62
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.61
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.61
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.6
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.59
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.59
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.59
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.58
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.52
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.52
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.48
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.48
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.48
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.47
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.46
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.46
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.45
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.43
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.41
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.4
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.39
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.39
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.37
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.36
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.36
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.35
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.34
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.33
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.3
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.28
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.27
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.26
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.26
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.26
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.25
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.23
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.23
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.22
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.2
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.18
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.18
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.15
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.14
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.11
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.1
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.1
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.09
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.09
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.01
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.0
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.0
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.99
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.98
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.98
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.96
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.95
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.94
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.94
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.93
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.93
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.91
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.9
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.89
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.89
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.88
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.88
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.84
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.83
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.83
3k9i_A117 BH0479 protein; putative protein binding protein, 97.83
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.81
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.81
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.72
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.71
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.69
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.67
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.65
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.63
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.6
3k9i_A117 BH0479 protein; putative protein binding protein, 97.59
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.57
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.56
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.51
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.48
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.4
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.37
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.36
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.35
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.33
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.28
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.25
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.24
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.22
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.08
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.06
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.02
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.02
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.0
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.98
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.95
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.93
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.8
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.71
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.58
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.37
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.35
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.34
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.34
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.27
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.22
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.21
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.15
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.04
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.02
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.02
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.92
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.66
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.48
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.22
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.57
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.42
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.31
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.97
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.87
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.61
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.55
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 93.42
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.41
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 93.34
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 92.92
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 92.0
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 90.83
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 90.82
1pc2_A152 Mitochondria fission protein; unknown function; NM 89.78
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 89.64
2uwj_G115 Type III export protein PSCG; virulence, chaperone 89.23
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.63
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.09
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 88.05
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 87.53
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 87.3
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.04
2p58_C116 Putative type III secretion protein YSCG; type III 86.4
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 86.21
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 86.0
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 84.86
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 84.74
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.33
2wpv_A 312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 82.89
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 82.81
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 81.38
3hra_A201 Ankyrin repeat family protein; structural protein; 80.85
3eiq_C358 Programmed cell death protein 4; PDCD4, anti-oncog 80.72
2zu6_B307 Programmed cell death protein 4; protein-protein c 80.65
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=7.3e-35  Score=261.72  Aligned_cols=205  Identities=15%  Similarity=0.108  Sum_probs=114.8

Q ss_pred             hHHHHHHHHHhccccchhhhhhHhhhhhhHHHHHHHHHhcCChhHHHHHHHHHHhCCCcCCcccHHHHHHHHhccCC---
Q 038758            4 GIQVHAHLIVCGVELCAFLGSQLLEVFCNWTSMMGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKD---   80 (354)
Q Consensus         4 a~~~~~~~~~~g~~~~~~~~~~li~~~~~y~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~---   80 (354)
                      +..+...+.+.+..+++..         .++.+|.+|++.|++++|+++|++|.+.|++||..||++||.+|++.+.   
T Consensus         9 ~e~L~~~~~~k~~~~spe~---------~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~   79 (501)
T 4g26_A            9 SENLSRKAKKKAIQQSPEA---------LLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATE   79 (501)
T ss_dssp             ---------------CHHH---------HHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSS
T ss_pred             HHHHHHHHHHhcccCCCHH---------HHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhh
Confidence            3344555555555555442         4555666666666666666666666666666666666666666665443   


Q ss_pred             ------hhhHHHHHHHHHHhccCCCceehhhHHHHHHhcCChhHHHHHHHhhccccchhhHHHHHHHhcCchhHHHHHhc
Q 038758           81 ------YRVGKDVYDYMISIKFEGNACVKRPLLDLFIKCGRMEITSGLFEEMDQDFLVNNSLIDFYAKCRYLKVSHCKFS  154 (354)
Q Consensus        81 ------~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~  154 (354)
                            ++.|.++|++|.+.|+.||..||++||.+|++.|++++|.++|++|....                        
T Consensus        80 ~~~~~~l~~A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g------------------------  135 (501)
T 4g26_A           80 SSPNPGLSRGFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFG------------------------  135 (501)
T ss_dssp             SSCCHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT------------------------
T ss_pred             hhhcchHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcC------------------------
Confidence                  45566666666666666666666666666666666666665555542111                        


Q ss_pred             cCCCCChhhhHHHHHHHHhCCChhHHHHHHHHHHhhhcCCCCCcchHHHHHHHhhhhcCccccchhhhHhhhhccccccc
Q 038758          155 KIKQKDLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPNTISLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLSTA  234 (354)
Q Consensus       155 ~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~  234 (354)
                        ..||..|||++|.+|++.|++++|.++|++|.  ..|+.||..||+++|.+|++.|+.++|.+++++|.+.+.     
T Consensus       136 --~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~--~~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~-----  206 (501)
T 4g26_A          136 --IQPRLRSYGPALFGFCRKGDADKAYEVDAHMV--ESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVR-----  206 (501)
T ss_dssp             --CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHH--HTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTS-----
T ss_pred             --CCCccceehHHHHHHHHCCCHHHHHHHHHHHH--hcCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCC-----
Confidence              13566666666666666666666666666665  556666666666666666666666666666666665555     


