Citrus Sinensis ID: 038763


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690
MDLERVKTIQSRLDEFTQRMSELLRIERDAELEFTQEELNAVPTPDENSDSSKPIEFLVSHGRAPQELCDTICNLFVVSTSTGLGGMHLVLFRVEGNHRLPPTTLSPGDMVCVRVCDSRGACATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNCEALMLLQKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALGLNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARISPAVASKSLGEIVKSKLASFVAEFERKKSDLRKDLRQCLKDDSLAAGIRQLLKQLGKTLKKKEKETVKEVLSSAQVVLATNTGAADPLIRRLDTFDLVGKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATKLTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGSLSLGCEEHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRERLDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHAEPGSFGGSGLGMDPMLPSIS
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHcccccccccccccccEEEEEEEEccccEEEEEEEEcccccccccccccccEEEEEEcccccccccccEEEEEEEEcccEEEEEEEEccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccHHHHcccccccccccccccccccccHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHccccEEEEccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHccccccccccEEEEEccccccccEEEcHHHHHccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccHHHHHccccccccccccccccccEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHcccccccccEEccccccccccccEEEEEEccccccccEEccccccccHHHHHHccccEEEEEccccccccHHHHHHHHHHHHcccEEEccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccccHEEcccHHHHHHHcHHHHcEEEEEEEccccccEEEEEEccccccccccEEccccEEEEEEcccccccccccEEEEEEEEccccEEEEEEEEcccccccccccccccEEHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHcccHEEEEEEEEEEccccccccEEEcHHHHHccccHHHHHHHHHHccccEEEEEEEEEcccHHHHHcccHHHHcccccccccHHHHHccccccccccccccccEEEEEccccccEEccccccEEEcccccccccHHHHHHHHHHHHHHHHccccHHHEEEEcccHHHHHHHHHHHHHcccccEEEEEEEcccccccccEEEEEEEEccccccEEEccccccEEEEEEEccccEEEEEcHHHHcccHHHHHHHHHHHHcccEEEccccccccccccccccccccc
MDLERVKTIQSRLDEFTQRMSELLRIERDAELEFTQEelnavptpdensdsskpieflvshgrapqeLCDTICNLFVVStstglggmHLVLFRVegnhrlppttlspgdmvcvrvcdsrgacatsCIQGFvhnlgedgcTISVALesrhgdptfsklfgksvRIDRIQGLADTLTYERNCEALMLLQknglhkrnpsIAAVVTLFgdkedvtwleendladwsevkldgimgktfdDSQKKAIALGlnkkrplliiqgppgtgktgLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGlnivrvgnparispavasKSLGEIVKSKLASFVAEFERKKSDLRKDLRQCLKDDSLAAGIRQLLKQLGKTLKKKEKETVKEVLSSAQVVLAtntgaadplirrldtfdLVGKRcilagdqcqlaPVILSRKALEGGIGVSLLERAATLHEGVLATKLTTQYRMNDAIASWASkemyggslissSTVAShllvdtpfvkptwitqcplllldtrlpygslslgceehldlagtgsfynegeAEIVVHHVFSLICagvspsaiavqspYVAQVQHLRERLddlpeaagvevatidsfqgreADAVIISMVRSNtlgavgflgdsrrMNVAITRACKHVAVvcdssticHNTFLARLLRHIRYFGrvkhaepgsfggsglgmdpmlpsis
mdlervktiqsrldeftQRMSELLRIERDAELEFTQEELnavptpdensdsSKPIEFLVSHGRAPQELCDTICNLFVVSTSTGLGGMHLVLFRVEGNHrlppttlspgdMVCVRVCDSRGACATSCIQGFVHNLGEDGCTISVALEsrhgdptfsklfgksvriDRIQGLADTLTYERNCEALMLLqknglhkrnPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIAlglnkkrplliiqgppgtgktgLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARIspavaskslgeiVKSKLASFVAeferkksdlrkDLRQCLKDDSLAAGIRQLLKQLGKTLKKKEKETVKEVLSSAQVvlatntgaadpliRRLDTFDLVGKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVlatklttqYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGSLSLGCEEHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRERLDDLPEAAGVEVAtidsfqgrEADAVIISMVRSNTLGAVGFLGDSRRMNVAITRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHAepgsfggsglgmdpmlpsis
MDLERVKTIQSRLDEFTQRMSELLRIERDAELEFTQEELNAVPTPDENSDSSKPIEFLVSHGRAPQELCDTICNLFVVSTSTGLGGMHLVLFRVEGNHRLPPTTLSPGDMVCVRVCDSRGACATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNCEALMLLQKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALGLNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARISPAVASKSLGEIVKSKLASFVAEFERKKSDLRKDLRQCLKDDSLAAGIRqllkqlgktlkkkeketvkevlSSAQVVLATNTGAADPLIRRLDTFDLVGKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATKLTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGSLSLGCEEHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRERLDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHAEPGSFGGSGLGMDPMLPSIS
********************************************************FLVSHGRAPQELCDTICNLFVVSTSTGLGGMHLVLFRVEGNHRLPPTTLSPGDMVCVRVCDSRGACATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNCEALMLLQKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALGLNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARISPAVASKSLGEIVKSKLASFVAEF**********LRQCLKDDSLAAGIRQLLKQLG***********KEVLSSAQVVLATNTGAADPLIRRLDTFDLVGKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATKLTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGSLSLGCEEHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRERLDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKH*********************
**********SRLDEFTQRMSELLRIERDAELEFTQEELNAVPTPDE**DSSKPIEFLVSHGRAPQELCDTICNLFVVSTSTGLGGMHLVLFR*************PGDMVCVRVCDS***CATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNCEALMLLQKNGLHKRNPSIAAVVTLFGDKE******************DGIMGKTFDDSQKKAIALGLNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARISPAVASKSLGEIVKSKLAS**AEFERKKSDL*********************KQLGKTLKKKEKETVKEVLSSAQVVLATNTGAADPLIRRLDTFDLVGKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATKLTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGS********************GEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRERLDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHAEPGSF********PM*****
MDLERVKTIQSRLDEFTQRMSELLRIERDAELEFTQEELNA***********KPIEFLVSHGRAPQELCDTICNLFVVSTSTGLGGMHLVLFRVEGNHRLPPTTLSPGDMVCVRVCDSRGACATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNCEALMLLQKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALGLNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARISPAVASKSLGEIVKSKLASFVAEFERKKSDLRKDLRQCLKDDSLAAGIRQLLKQLGKTLKKKEKETVKEVLSSAQVVLATNTGAADPLIRRLDTFDLVGKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATKLTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGSLSLGCEEHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRERLDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHAEPGSFGGSGLGMDPMLPSIS
MDLERVKTIQSRLDEFTQRMSELLRIERDAELEFTQEELNAVPTPDENSDSSKPIEFLVSHGRAPQELCDTICNLFVVSTSTGLGGMHLVLFRVEGNHRLPPTTLSPGDMVCVRVCDSRGACATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNCEALMLLQKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALGLNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARISPAVASKSLGEIVKSKLASFVAEFERKKSDLRKDLRQCLKDDSLAAGIRQLLKQLGKTLKKKEKETVKEVLSSAQVVLATNTGAADPLIRRLDTFDLVGKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATKLTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGSLSLGCEEHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRERLDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHAEPGSFGGSGLGMDPML****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLERVKTIQSRxxxxxxxxxxxxxxxxxxxxxFTQEELNAVPTPDENSDSSKPIEFLVSHGRAPQELCDTICNLFVVSTSTGLGGMHLVLFRVEGNHRLPPTTLSPGDMVCVRVCDSRGACATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNCEALMLLQKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALGLNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARISPAVASKSLGEIVKSKLASFxxxxxxxxxxxxxxxxxxxxxDSLxxxxxxxxxxxxxxxxxxxxxTVKEVLSSAQVVLATNTGAADPLIRRLDTFDLVGKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATKLTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGSLSLGCEEHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRERLDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHAEPGSFGGSGLGMDPMLPSIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query690 2.2.26 [Sep-21-2011]
P38935 993 DNA-binding protein SMUBP yes no 0.860 0.598 0.366 4e-87
P40694 993 DNA-binding protein SMUBP yes no 0.871 0.605 0.355 4e-86
Q60560 989 DNA-binding protein SMUBP N/A no 0.871 0.607 0.353 2e-85
Q9EQN5 988 DNA-binding protein SMUBP yes no 0.868 0.606 0.346 1e-81
O94247660 DNA polymerase alpha-asso yes no 0.830 0.868 0.306 4e-65
P34243683 DNA polymerase alpha-asso yes no 0.604 0.610 0.334 1e-54
P30771 971 ATP-dependent helicase NA no no 0.572 0.406 0.336 4e-48
Q9FJR0 1254 Regulator of nonsense tra no no 0.540 0.297 0.329 5e-48
Q9HEH1 1093 Regulator of nonsense tra N/A no 0.553 0.349 0.324 3e-47
Q92900 1129 Regulator of nonsense tra no no 0.552 0.337 0.307 3e-45
>sp|P38935|SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens GN=IGHMBP2 PE=1 SV=3 Back     alignment and function desciption
 Score =  323 bits (827), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 256/698 (36%), Positives = 361/698 (51%), Gaps = 104/698 (14%)

Query: 13  LDEFTQRMSELLRIERDAELEFT---QEELNAVPTPDENSDSSKPIEFLVSHGRAPQELC 69
           ++ F  +  +LL +ERDAE+E     QE ++              ++ L S G     +C
Sbjct: 6   VESFVTKQLDLLELERDAEVEERRSWQENIS--------------LKELQSRG-----VC 46

Query: 70  DTICNLFVVSTSTGLGGMHLVLF---RVEGNHRLPPTTLSPGDMVCVRVCDSRGACATSC 126
             +  L V S  TGL G  LV F   R      LP  + + GD+V +    + G+   + 
Sbjct: 47  --LLKLQVSSQRTGLYGRLLVTFEPRRYGSAAALPSNSFTSGDIVGLYDAANEGSQLATG 104

Query: 127 IQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNCEALMLL 186
           I   V        +++VA +  H D   S     S R+ +   LA+ +TY R  +AL+ L
Sbjct: 105 ILTRVTQK-----SVTVAFDESH-DFQLSLDRENSYRLLK---LANDVTYRRLKKALIAL 155

Query: 187 QKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALG 246
           +K   +   P+ + +  LFG          +  +  SE+          D SQK+A+   
Sbjct: 156 KK---YHSGPASSLIEVLFG---------RSAPSPASEIHPLTFFNTCLDTSQKEAVLFA 203

Query: 247 LNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNI 306
           L++K  L II GPPGTGKT  + EII +AV+QG +VL  AP+N AVDN+VE+L+     I
Sbjct: 204 LSQKE-LAIIHGPPGTGKTTTVVEIILQAVKQGLKVLCCAPSNIAVDNLVERLALCKQRI 262

Query: 307 VRVGNPARISPAVASKSLGEIV-KSKLASFVAEFERKKSDLRKDLRQCL------KDDSL 359
           +R+G+PAR+  ++   SL  ++ +S  A  VA       D+RKD+ Q        +D   
Sbjct: 263 LRLGHPARLLESIQQHSLDAVLARSDSAQIVA-------DIRKDIDQVFVKNKKTQDKRE 315

Query: 360 AAGIRQLLKQLGKTLKKKEKETVKEVLSSAQVVLATNTGA-ADPLIRRL--DTFDLV--- 413
            +  R  +K L K LK++E+  + E L+SA VVLATNTGA AD  ++ L    FD+V   
Sbjct: 316 KSNFRNEIKLLRKELKEREEAAMLESLTSANVVLATNTGASADGPLKLLPESYFDVVVID 375

Query: 414 ----------------GKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLA 457
                            ++CILAGD  QL P  +S KA   G+ +SL+ER A  +   + 
Sbjct: 376 ECAQALEASCWIPLLKARKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEYGARVV 435

Query: 458 TKLTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRL 517
             LT QYRM+ AI  WAS  MY G L + S+VA HLL D P V  T  T  PLLL+DT  
Sbjct: 436 RTLTVQYRMHQAIMRWASDTMYLGQLTAHSSVARHLLRDLPGVAATEETGVPLLLVDT-- 493

Query: 518 PYGSLSLGCE----EHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQ 573
                  GC     E  D    G   N GE  +V  H+ +L+ AGV    IAV SPY  Q
Sbjct: 494 ------AGCGLFELEEEDEQSKG---NPGEVRLVSLHIQALVDAGVPARDIAVVSPYNLQ 544

Query: 574 VQHLRERL-DDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAI 632
           V  LR+ L    PE   +E+ ++D FQGRE +AVI+S VRSN  G VGFL + RR+NVA+
Sbjct: 545 VDLLRQSLVHRHPE---LEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAV 601

Query: 633 TRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHA 670
           TRA +HVAV+CDS T+ ++ FL  L+ +    G V+ A
Sbjct: 602 TRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTA 639




5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Acts as a transcription regulator. Required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Binds to the insulin II gene RIPE3B enhancer region. May be involved in translation (By similarity). DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region. Preferentially binds to the 5'-GGGCT-3' motif. Interacts with tRNA-Tyr. Stimulates the transcription of the human neurotropic virus JCV.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|P40694|SMBP2_MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 Back     alignment and function description
>sp|Q60560|SMBP2_MESAU DNA-binding protein SMUBP-2 OS=Mesocricetus auratus GN=IGHMBP2 PE=1 SV=1 Back     alignment and function description
>sp|Q9EQN5|SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus GN=Ighmbp2 PE=1 SV=1 Back     alignment and function description
>sp|O94247|HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcs1 PE=3 SV=1 Back     alignment and function description
>sp|P34243|HCS1_YEAST DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCS1 PE=1 SV=1 Back     alignment and function description
>sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 Back     alignment and function description
>sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 Back     alignment and function description
>sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query690
255566048 989 DNA-binding protein smubp-2, putative [R 1.0 0.697 0.847 0.0
224124044788 predicted protein [Populus trichocarpa] 1.0 0.875 0.851 0.0
297737213789 unnamed protein product [Vitis vinifera] 1.0 0.874 0.850 0.0
225454589 953 PREDICTED: DNA-binding protein SMUBP-2 [ 1.0 0.724 0.850 0.0
356501783 928 PREDICTED: DNA-binding protein SMUBP-2-l 1.0 0.743 0.816 0.0
356536591 949 PREDICTED: DNA-binding protein SMUBP-2-l 1.0 0.727 0.816 0.0
449451781 957 PREDICTED: DNA-binding protein SMUBP-2-l 1.0 0.721 0.825 0.0
297805152 979 hypothetical protein ARALYDRAFT_493645 [ 0.998 0.703 0.815 0.0
30692868 961 putative DNA-binding protein [Arabidopsi 0.998 0.716 0.818 0.0
9758800750 DNA helicase-like [Arabidopsis thaliana] 0.998 0.918 0.818 0.0
>gi|255566048|ref|XP_002524012.1| DNA-binding protein smubp-2, putative [Ricinus communis] gi|223536739|gb|EEF38380.1| DNA-binding protein smubp-2, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1203 bits (3113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/710 (84%), Positives = 643/710 (90%), Gaps = 20/710 (2%)

Query: 1   MDLERVKTIQSRLDEFTQRMSELLRIERDAELEFTQEELNAVPTPDENSDSSKPIEFLVS 60
           M+L++ K IQSR+DEFT+ MSELL+IERD+ELEFTQEELNAVPTPDENSD SKPIEFLVS
Sbjct: 280 MNLDKAKAIQSRIDEFTKTMSELLQIERDSELEFTQEELNAVPTPDENSDPSKPIEFLVS 339

Query: 61  HGRAPQELCDTICNLFVVSTSTGLGGMHLVLFRVEGNHRLPPTTLSPGDMVCVRVCDSRG 120
           HG+A QELCDTICNL  VSTSTGLGGMHLVLFRVEGNHRLPPT LSPGDMVCVR+CDSRG
Sbjct: 340 HGQAQQELCDTICNLNAVSTSTGLGGMHLVLFRVEGNHRLPPTNLSPGDMVCVRICDSRG 399

Query: 121 ACATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNC 180
           A ATSC+QGFV+NLGEDGC+ISVALESRHGDPTFSKLFGK VRIDRI GLAD LTYERNC
Sbjct: 400 AGATSCMQGFVNNLGEDGCSISVALESRHGDPTFSKLFGKGVRIDRIHGLADALTYERNC 459

Query: 181 EALMLLQKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMG-KTFDDSQ 239
           EALMLLQKNGL K+NPSIA V TLFGD ED+ WLEE DLA+W+E  +DG  G + FDDSQ
Sbjct: 460 EALMLLQKNGLQKKNPSIAIVATLFGDSEDLAWLEEKDLAEWNEADMDGCFGSERFDDSQ 519

Query: 240 KKAIALGLNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKL 299
           ++A+ALGLN+KRPLLIIQGPPGTGK+GLLKE+I RAV QGERVLVTAPTNAAVDNMVEKL
Sbjct: 520 RRAMALGLNQKRPLLIIQGPPGTGKSGLLKELIVRAVHQGERVLVTAPTNAAVDNMVEKL 579

Query: 300 SDVGLNIVRVGNPARISPAVASKSLGEIVKSKLASFVAEFERKKSDLRKDLRQCLKDDSL 359
           S++GL+IVRVGNPARIS AVASKSL EIV SKLA+F  EFERKKSDLRKDLR CL+DDSL
Sbjct: 580 SNIGLDIVRVGNPARISSAVASKSLSEIVNSKLATFRMEFERKKSDLRKDLRHCLEDDSL 639

Query: 360 AAGIRQLLKQLGKTLKKKEKETVKEVLSSAQVVLATNTGAADPLIRRLDTFDLV------ 413
           AAGIRQLLKQLGKT+KKKEKE+VKEVLSSAQVVLATNTGAADPLIRRLDTFDLV      
Sbjct: 640 AAGIRQLLKQLGKTMKKKEKESVKEVLSSAQVVLATNTGAADPLIRRLDTFDLVVIDEAG 699

Query: 414 -------------GKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATKL 460
                        GKRCILAGDQCQLAPVILSRKALEGG+GVSLLERAATLH+GVLA +L
Sbjct: 700 QAIEPSCWIPILQGKRCILAGDQCQLAPVILSRKALEGGLGVSLLERAATLHDGVLALQL 759

Query: 461 TTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYG 520
           TTQYRMNDAIASWASKEMYGG L SSS VASHLLV +PFVKPTWITQCPLLLLDTR+PYG
Sbjct: 760 TTQYRMNDAIASWASKEMYGGLLKSSSKVASHLLVHSPFVKPTWITQCPLLLLDTRMPYG 819

Query: 521 SLSLGCEEHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRER 580
           SL +GCEEHLD AGTGSFYNEGEAEIVV HV SLI AGV P+ IAVQSPYVAQVQ LR+R
Sbjct: 820 SLFIGCEEHLDPAGTGSFYNEGEAEIVVQHVISLIYAGVRPTTIAVQSPYVAQVQLLRDR 879

Query: 581 LDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRACKHVA 640
           LD+LPEA GVEVATIDSFQGREADAVIISMVRSN LGAVGFLGDSRRMNVAITRA +HVA
Sbjct: 880 LDELPEADGVEVATIDSFQGREADAVIISMVRSNNLGAVGFLGDSRRMNVAITRARRHVA 939

Query: 641 VVCDSSTICHNTFLARLLRHIRYFGRVKHAEPGSFGGSGLGMDPMLPSIS 690
           VVCDSSTICHNTFLARLLRHIRYFGRVKHAEPGSFGGSGLGMDPMLPSIS
Sbjct: 940 VVCDSSTICHNTFLARLLRHIRYFGRVKHAEPGSFGGSGLGMDPMLPSIS 989




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224124044|ref|XP_002319231.1| predicted protein [Populus trichocarpa] gi|222857607|gb|EEE95154.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297737213|emb|CBI26414.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225454589|ref|XP_002264216.1| PREDICTED: DNA-binding protein SMUBP-2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356501783|ref|XP_003519703.1| PREDICTED: DNA-binding protein SMUBP-2-like [Glycine max] Back     alignment and taxonomy information
>gi|356536591|ref|XP_003536820.1| PREDICTED: DNA-binding protein SMUBP-2-like [Glycine max] Back     alignment and taxonomy information
>gi|449451781|ref|XP_004143639.1| PREDICTED: DNA-binding protein SMUBP-2-like [Cucumis sativus] gi|449527761|ref|XP_004170878.1| PREDICTED: DNA-binding protein SMUBP-2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297805152|ref|XP_002870460.1| hypothetical protein ARALYDRAFT_493645 [Arabidopsis lyrata subsp. lyrata] gi|297316296|gb|EFH46719.1| hypothetical protein ARALYDRAFT_493645 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30692868|ref|NP_198446.3| putative DNA-binding protein [Arabidopsis thaliana] gi|332006651|gb|AED94034.1| putative DNA-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9758800|dbj|BAB09253.1| DNA helicase-like [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query690
TAIR|locus:2162858961 AT5G35970 [Arabidopsis thalian 0.598 0.429 0.775 4e-296
UNIPROTKB|E1BY42 976 E1BY42 "Uncharacterized protei 0.820 0.579 0.369 9.5e-80
UNIPROTKB|E2R760 992 IGHMBP2 "Uncharacterized prote 0.818 0.569 0.370 4.1e-77
UNIPROTKB|E2R8W1 1010 IGHMBP2 "Uncharacterized prote 0.818 0.559 0.370 4.1e-77
TAIR|locus:2056896639 AT2G03270 [Arabidopsis thalian 0.813 0.877 0.345 3.1e-76
RGD|68325 988 Ighmbp2 "immunoglobulin mu bin 0.360 0.252 0.457 1e-75
UNIPROTKB|Q9EQN5 988 Ighmbp2 "DNA-binding protein S 0.360 0.252 0.457 1e-75
UNIPROTKB|F1RY71 987 IGHMBP2 "Uncharacterized prote 0.360 0.252 0.461 7.4e-75
UNIPROTKB|Q60560 989 IGHMBP2 "DNA-binding protein S 0.360 0.251 0.457 9.6e-75
DICTYBASE|DDB_G0271732 1024 DDB_G0271732 "AN1-type zinc fi 0.356 0.240 0.422 1.6e-65
TAIR|locus:2162858 AT5G35970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1642 (583.1 bits), Expect = 4.0e-296, Sum P(2) = 4.0e-296
 Identities = 321/414 (77%), Positives = 352/414 (85%)

Query:     1 MDLERVKTIQSRLDEFTQRMSELLRIERDAELEFTQEELNAVPTPDENSDSSKPIEFLVS 60
             MD E+VK IQ R+DEFT +MS+LL++ERD ELE TQEEL+ VPTPDE+SDSSKPIEFLV 
Sbjct:   252 MDSEKVKAIQERIDEFTSQMSQLLQVERDTELEVTQEELDVVPTPDESSDSSKPIEFLVR 311

Query:    61 HGRAPQELCDTICNLFVVSTSTGLGGMHLVLFRVEGNHRLPPTTLSPGDMVCVRVCDSRG 120
             HG APQELCDTICNL+ VSTSTGLGGMHLVLF+V GNHRLPPTTLSPGDMVC+RVCDSRG
Sbjct:   312 HGDAPQELCDTICNLYAVSTSTGLGGMHLVLFKVGGNHRLPPTTLSPGDMVCIRVCDSRG 371

Query:   121 ACATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNC 180
             A AT+C QGFVHNLGEDGC+I VALESRHGDPTFSKLFGKSVRIDRI GLAD LTYERNC
Sbjct:   372 AGATACTQGFVHNLGEDGCSIGVALESRHGDPTFSKLFGKSVRIDRIHGLADALTYERNC 431

Query:   181 EALMLLQKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKL-DGIMGKTFDDSQ 239
             EALMLLQKNGL K+NPSI+ V TLFGD ED+TWLE+ND  DWSE +L D  + K FD SQ
Sbjct:   432 EALMLLQKNGLQKKNPSISVVATLFGDGEDITWLEQNDYVDWSEAELSDEPVSKLFDSSQ 491

Query:   240 KKAIALGLNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKL 299
             ++AIALG+NKKRP++I+QGPPGTGKTG+LKE+I  AVQQGERVLVTAPTNAAVDNMVEKL
Sbjct:   492 RRAIALGVNKKRPVMIVQGPPGTGKTGMLKEVITLAVQQGERVLVTAPTNAAVDNMVEKL 551

Query:   300 SDVGLNIVRVGNPARISPAVASKSLGEIVKSKLASFVAEFERKKSDLRKDLRQCLKDDSL 359
               +GLNIVRVGNPARIS AVASKSLGEIV SKLASF AE ERKKSDLRKDLRQCL+DD L
Sbjct:   552 LHLGLNIVRVGNPARISSAVASKSLGEIVNSKLASFRAELERKKSDLRKDLRQCLRDDVL 611

Query:   360 AAGIRXXXXXXXXXXXXXXXXXXXXXXSSAQVVLATNTGAADPLIRRLDTFDLV 413
             AAGIR                      S+AQVV ATN GAADPLIRRL+TFDLV
Sbjct:   612 AAGIRQLLKQLGKTLKKKEKETVKEILSNAQVVFATNIGAADPLIRRLETFDLV 665


GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
UNIPROTKB|E1BY42 E1BY42 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R760 IGHMBP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8W1 IGHMBP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2056896 AT2G03270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|68325 Ighmbp2 "immunoglobulin mu binding protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9EQN5 Ighmbp2 "DNA-binding protein SMUBP-2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RY71 IGHMBP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q60560 IGHMBP2 "DNA-binding protein SMUBP-2" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271732 DDB_G0271732 "AN1-type zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O94247HCS1_SCHPO3, ., 6, ., 4, ., 1, 20.30650.83040.8681yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XIII.2464.1
hypothetical protein (746 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query690
TIGR00376637 TIGR00376, TIGR00376, DNA helicase, putative 1e-107
pfam13087195 pfam13087, AAA_12, AAA domain 5e-66
COG1112767 COG1112, COG1112, Superfamily I DNA and RNA helica 2e-60
pfam13086220 pfam13086, AAA_11, AAA domain 1e-47
pfam1324573 pfam13245, AAA_19, Part of AAA domain 2e-13
pfam13604195 pfam13604, AAA_30, AAA domain 2e-08
pfam00580267 pfam00580, UvrD-helicase, UvrD/REP helicase N-term 3e-05
TIGR01447586 TIGR01447, recD, exodeoxyribonuclease V, alpha sub 5e-05
COG1199 654 COG1199, DinG, Rad3-related DNA helicases [Transcr 2e-04
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-04
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-04
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 3e-04
TIGR01448720 TIGR01448, recD_rel, helicase, putative, RecD/TraA 5e-04
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 8e-04
COG0210 655 COG0210, UvrD, Superfamily I DNA and RNA helicases 0.001
pfam12846316 pfam12846, AAA_10, AAA-like domain 0.002
PHA02558501 PHA02558, uvsW, UvsW helicase; Provisional 0.002
pfam07652146 pfam07652, Flavi_DEAD, Flavivirus DEAD domain 0.002
pfam05970364 pfam05970, PIF1, PIF1-like helicase 0.002
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 0.003
>gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative Back     alignment and domain information
 Score =  338 bits (868), Expect = e-107
 Identities = 229/705 (32%), Positives = 334/705 (47%), Gaps = 131/705 (18%)

Query: 26  IERDAELEFTQEELNAVPTPDENSDSSKPIEFLVSHGRAPQELCDTICNLFVVSTSTGLG 85
           +ER+AE+     E+  +            ++     GRA       I NL       GL 
Sbjct: 1   LEREAEISAMMNEIRRLS-----------LKQRERRGRA-------ILNLQG-KIRGGLL 41

Query: 86  GMHLVLFRVEGNHRLP-PTTLSPGDMVCVRVCDSRGACATSCIQGFVHNLGEDGCTISVA 144
           G  LV F      R    T +S GD+V V    SRG    S + G V  +G+    I+VA
Sbjct: 42  GFLLVRF----GRRKAIATEISVGDIVLV----SRGNPLQSDLTGVVTRVGKR--FITVA 91

Query: 145 LESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNCEALMLLQKNGLHKRNPSIAAVVTL 204
           LE     P +S    K VRID     A+ +T++R  EAL  L +N        +     +
Sbjct: 92  LE--ESVPQWSL---KRVRIDL---YANDVTFKRMKEALRALTENHS-----RLLEF--I 136

Query: 205 FGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALGLNKKRPLLIIQGPPGTGK 264
            G +      E +D   +             ++SQK+A+   L+  + L +I GPPGTGK
Sbjct: 137 LGREAPSKASEIHDFQFFD---------PNLNESQKEAVLFALSS-KDLFLIHGPPGTGK 186

Query: 265 TGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARISPAVASKSL 324
           T  L E+I + V++G RVLVTAP+N AVDN++E+L+     IVR+G+PAR+  +    SL
Sbjct: 187 TRTLVELIRQLVKRGLRVLVTAPSNIAVDNLLERLALCDQKIVRLGHPARLLKSNKQHSL 246

Query: 325 GEIVKS------------KLASFVAEFERKKSD-------------LRKDLRQ------- 352
             ++++            K+   + E  +K                LRK L++       
Sbjct: 247 DYLIENHPKYQIVADIREKIDELIEERNKKLKPSPQKRRGLSDIKILRKALKKREARGIE 306

Query: 353 CLKDDSLAAGI--RQLLKQLGKTLKKKEKETVKEVLSSAQVVLATNTGAADPLIRRLDTF 410
            LK  S+A  I   + + +L K L + E+    E+L+ + VV +TN+ A      +   F
Sbjct: 307 SLKIASMAEWIETNKSIDRLLKLLPEIEERIENEILAESDVVQSTNSSA----GLKGWEF 362

Query: 411 DLV-------------------GKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATL 451
           D+                     ++ ILAGD  QL P ILS  A    + ++L ER    
Sbjct: 363 DVAVIDEASQAMEPSCLIPLLKARKLILAGDHKQLPPTILSHDA--EELELTLFERLIKE 420

Query: 452 HEGVLATKLTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPT-----WIT 506
           +     T L  QYRMN  I  + S+E Y G L +  +VA+ LL D P V+ T       T
Sbjct: 421 YPERSRT-LNVQYRMNQKIMEFPSREFYNGKLTAHESVANILLRDLPKVEATESEDDLET 479

Query: 507 QCPLLLLDTRLPYGSLSLGCE-EHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIA 565
             PLL +DT         GCE   L  A + S YN GEAE+V   + +L+  GV  + I 
Sbjct: 480 GIPLLFIDTS--------GCELFELKEADSTSKYNPGEAELVSEIIQALVKMGVPANDIG 531

Query: 566 VQSPYVAQVQHLRERLDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDS 625
           V +PY AQV  LR+ L+       +EV+++D FQGRE + +IIS VRSN  G VGFL D 
Sbjct: 532 VITPYDAQVDLLRQLLEH--RHIDIEVSSVDGFQGREKEVIIISFVRSNRKGEVGFLKDL 589

Query: 626 RRMNVAITRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHA 670
           RR+NVA+TRA + + V+ DS T+ ++ F  RL+   +  G V+ A
Sbjct: 590 RRLNVALTRARRKLIVIGDSRTLSNHKFYKRLIEWCKQHGEVREA 634


The gene product may represent a DNA helicase. Eukaryotic members of this family have been characterized as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterized as helicases [DNA metabolism, DNA replication, recombination, and repair]. Length = 637

>gnl|CDD|221913 pfam13087, AAA_12, AAA domain Back     alignment and domain information
>gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|221912 pfam13086, AAA_11, AAA domain Back     alignment and domain information
>gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain Back     alignment and domain information
>gnl|CDD|222258 pfam13604, AAA_30, AAA domain Back     alignment and domain information
>gnl|CDD|216004 pfam00580, UvrD-helicase, UvrD/REP helicase N-terminal domain Back     alignment and domain information
>gnl|CDD|233417 TIGR01447, recD, exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|233418 TIGR01448, recD_rel, helicase, putative, RecD/TraA family Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|223288 COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|221803 pfam12846, AAA_10, AAA-like domain Back     alignment and domain information
>gnl|CDD|222875 PHA02558, uvsW, UvsW helicase; Provisional Back     alignment and domain information
>gnl|CDD|203709 pfam07652, Flavi_DEAD, Flavivirus DEAD domain Back     alignment and domain information
>gnl|CDD|191413 pfam05970, PIF1, PIF1-like helicase Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 690
KOG1803649 consensus DNA helicase [Replication, recombination 100.0
TIGR00376637 DNA helicase, putative. The gene product may repre 100.0
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 100.0
KOG18051100 consensus DNA replication helicase [Replication, r 100.0
KOG18071025 consensus Helicases [Replication, recombination an 100.0
COG1112767 Superfamily I DNA and RNA helicases and helicase s 100.0
PF13087200 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP 100.0
KOG1801827 consensus tRNA-splicing endonuclease positive effe 100.0
KOG1804775 consensus RNA helicase [RNA processing and modific 100.0
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 99.96
KOG18061320 consensus DEAD box containing helicases [Replicati 99.95
PRK11054684 helD DNA helicase IV; Provisional 99.94
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 99.93
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 99.93
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 99.93
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 99.92
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 99.88
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 99.86
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 99.85
PRK10875615 recD exonuclease V subunit alpha; Provisional 99.85
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 99.82
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 99.79
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 99.79
PRK13889 988 conjugal transfer relaxase TraA; Provisional 99.77
PRK13826 1102 Dtr system oriT relaxase; Provisional 99.77
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 99.77
PRK13909 910 putative recombination protein RecB; Provisional 99.73
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 99.72
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 99.67
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 99.66
PRK10876 1181 recB exonuclease V subunit beta; Provisional 99.65
COG3973747 Superfamily I DNA and RNA helicases [General funct 99.64
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 99.62
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 99.61
PF1324576 AAA_19: Part of AAA domain 99.49
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 99.45
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 99.39
COG0507696 RecD ATP-dependent exoDNAse (exonuclease V), alpha 99.12
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 99.07
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 99.04
PF13361351 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 99.01
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 98.96
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 98.93
COG3972660 Superfamily I DNA and RNA helicases [General funct 98.45
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.45
smart00487201 DEXDc DEAD-like helicases superfamily. 98.29
PRK10536262 hypothetical protein; Provisional 98.27
PF13538104 UvrD_C_2: UvrD-like helicase C-terminal domain; PD 98.26
TIGR02773 1158 addB_Gpos ATP-dependent nuclease subunit B. DNA re 98.23
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.1
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 97.98
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.97
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 97.86
PRK08181269 transposase; Validated 97.78
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 97.74
PRK07952244 DNA replication protein DnaC; Validated 97.67
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.66
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.65
PRK05580679 primosome assembly protein PriA; Validated 97.64
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 97.57
PHA02558501 uvsW UvsW helicase; Provisional 97.52
PRK06851367 hypothetical protein; Provisional 97.48
PRK12377248 putative replication protein; Provisional 97.45
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.45
PRK06526254 transposase; Provisional 97.42
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.42
PTZ00424401 helicase 45; Provisional 97.4
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.39
smart00382148 AAA ATPases associated with a variety of cellular 97.35
TIGR00643630 recG ATP-dependent DNA helicase RecG. 97.35
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 97.32
PRK05973237 replicative DNA helicase; Provisional 97.31
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 97.29
PRK08084235 DNA replication initiation factor; Provisional 97.27
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.27
PRK14974336 cell division protein FtsY; Provisional 97.25
PRK02362 737 ski2-like helicase; Provisional 97.25
TIGR00064272 ftsY signal recognition particle-docking protein F 97.25
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.25
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.25
PRK06851367 hypothetical protein; Provisional 97.23
PRK08116268 hypothetical protein; Validated 97.21
PRK09183259 transposase/IS protein; Provisional 97.18
PRK06893229 DNA replication initiation factor; Validated 97.17
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.17
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 97.15
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.11
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.11
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.09
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 97.09
KOG1804 775 consensus RNA helicase [RNA processing and modific 97.08
PRK06067234 flagellar accessory protein FlaH; Validated 97.06
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 97.06
PRK04328249 hypothetical protein; Provisional 97.05
PRK06835329 DNA replication protein DnaC; Validated 97.04
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 97.02
PRK10416318 signal recognition particle-docking protein FtsY; 97.01
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.01
PRK00254 720 ski2-like helicase; Provisional 97.0
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.0
TIGR02533486 type_II_gspE general secretory pathway protein E. 96.99
PRK01172 674 ski2-like helicase; Provisional 96.98
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 96.98
PF00004132 AAA: ATPase family associated with various cellula 96.98
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.98
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.97
PRK10436462 hypothetical protein; Provisional 96.97
COG1198730 PriA Primosomal protein N' (replication factor Y) 96.96
PRK04296190 thymidine kinase; Provisional 96.95
cd03115173 SRP The signal recognition particle (SRP) mediates 96.92
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 96.92
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 96.86
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.86
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 96.85
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 96.85
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.85
PRK10867433 signal recognition particle protein; Provisional 96.85
PRK09401 1176 reverse gyrase; Reviewed 96.85
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 96.84
PTZ00110545 helicase; Provisional 96.83
PRK106891147 transcription-repair coupling factor; Provisional 96.82
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 96.82
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.81
PRK13833323 conjugal transfer protein TrbB; Provisional 96.79
PRK00771437 signal recognition particle protein Srp54; Provisi 96.79
PRK06921266 hypothetical protein; Provisional 96.78
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.78
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 96.77
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.75
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.75
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 96.72
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 96.71
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 96.68
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 96.68
TIGR00959428 ffh signal recognition particle protein. This mode 96.67
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 96.65
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 96.65
cd01394218 radB RadB. The archaeal protein radB shares simila 96.65
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.64
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.64
PHA00729226 NTP-binding motif containing protein 96.64
PRK08727233 hypothetical protein; Validated 96.64
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.63
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 96.63
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 96.63
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.62
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 96.61
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 96.6
PRK05642234 DNA replication initiation factor; Validated 96.6
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.59
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.58
PLN03025319 replication factor C subunit; Provisional 96.53
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 96.52
PRK08939306 primosomal protein DnaI; Reviewed 96.52
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.52
PRK12402337 replication factor C small subunit 2; Reviewed 96.5
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.5
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.49
COG4096 875 HsdR Type I site-specific restriction-modification 96.48
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.46
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.44
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 96.43
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.42
smart00488289 DEXDc2 DEAD-like helicases superfamily. 96.41
smart00489289 DEXDc3 DEAD-like helicases superfamily. 96.41
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 96.41
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.4
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.39
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.38
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 96.37
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.37
PRK09302509 circadian clock protein KaiC; Reviewed 96.36
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.34
PF13173128 AAA_14: AAA domain 96.34
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.32
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.31
TIGR00595505 priA primosomal protein N'. All proteins in this f 96.31
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 96.3
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.28
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 96.28
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 96.27
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 96.26
PRK11823446 DNA repair protein RadA; Provisional 96.25
cd00983325 recA RecA is a bacterial enzyme which has roles in 96.25
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 96.25
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 96.24
KOG2028554 consensus ATPase related to the helicase subunit o 96.23
PF05729166 NACHT: NACHT domain 96.21
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.21
PRK14701 1638 reverse gyrase; Provisional 96.2
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.18
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.15
COG4088261 Predicted nucleotide kinase [Nucleotide transport 96.15
PRK13767 876 ATP-dependent helicase; Provisional 96.13
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.13
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 96.12
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.1
PRK13768253 GTPase; Provisional 96.09
PRK09302509 circadian clock protein KaiC; Reviewed 96.07
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.07
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.07
PRK00149450 dnaA chromosomal replication initiation protein; R 96.06
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.04
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 96.04
PHA02653675 RNA helicase NPH-II; Provisional 96.03
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 96.02
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.0
PRK09354349 recA recombinase A; Provisional 96.0
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 95.99
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 95.97
CHL00181287 cbbX CbbX; Provisional 95.97
COG2256436 MGS1 ATPase related to the helicase subunit of the 95.95
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.95
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 95.94
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.93
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 95.92
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.9
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 95.9
PHA02544316 44 clamp loader, small subunit; Provisional 95.88
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.83
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.82
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 95.81
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 95.8
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 95.8
PRK13766 773 Hef nuclease; Provisional 95.78
PRK12422445 chromosomal replication initiation protein; Provis 95.78
PF12846304 AAA_10: AAA-like domain 95.76
PRK09435332 membrane ATPase/protein kinase; Provisional 95.75
cd01393226 recA_like RecA is a bacterial enzyme which has rol 95.74
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 95.73
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.72
COG1204 766 Superfamily II helicase [General function predicti 95.72
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 95.71
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.7
cd03114148 ArgK-like The function of this protein family is u 95.69
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.69
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.68
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 95.67
PRK00889175 adenylylsulfate kinase; Provisional 95.67
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.64
PRK14088440 dnaA chromosomal replication initiation protein; P 95.6
PRK03992389 proteasome-activating nucleotidase; Provisional 95.59
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.58
PRK04195482 replication factor C large subunit; Provisional 95.57
cd03116159 MobB Molybdenum is an essential trace element in t 95.55
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 95.52
KOG1533290 consensus Predicted GTPase [General function predi 95.49
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 95.48
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 95.47
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.44
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.44
PRK05541176 adenylylsulfate kinase; Provisional 95.43
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 95.43
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 95.43
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 95.43
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.4
PRK13342413 recombination factor protein RarA; Reviewed 95.39
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 95.38
PRK13764602 ATPase; Provisional 95.38
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 95.34
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.33
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 95.33
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.33
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 95.32
PRK09694 878 helicase Cas3; Provisional 95.32
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 95.32
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.31
PRK00440319 rfc replication factor C small subunit; Reviewed 95.31
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 95.29
PHA02244383 ATPase-like protein 95.26
PRK06696223 uridine kinase; Validated 95.25
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.24
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.24
PF1355562 AAA_29: P-loop containing region of AAA domain 95.23
PTZ001121164 origin recognition complex 1 protein; Provisional 95.23
PRK06762166 hypothetical protein; Provisional 95.22
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.21
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 95.21
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 95.19
PRK07667193 uridine kinase; Provisional 95.19
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 95.19
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 95.18
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 95.17
cd02034116 CooC The accessory protein CooC, which contains a 95.16
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 95.14
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 95.13
PRK04301317 radA DNA repair and recombination protein RadA; Va 95.11
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 95.11
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 95.08
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 95.07
PRK08118167 topology modulation protein; Reviewed 95.07
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 95.05
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.05
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.03
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 95.02
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 95.01
PRK12608380 transcription termination factor Rho; Provisional 94.96
PRK06620214 hypothetical protein; Validated 94.96
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 94.96
cd03112158 CobW_like The function of this protein family is u 94.95
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 94.94
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.93
COG1936180 Predicted nucleotide kinase (related to CMP and AM 94.91
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 94.91
PRK08233182 hypothetical protein; Provisional 94.89
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 94.88
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 94.88
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 94.84
PRK14527191 adenylate kinase; Provisional 94.84
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 94.83
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.81
PF07726131 AAA_3: ATPase family associated with various cellu 94.81
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.78
PRK00131175 aroK shikimate kinase; Reviewed 94.78
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 94.78
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 94.78
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 94.78
TIGR02236310 recomb_radA DNA repair and recombination protein R 94.73
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.72
PRK08506472 replicative DNA helicase; Provisional 94.71
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 94.7
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 94.69
PRK13341 725 recombination factor protein RarA/unknown domain f 94.68
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.66
PRK06547172 hypothetical protein; Provisional 94.64
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 94.63
cd02117212 NifH_like This family contains the NifH (iron prot 94.63
COG2255332 RuvB Holliday junction resolvasome, helicase subun 94.63
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 94.62
TIGR00665434 DnaB replicative DNA helicase. This model describe 94.62
COG0714329 MoxR-like ATPases [General function prediction onl 94.62
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 94.61
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 94.6
PRK14531183 adenylate kinase; Provisional 94.58
PRK05480209 uridine/cytidine kinase; Provisional 94.57
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 94.57
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.55
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 94.55
PRK03839180 putative kinase; Provisional 94.53
PRK09519 790 recA DNA recombination protein RecA; Reviewed 94.52
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.52
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.49
COG0470325 HolB ATPase involved in DNA replication [DNA repli 94.49
KOG0354 746 consensus DEAD-box like helicase [General function 94.48
PRK07261171 topology modulation protein; Provisional 94.48
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.47
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 94.47
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 94.46
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 94.45
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 94.42
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 94.41
PRK14530215 adenylate kinase; Provisional 94.4
PRK14532188 adenylate kinase; Provisional 94.4
PRK14087450 dnaA chromosomal replication initiation protein; P 94.4
PRK04040188 adenylate kinase; Provisional 94.4
PLN02200234 adenylate kinase family protein 94.36
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 94.34
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 94.34
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 94.33
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 94.32
COG0606490 Predicted ATPase with chaperone activity [Posttran 94.31
KOG0731774 consensus AAA+-type ATPase containing the peptidas 94.31
PRK13531498 regulatory ATPase RavA; Provisional 94.31
PRK06761282 hypothetical protein; Provisional 94.31
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 94.29
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 94.29
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 94.27
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 94.26
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 94.23
cd02040270 NifH NifH gene encodes component II (iron protein) 94.19
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 94.19
KOG0987540 consensus DNA helicase PIF1/RRM3 [Cell cycle contr 94.17
PRK02496184 adk adenylate kinase; Provisional 94.16
COG1200677 RecG RecG-like helicase [DNA replication, recombin 94.16
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 94.15
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 94.15
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 94.14
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 94.13
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 94.13
PRK14528186 adenylate kinase; Provisional 94.13
KOG2108 853 consensus 3'-5' DNA helicase [Replication, recombi 94.12
PHA02624647 large T antigen; Provisional 94.12
CHL00195489 ycf46 Ycf46; Provisional 94.11
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 94.09
PRK13851344 type IV secretion system protein VirB11; Provision 94.08
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 93.99
PRK14086617 dnaA chromosomal replication initiation protein; P 93.96
PHA02542473 41 41 helicase; Provisional 93.96
COG3911183 Predicted ATPase [General function prediction only 93.95
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 93.95
PRK00279215 adk adenylate kinase; Reviewed 93.93
COG4098441 comFA Superfamily II DNA/RNA helicase required for 93.93
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 93.93
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 93.92
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 93.91
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 93.89
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.89
PRK15453290 phosphoribulokinase; Provisional 93.88
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 93.84
PRK05439311 pantothenate kinase; Provisional 93.83
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 93.82
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 93.82
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 93.8
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 93.8
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 93.79
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 93.75
PRK08154309 anaerobic benzoate catabolism transcriptional regu 93.75
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 93.74
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 93.73
PRK10865857 protein disaggregation chaperone; Provisional 93.73
PRK05595444 replicative DNA helicase; Provisional 93.72
PRK13407334 bchI magnesium chelatase subunit I; Provisional 93.7
PRK13973213 thymidylate kinase; Provisional 93.69
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 93.69
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 93.69
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 93.69
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 93.68
PRK08760476 replicative DNA helicase; Provisional 93.67
PRK13947171 shikimate kinase; Provisional 93.67
PRK00698205 tmk thymidylate kinase; Validated 93.66
PRK05748448 replicative DNA helicase; Provisional 93.66
PTZ00301210 uridine kinase; Provisional 93.66
PRK09165497 replicative DNA helicase; Provisional 93.64
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 93.57
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 93.55
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 93.52
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 93.51
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 93.51
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 93.51
PRK01184184 hypothetical protein; Provisional 93.51
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 93.46
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 93.44
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 93.44
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 93.39
PF13479213 AAA_24: AAA domain 93.38
PRK13234295 nifH nitrogenase reductase; Reviewed 93.37
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 93.33
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 93.32
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 93.31
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.31
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 93.3
PHA03311 828 helicase-primase subunit BBLF4; Provisional 93.28
PRK09087226 hypothetical protein; Validated 93.28
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 93.28
PRK13235274 nifH nitrogenase reductase; Reviewed 93.28
CHL00176638 ftsH cell division protein; Validated 93.27
cd02036179 MinD Bacterial cell division requires the formatio 93.26
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.24
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 93.19
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 93.18
PTZ00088229 adenylate kinase 1; Provisional 93.17
PRK03846198 adenylylsulfate kinase; Provisional 93.17
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 93.11
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 93.11
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 93.08
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 93.06
PHA02530300 pseT polynucleotide kinase; Provisional 93.05
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 93.04
COG1855604 ATPase (PilT family) [General function prediction 93.02
PRK15455 644 PrkA family serine protein kinase; Provisional 93.0
PRK13695174 putative NTPase; Provisional 92.99
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 92.99
COG1201 814 Lhr Lhr-like helicases [General function predictio 92.99
PRK00625173 shikimate kinase; Provisional 92.93
PTZ00202550 tuzin; Provisional 92.93
PRK07940394 DNA polymerase III subunit delta'; Validated 92.92
PHA02774613 E1; Provisional 92.92
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 92.91
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 92.9
TIGR01287275 nifH nitrogenase iron protein. This model describe 92.9
PRK13949169 shikimate kinase; Provisional 92.88
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 92.85
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 92.81
PRK10865 857 protein disaggregation chaperone; Provisional 92.77
PHA00350399 putative assembly protein 92.76
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 92.74
PRK12339197 2-phosphoglycerate kinase; Provisional 92.74
PRK13765 637 ATP-dependent protease Lon; Provisional 92.71
PRK14526211 adenylate kinase; Provisional 92.69
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 92.64
KOG0736953 consensus Peroxisome assembly factor 2 containing 92.64
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 92.63
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 92.63
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 92.62
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 92.62
PRK06217183 hypothetical protein; Validated 92.61
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 92.61
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 92.58
PHA00547337 hypothetical protein 92.58
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 92.56
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 92.56
TIGR00235207 udk uridine kinase. Model contains a number of lon 92.49
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 92.47
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 92.46
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 92.42
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 92.42
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 92.42
PRK14737186 gmk guanylate kinase; Provisional 92.41
PF07088484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 92.4
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 92.4
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
Probab=100.00  E-value=4.3e-117  Score=938.13  Aligned_cols=625  Identities=45%  Similarity=0.633  Sum_probs=539.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCCcchHHHhhcCCCcccccccccceeEeeeeeecCCeEEEEEE
Q 038763           14 DEFTQRMSELLRIERDAELEFTQEELNAVPTPDENSDSSKPIEFLVSHGRAPQELCDTICNLFVVSTSTGLGGMHLVLFR   93 (690)
Q Consensus        14 ~~~~~~~~~l~~~e~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~l~~~~~~~g~~g~~~~~~~   93 (690)
                      ++|++++.+||++||++|++.++.++.+.+           ++.|+++|.       |++||.+.+.++|++|+.++.|.
T Consensus         3 ~~f~sk~~~ll~~er~~ei~~t~~~~~~~~-----------ie~l~~~g~-------~i~nl~~v~~~tGl~g~~li~f~   64 (649)
T KOG1803|consen    3 EEFVSKMSELLDHERKAEISVTEKSLDNVP-----------IEALQRKGL-------AILNLWLVSVRTGLGGKSLIVFS   64 (649)
T ss_pred             hHHHHHHHHHHHhhhhcchhhhhHhhhcCC-----------HHHHHhccc-------eeeeEEEEEEeecccceEEEEec
Confidence            689999999999999999999999999887           889999987       59999999999999999999998


Q ss_pred             ecCCCCCCCCCCCCCCEEEEEecCCCCCCCCcceeEEEEEEcCCceEEEEEEecCCCCCccccccCceeEEeEEeeccch
Q 038763           94 VEGNHRLPPTTLSPGDMVCVRVCDSRGACATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADT  173 (690)
Q Consensus        94 ~~~~~~~~~~~~~~Gd~V~i~~~~~~~~~~~~~~~g~V~~~~~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  173 (690)
                      ... +.+|++.|.+||+|.|+ .+........|.+|+|+++..  ..|++++++..+.|...    ..+   ++.+++|.
T Consensus        65 ~~~-~~lp~~~~~~gd~v~lr-~~~~~~~~~~~~~GvV~~~~~--~~i~~a~ee~~d~~~~~----~~l---~l~kl~n~  133 (649)
T KOG1803|consen   65 KNR-EVLPSNSFGPGDVVWLR-TDKLNNKSKPCTEGVVYRVAE--DSIDVAFEEEVDKPLTL----SSL---RLLKLENK  133 (649)
T ss_pred             cCc-cccCcCCCCCCcEEEEE-cccccccCcccccceeEeecc--chhhHhHHhhhcccchh----hHH---HHHHhhhh
Confidence            755 78999999999999998 444444444588999999987  48999998765444322    122   45688999


Q ss_pred             hhHHHHHHHHHHHHhccccCCCCchhHHHhhhCCCccchhhhccccccchhhhhcCCCCCCCCHHHHHHHHHHhcCCCCe
Q 038763          174 LTYERNCEALMLLQKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALGLNKKRPL  253 (690)
Q Consensus       174 ~t~~r~~~al~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LN~~Q~~Av~~al~~~~~~  253 (690)
                      +||+||..++..++......  +...++.+++++.+++.+.+..       ......+...||+||++||.++++.+ ++
T Consensus       134 vty~R~~~~~i~l~~~~~~~--~~~~vv~~l~~~~~~~~~~~~~-------~~~~~~~~~~ln~SQk~Av~~~~~~k-~l  203 (649)
T KOG1803|consen  134 VTYRRMKDTMICLSKFSNPG--PSSDVVETLFGDRKPIPSPNIE-------IKKITFFNKNLNSSQKAAVSFAINNK-DL  203 (649)
T ss_pred             hhheecHHHHhhHhhhcCcc--chhhhHHHHhccccCCCCchhh-------hcccccCCccccHHHHHHHHHHhccC-Cc
Confidence            99999999999998754332  6677899999998876654311       00012334569999999999999875 79


Q ss_pred             EEEeCCCCCChhHHHHHHHHHHHHcCCeEEEEcCChHHHHHHHHHHHhcCCceeecCCCcccCchhccccHHHHHHHHHH
Q 038763          254 LIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARISPAVASKSLGEIVKSKLA  333 (690)
Q Consensus       254 ~lI~GPPGTGKT~tl~~~i~~l~~~g~rVLv~a~SN~AvD~l~erL~~~~~~~vRiG~~~r~~~~~~~~~l~~~~~~~l~  333 (690)
                      .+||||||||||+|++++|.|+++++++||||||||.|||||++||...+..++|+|+|+|+.+.+..++++.+..+...
T Consensus       204 ~~I~GPPGTGKT~TlvEiI~qlvk~~k~VLVcaPSn~AVdNiverl~~~~~~l~R~g~paRl~~~~~~~sld~~~~t~d~  283 (649)
T KOG1803|consen  204 LIIHGPPGTGKTRTLVEIISQLVKQKKRVLVCAPSNVAVDNIVERLTHLKLNLVRVGHPARLLESVADHSLDLLSNTKDN  283 (649)
T ss_pred             eEeeCCCCCCceeeHHHHHHHHHHcCCeEEEEcCchHHHHHHHHHhcccccchhhcCchhhhhhhhhhhHHHHHHhcCch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998876543


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCcEEEEcccccchHHHhcCCCcccc
Q 038763          334 SFVAEFERKKSDLRKDLRQCLKDDSLAAGIRQLLKQLGKTLKKKEKETVKEVLSSAQVVLATNTGAADPLIRRLDTFDLV  413 (690)
Q Consensus       334 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~il~~a~Vv~~T~~~a~~~~l~~~~~fD~v  413 (690)
                      .......++..++......+.+++..++.++..++.+++++++++.+.+.+++.+++||++|+.++...++.. ..||+|
T Consensus       284 ~~~~~~~sk~~d~~~~~~~~tk~~~~~~~~~~~i~~lrkdl~kre~~~v~eii~n~~VVfaTl~ga~~~~~~~-~~fD~v  362 (649)
T KOG1803|consen  284 SQNAKDISKDIDILFQKNTKTKNDKLRKGIRKEIKLLRKDLRKRERKTVKEIISNSRVVFATLGGALDRLLRK-RTFDLV  362 (649)
T ss_pred             hhhhhhhHHHHHHHhhhhhcccchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccceEEEeccchhhhhhcc-cCCCEE
Confidence            3332222222233334455567788899999999999999999999999999999999999999999987777 489988


Q ss_pred             -------------------cceeeecCCCCCCCccccchhhhhcCCCccHHHHHHHhCCCccccccccccCCchhHHHhh
Q 038763          414 -------------------GKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATKLTTQYRMNDAIASWA  474 (690)
Q Consensus       414 -------------------~~~~VLvGD~~QLpP~v~s~~a~~~gl~~SLfeRl~~~~~~~~~~~L~~qYRm~~~I~~f~  474 (690)
                                         ++++||+|||+||||+|.|.++...|+..|+|||+.+.+++....+|++|||||..||.|+
T Consensus       363 IIDEaaQamE~~cWipvlk~kk~ILaGDp~QLpP~v~S~~a~~~gl~~Sl~erlae~~~~~~~~~Ln~QYRMn~~Im~ws  442 (649)
T KOG1803|consen  363 IIDEAAQAMEPQCWIPVLKGKKFILAGDPKQLPPTVLSDKAKRGGLQVSLLERLAEKFGNLSKILLNEQYRMNEKIMNWS  442 (649)
T ss_pred             EEehhhhhccchhhhHHhcCCceEEeCCcccCCcccccchhhhccchhhHHHHHHHHcccchhhhhhhhhcchHHHhhCc
Confidence                               7899999999999999999999999999999999999999998999999999999999999


Q ss_pred             hhccCCCcccCCcccccccccCCCCCCCCCCCCCCeEEEeCCCCCCCCCCCcccccccCCCCCccCHHHHHHHHHHHHHH
Q 038763          475 SKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGSLSLGCEEHLDLAGTGSFYNEGEAEIVVHHVFSL  554 (690)
Q Consensus       475 s~~fY~g~L~~~~~v~~~~l~~~~~~~~~~~~~~p~~~~dt~~~~~~~~~~~~e~~~~~~~~S~~N~~Ea~~v~~~v~~L  554 (690)
                      |..||+|+|+++.+++++.|.|+|.+.+.|....|++|+||++.+..-..+++++     -+|++|+.||++|..+++.|
T Consensus       443 n~~fY~~qlka~~~v~~~lL~dl~~v~~t~~t~~PlvlvDT~~~~~~e~~~e~~~-----~~S~~N~gEa~Iv~~Hv~~L  517 (649)
T KOG1803|consen  443 NEVFYNGQLKAASSVASHLLRDLPNVLATESTKSPLVLVDTQGEKDEEKRGEEEE-----LGSKYNEGEAKIVMEHVKRL  517 (649)
T ss_pred             HhhhcCCeeeecchhhhhhhhcccCCCCccccCCcEEEEecccchhhhhccchhh-----ccccCCHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999997554322222222     25999999999999999999


Q ss_pred             HHCCCCCCcEEEEcCcHHHHHHHHHHhhcCCCCCCeEEecccCccCccccEEEEEeeecCCCCcccccCCCCceeeeecc
Q 038763          555 ICAGVSPSAIAVQSPYVAQVQHLRERLDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITR  634 (690)
Q Consensus       555 ~~~g~~~~~IgIItpY~~Qv~~l~~~L~~~~~~~~v~V~TVd~fQG~E~dvVIlS~vrsn~~~~~gfl~d~rRlNVAlTR  634 (690)
                      +..|+++.||||||||++|+.+||..  ......+++|+|||+|||+|+|+||||+||||+.+++|||.|.||||||+||
T Consensus       518 ~~~gV~p~dIaVIsPY~aQv~llR~~--~~~~~~~veV~TVD~fQGrEkdvVIfsmVRSN~k~evGFL~e~RRLNVAiTR  595 (649)
T KOG1803|consen  518 LEAGVQPSDIAVISPYNAQVSLLREE--DEEDFRDVEVGTVDGFQGREKDVVIFSLVRSNDKGEVGFLGETRRLNVAITR  595 (649)
T ss_pred             HHcCCChhHeEEeccchHHHHHHhhc--ccccCccceeecccccccceeeEEEEEEEeecCcccccccCCcceeeEEEEe
Confidence            99999999999999999999999932  2344567999999999999999999999999999999999999999999999


Q ss_pred             ccccEEEEecCcccc-cChHHHHHHHHHHHcCcEEecCCCCCcCCCCCCCCCCCC
Q 038763          635 ACKHVAVVCDSSTIC-HNTFLARLLRHIRYFGRVKHAEPGSFGGSGLGMDPMLPS  688 (690)
Q Consensus       635 Ak~~LiivG~~~tl~-~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  688 (690)
                      ||++++||||..|++ .+.++++|++|+.+++.+..++-   +.++.+++|.++.
T Consensus       596 aRRh~~vIgds~tl~~~~~~l~k~~~f~~~~~~~~~p~~---~~~~~~~~~~~~~  647 (649)
T KOG1803|consen  596 ARRHFVVIGDSRTLKEGNEFLKKLVEFLEENKLVFGPSI---LEYFNDAEPAAYP  647 (649)
T ss_pred             ccceEEEEcCcHHHHhhHHHHHHHHHHhhhcceeccccc---hhhhhcccccccc
Confidence            999999999999999 89999999999999999975543   4555666665554



>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A Back     alignment and domain information
>KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] Back     alignment and domain information
>KOG1804 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR02773 addB_Gpos ATP-dependent nuclease subunit B Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG1804 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>KOG0987 consensus DNA helicase PIF1/RRM3 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA03311 helicase-primase subunit BBLF4; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PHA00547 hypothetical protein Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query690
4b3g_A646 Crystal Structure Of Ighmbp2 Helicase In Complex Wi 8e-83
4b3f_X646 Crystal Structure Of 1ghmbp2 Helicase Length = 646 1e-82
2xzl_A802 Upf1-Rna Complex Length = 802 3e-45
2gjk_A624 Structural And Functional Insights Into The Human U 2e-42
2xzo_A623 Upf1 Helicase - Rna Complex Length = 623 2e-42
2wjv_A800 Crystal Structure Of The Complex Between Human Nons 2e-42
>pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 Back     alignment and structure

Iteration: 1

Score = 305 bits (780), Expect = 8e-83, Method: Compositional matrix adjust. Identities = 247/698 (35%), Positives = 349/698 (50%), Gaps = 104/698 (14%) Query: 13 LDEFTQRMSELLRIERDAELEFTQEELNAVPTPDENSDSSKPIEFLVSHGRAPQELCDTI 72 ++ F + +LL +ERDAE+E + + EN ++ L S G +C + Sbjct: 4 VESFVTKQLDLLELERDAEVEERR-------SWQENIS----LKELQSRG-----VC--L 45 Query: 73 CNLFVVSTSTGLGGMHLVLF---RVEGNHRLPPTTLSPGDMVCVRVCDSRGACATSCIQG 129 L V S TGL G LV F R LP + + GD+V + + G+ + I Sbjct: 46 LKLQVSSQRTGLYGRLLVTFEPRRYGSAAALPSNSFTSGDIVGLYDAANEGSQLATGILT 105 Query: 130 FVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRID---RIQGLADTLTYERNCEALMLL 186 V +++VA + H F +S+ + R+ LA+ +TY R +AL+ L Sbjct: 106 RVTQ-----KSVTVAFDESHD-------FQQSLDRENSYRLLKLANDVTYRRLKKALIAL 153 Query: 187 QKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALG 246 +K + P+ + + LFG + + SE+ D SQK+A+ Sbjct: 154 KK---YHSGPASSLIEVLFG---------RSAPSPASEIHPLTFFNTCLDTSQKEAVLFA 201 Query: 247 LNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNI 306 L++K L II GPPGTGKT + EII +AV+QG +VL AP+N AVDN+VE+L+ I Sbjct: 202 LSQKE-LAIIHGPPGTGKTTTVVEIILQAVKQGLKVLCCAPSNIAVDNLVERLALCKQRI 260 Query: 307 VRVGNPARISPAVASKSLGEIV-KSKLASFVAEFERKKSDLRKDLRQCL------KDDSL 359 +R+G+PAR+ ++ SL ++ +S A VA D+RKD+ Q +D Sbjct: 261 LRLGHPARLLESIQQHSLDAVLARSDSAQIVA-------DIRKDIDQVFVKNKKTQDKRE 313 Query: 360 AAGIRXXXXXXXXXXXXXXXXXXXXXXSSAQVVLATNTGA-ADPLIRRL--DTFDLV--- 413 + R +SA VVLATNTGA AD ++ L FD+V Sbjct: 314 KSNFRNEIKLLRKELKEREEAAMLESLTSANVVLATNTGASADGPLKLLPESYFDVVVID 373 Query: 414 ----------------GKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLA 457 ++CILAGD QL P +S KA G+ +SL+ER A + + Sbjct: 374 ECAQALEASCWIPLLKARKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEYGARVV 433 Query: 458 TKLTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRL 517 LT QYRM+ AI WAS MY G L + S+VA HLL D P V T T PLLL+DT Sbjct: 434 RTLTVQYRMHQAIMRWASDTMYLGQLTAHSSVARHLLRDLPGVAATEETGVPLLLVDT-- 491 Query: 518 PYGSLSLGCE----EHLDLAGTGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQ 573 GC E D G N GE +V H+ +L+ AGV IAV SPY Q Sbjct: 492 ------AGCGLFELEEEDEQSKG---NPGEVRLVSLHIQALVDAGVPARDIAVVSPYNLQ 542 Query: 574 VQHLRERL-DDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAI 632 V LR+ L PE +E+ ++D FQGRE +AVI+S VRSN G VGFL + RR+NVA+ Sbjct: 543 VDLLRQSLVHRHPE---LEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAV 599 Query: 633 TRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHA 670 TRA +HVAV+CDS T+ ++ FL L+ + G V+ A Sbjct: 600 TRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTA 637
>pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 Back     alignment and structure
>pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 Back     alignment and structure
>pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 Back     alignment and structure
>pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 Back     alignment and structure
>pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query690
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 1e-147
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 1e-144
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 1e-137
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 3e-11
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 8e-11
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 2e-07
1yks_A440 Genome polyprotein [contains: flavivirin protease 8e-07
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 1e-06
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 2e-06
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 8e-06
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 9e-05
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 2e-04
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
 Score =  441 bits (1136), Expect = e-147
 Identities = 162/613 (26%), Positives = 258/613 (42%), Gaps = 76/613 (12%)

Query: 77  VVSTSTGLGGMHLVLFRVEGNHRLPPTTLSPGDMVCVRVCDSRGACATSCIQGFVHNLGE 136
            V    GL    +  F +          L  GD +C+R              G V  + +
Sbjct: 40  TVRWDLGLNKKRIAYFTLPKTDSDM--RLMQGDEICLRYKGDLAP--LWKGIGHVIKVPD 95

Query: 137 D-GCTISVALESRHGDPTFSKLFGKSVRIDRIQGLADTLTYERNCEALMLLQKNGLHKRN 195
           + G  I++ L S  G P        + ++D    +  + +++R   AL     +   + +
Sbjct: 96  NYGDEIAIELRSSVGAPVEV---THNFQVDF---VWKSTSFDRMQSALKTFAVD---ETS 146

Query: 196 PSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALGLNKKRPLLI 255
            S      L G + +   ++      ++   L        + SQ  A+   L   RPL +
Sbjct: 147 VSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPD-----LNHSQVYAVKTVLQ--RPLSL 199

Query: 256 IQGPPGTGKTGLLKEIIARAVQQGE-RVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPAR 314
           IQGPPGTGKT     I+    +QG   VLV AP+N AVD + EK+   GL +VR+   +R
Sbjct: 200 IQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSR 259

Query: 315 ISPAVASKSLGEIVKSKLASFVAEFERKKSDLRKDLRQCLKDDSLAAGIRQLLKQLGKTL 374
                      E + S ++      + +  D   +L+   K   L     +L     K  
Sbjct: 260 -----------EAIDSPVSFLALHNQIRNMDSMPELQ---KLQQLKDETGELSSADEKRY 305

Query: 375 KKKEKETVKEVLSSAQVVLATNTGAADPLIRRLDTFDLV--------------------G 414
           +  ++   +E+L +A V+  T  GA DP + ++  F  +                     
Sbjct: 306 RALKRTAERELLMNADVICCTCVGAGDPRLAKMQ-FRSILIDESTQATEPECMVPVVLGA 364

Query: 415 KRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATKLTTQYRMNDAIASWA 474
           K+ IL GD CQL PV++ +KA + G+  SL ER   L   +   +L  QYRM+ A++++ 
Sbjct: 365 KQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLG--IRPIRLQVQYRMHPALSAFP 422

Query: 475 SKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGSLSLGCEEHLDLAG 534
           S   Y GSL +  T A  +     F  P      P+    T+        G EE    + 
Sbjct: 423 SNIFYEGSLQNGVTAADRVKKGFDFQWPQ--PDKPMFFYVTQ--------GQEEIA--SS 470

Query: 535 TGSFYNEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRERLDDL-----PEAAG 589
             S+ N  EA  V      L+ AG  P  I + +PY  Q  +L + +             
Sbjct: 471 GTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQE 530

Query: 590 VEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRACKHVAVVCDSSTIC 649
           VE+A++D+FQGRE D +I+S VR+N    +GFL D RR+NVA+TRA   V +V +   + 
Sbjct: 531 VEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALS 590

Query: 650 HNTFLARLLRHIR 662
                  LL + +
Sbjct: 591 KQPLWNHLLNYYK 603


>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Length = 574 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Length = 459 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Length = 608 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query690
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 100.0
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 100.0
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 100.0
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 100.0
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 99.96
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 99.93
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 99.93
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 99.93
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 99.91
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 99.87
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 99.76
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 99.73
3dmn_A174 Putative DNA helicase; APC89291.2, lactobacillus p 99.57
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 99.57
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 98.99
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.11
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.0
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.98
3b6e_A216 Interferon-induced helicase C domain-containing P; 97.97
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.91
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.84
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.82
3bor_A237 Human initiation factor 4A-II; translation initiat 97.8
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.8
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.8
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.77
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.74
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.74
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.71
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.7
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.69
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.69
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 97.68
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 97.68
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 97.66
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.65
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 97.65
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 97.62
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.58
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.56
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.53
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.49
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.48
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.45
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.45
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 97.42
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.36
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 97.36
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 97.36
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 97.35
3h1t_A590 Type I site-specific restriction-modification syst 97.35
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.34
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.33
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 97.33
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 97.31
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.31
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 97.3
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 97.28
3bos_A242 Putative DNA replication factor; P-loop containing 97.27
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 97.24
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 97.23
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.23
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 97.23
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 97.23
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 97.21
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.08
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 97.07
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.05
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.04
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 97.02
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.01
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.01
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 97.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 96.95
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.92
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.91
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.88
4gl2_A 699 Interferon-induced helicase C domain-containing P; 96.85
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 96.85
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 96.85
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.84
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.82
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.82
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.73
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 96.73
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.68
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.66
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.64
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.62
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 96.61
2qgz_A308 Helicase loader, putative primosome component; str 96.61
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.59
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.58
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 96.55
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.54
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.52
1tue_A212 Replication protein E1; helicase, replication, E1E 96.5
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.49
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 96.46
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.44
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.41
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.41
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.41
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 96.4
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 96.4
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 96.39
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 96.39
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 96.38
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 96.34
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.33
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 96.28
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.27
1yks_A440 Genome polyprotein [contains: flavivirin protease 96.27
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 96.26
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.26
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.25
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 96.24
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.2
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.2
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.18
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 96.17
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 96.15
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.15
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.14
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 96.13
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.12
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.12
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.11
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.08
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.08
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.07
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 96.07
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.07
3co5_A143 Putative two-component system transcriptional RES 96.06
3io5_A333 Recombination and repair protein; storage dimer, i 96.06
1p9r_A418 General secretion pathway protein E; bacterial typ 96.06
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.03
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.02
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.99
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.98
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 95.96
1xp8_A366 RECA protein, recombinase A; recombination, radior 95.96
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 95.94
2xxa_A433 Signal recognition particle protein; protein trans 95.9
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.85
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.85
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 95.85
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 95.83
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.81
2z43_A324 DNA repair and recombination protein RADA; archaea 95.81
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.78
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.75
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.74
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.74
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.73
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 95.72
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.7
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 95.7
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 95.67
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 95.67
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.66
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.64
2r6a_A454 DNAB helicase, replicative helicase; replication, 95.64
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.63
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.63
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.62
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.59
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 95.59
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 95.57
2r62_A268 Cell division protease FTSH homolog; ATPase domain 95.56
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.55
3pvs_A447 Replication-associated recombination protein A; ma 95.5
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.49
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.48
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 95.45
2chq_A319 Replication factor C small subunit; DNA-binding pr 95.45
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.45
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 95.44
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 95.44
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 95.43
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.43
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.42
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 95.42
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.41
2r44_A331 Uncharacterized protein; putative ATPase, structur 95.4
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.4
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.4
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 95.39
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.38
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.36
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.32
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.31
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.29
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.28
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.24
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 95.24
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.22
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 95.21
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 95.21
3bs4_A260 Uncharacterized protein PH0321; structural genomic 95.2
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 95.19
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.17
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 95.13
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 95.12
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.1
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 95.03
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.01
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 94.99
2og2_A359 Putative signal recognition particle receptor; nuc 94.95
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.91
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 94.89
2gno_A305 DNA polymerase III, gamma subunit-related protein; 94.88
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.85
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.84
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 94.82
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.82
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.81
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 94.81
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.8
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 94.77
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 94.75
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 94.75
1ojl_A304 Transcriptional regulatory protein ZRAR; response 94.74
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 94.71
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.67
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 94.64
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.62
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.6
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.53
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.53
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.49
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 94.45
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.39
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.35
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.33
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.33
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 94.31
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 94.29
2fna_A357 Conserved hypothetical protein; structural genomic 94.28
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.28
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.27
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 94.24
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.24
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 94.24
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.22
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 94.21
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.2
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 94.2
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 94.2
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.16
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.16
1via_A175 Shikimate kinase; structural genomics, transferase 94.15
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.13
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 94.12
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.11
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 94.11
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.03
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.01
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 94.0
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 93.99
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.98
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 93.98
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 93.96
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.95
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.94
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.94
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 93.93
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 93.92
2www_A349 Methylmalonic aciduria type A protein, mitochondri 93.92
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 93.92
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.89
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 93.87
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.86
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.83
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.81
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 93.79
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.75
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.72
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.71
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 93.7
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 93.7
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.69
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 93.67
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.67
2ewv_A372 Twitching motility protein PILT; pilus retraction 93.67
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.65
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 93.65
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 93.63
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.62
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 93.6
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.6
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.59
4a74_A231 DNA repair and recombination protein RADA; hydrola 93.58
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.56
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 93.55
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.54
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 93.54
3tlx_A243 Adenylate kinase 2; structural genomics, structura 93.51
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 93.48
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.43
1w36_C 1122 RECC, exodeoxyribonuclease V gamma chain; recombin 93.42
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.38
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 93.37
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.35
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.31
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.28
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 93.28
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 93.21
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 93.18
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 93.17
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 93.17
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 93.16
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 93.14
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.14
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 93.13
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 93.11
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 93.1
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.04
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.0
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 92.95
2oap_1511 GSPE-2, type II secretion system protein; hexameri 92.94
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 92.93
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 92.89
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 92.89
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 92.82
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 92.82
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 92.79
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 92.72
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 92.69
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 92.64
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 92.62
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 92.61
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 92.59
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 92.58
3end_A307 Light-independent protochlorophyllide reductase ir 92.51
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 92.46
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 92.44
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 92.44
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 92.43
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 92.43
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 92.4
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 92.39
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 92.38
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.32
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 92.31
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.31
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 92.26
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 92.2
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.15
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.15
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 92.11
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.03
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 91.92
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 91.92
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 91.89
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 91.85
3cwq_A209 Para family chromosome partitioning protein; alpha 91.67
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 91.63
2hf9_A226 Probable hydrogenase nickel incorporation protein 91.58
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 91.55
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 91.5
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 91.45
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 91.45
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 91.43
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 91.34
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 91.33
3r20_A233 Cytidylate kinase; structural genomics, seattle st 91.32
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 91.3
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.27
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 91.22
3igf_A374 ALL4481 protein; two-domained protein consisting o 91.21
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 91.18
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 91.17
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 91.04
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 91.0
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 90.91
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 90.74
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 90.68
3fwy_A314 Light-independent protochlorophyllide reductase I 90.65
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 90.55
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 90.48
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 90.47
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 90.44
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 90.32
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 90.27
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 90.25
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 90.21
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.2
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 90.14
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 90.02
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 90.0
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 89.88
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 89.86
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 89.79
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 89.72
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 89.69
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 89.65
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 89.62
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 89.61
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 89.61
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 89.51
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 89.49
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 89.47
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 89.29
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 89.28
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 89.19
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 89.04
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 89.02
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 89.0
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 88.87
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 88.86
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 88.85
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 88.79
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 88.78
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 88.77
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 88.65
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 88.6
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 88.57
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 88.47
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 88.47
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 88.42
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 88.