Q ss_pred             cchhHHHHHHhcccCCCCcchHHHHHHHHHh
Q 038758          235 CGFVICSCSVFNQLSTRDVVVWNSIISAFVR  265 (354)
Q Consensus       235 ~~~~~~a~~~~~~~~~~~~~~~~~li~~~~~  265 (354)
                                     .|+..||+.++..|+.
T Consensus       207 ---------------~ps~~T~~~l~~~F~s  222 (501)
T 4g26_A          207 ---------------QVSKSTFDMIEEWFKS  222 (501)
T ss_dssp             ---------------SBCHHHHHHHHHHHHS
T ss_pred             ---------------CcCHHHHHHHHHHHhc
Confidence                           5556666665555554



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3eiq_C Programmed cell death protein 4; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Mus musculus} Back     alignment and structure
>2zu6_B Programmed cell death protein 4; protein-protein complex, ATP-binding, helicase, hydrolase, initiation factor, nucleotide-binding; 2.80A {Homo sapiens} PDB: 3eij_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.79
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.69
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.52
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.4
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.03
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.03
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.9
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.83
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.75
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.74
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.68
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.61
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.59
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.59
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.58
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.51
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.39
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.35
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.15
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.12
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.08
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.04
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.97
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.96
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.94
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.84
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.69
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.6
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.55
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.52
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.47
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.47
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.41
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.38
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.35
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.3
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.27
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.22
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.04
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.0
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.95
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.94
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.92
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.86
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.81
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.81
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.79
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.71
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.45
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.37
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.62
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.57
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.5
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.59
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 91.32
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 90.43
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 88.04
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 84.07
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 82.41
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 82.2
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79  E-value=1.1e-17  Score=143.68  Aligned_cols=308  Identities=9%  Similarity=0.031  Sum_probs=201.2

Q ss_pred             HHHHHhcCChhHHHHHHHHHHhCCCcCCcccHHHHHHHHhccCChhhHHHHHHHHHHhccCCCceehhhHHHHHHhcCCh
Q 038758           37 MGMYNVLGYYEEIVNLFYLMIDKGVRPDHFVCPKVYKACSELKDYRVGKDVYDYMISIKFEGNACVKRPLLDLFIKCGRM  116 (354)
Q Consensus        37 i~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~  116 (354)
                      -..+.+.|++++|.+.++++.+.. +-+...+..+...+.+.|++++|.+.++...+.. +-+..++..+..+|.+.|++
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~   83 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhccc
Confidence            355678899999999999998764 2345667888888999999999999999998875 55677889999999999999


Q ss_pred             hHHHHHHHhh----c----------------------------------cccchhhHHHHHHHhcCchhHHHHHhccCCC
Q 038758          117 EITSGLFEEM----D----------------------------------QDFLVNNSLIDFYAKCRYLKVSHCKFSKIKQ  158 (354)
Q Consensus       117 ~~a~~~~~~~----~----------------------------------~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~  158 (354)
                      ++|...+...    +                                  ................+....+...+.....
T Consensus        84 ~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (388)
T d1w3ba_          84 QEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIE  163 (388)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhc
Confidence            9999998887    0                                  0000111111112222222222222222111


Q ss_pred             --C-ChhhhHHHHHHHHhCCChhHHHHHHHHHHhhhcCCCCC-cchHHHHHHHhhhhcCccccchhhhHhhhhcccccc-
Q 038758          159 --K-DLVSWNAMLAGYALGGFREEVTNLLDEMEMIQTDMQPN-TISLSGVLAACAQVKGVKLGKAIHGYVLRHHIHLST-  233 (354)
Q Consensus       159 --~-~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~p~-~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~-  233 (354)
                        | +...+..+...+...|++++|...++...  .  ..|+ ...+..+...+...|++++|...+....+....... 
T Consensus       164 ~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al--~--~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~  239 (388)
T d1w3ba_         164 TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAV--T--LDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVV  239 (388)
T ss_dssp             HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHH--H--HCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHH
T ss_pred             cCcchhHHHHhhcccccccCcHHHHHHHHHHHH--H--hCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHH
Confidence              1 23344445555555566666666655554  2  1222 334455555555556666665555555443332221 


Q ss_pred             ---------ccchhHHHHHHhcccC---CCCcchHHHHHHHHHhcCCHHHHHHHHHHHHHcCcCCCHhhHHHHHHHhhcc
Q 038758          234 ---------ACGFVICSCSVFNQLS---TRDVVVWNSIISAFVRSGQVVDALDLLRDVIVANVKPNTVTIVSVLPACLKL  301 (354)
Q Consensus       234 ---------~~~~~~~a~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~t~~~li~~~~~~  301 (354)
                               ..|++++|...|++..   +.+..+|..+...+...|++++|++.++...... +.+...+..+...+...
T Consensus       240 ~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~  318 (388)
T d1w3ba_         240 HGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIKREQ  318 (388)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHHHHC
Confidence                     4555566665555432   3356778888889999999999999998887543 45667777888888888


Q ss_pred             CcccCc---------ccc-chhHHHHHHHHHHhcCChhHHHHHhhcCCC--CC-cccHHHhhh
Q 038758          302 AALPQG---------LGT-GSFVWNALIDMYGRCGAIQKSRKIFVLMPH--KN-LVSWNVMIS  351 (354)
Q Consensus       302 ~~~~~~---------~~~-~~~~~~~li~~~~~~g~~~~A~~~~~~m~~--~~-~~~~~~li~  351 (354)
                      |+.+++         ..| +..++..+...|.+.|++++|.+.|++..+  |+ ...|..+-.
T Consensus       319 ~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~  381 (388)
T d1w3ba_         319 GNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGN  381 (388)
T ss_dssp             TCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHH
Confidence            888876         344 467788899999999999999999998876  64 345555543



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure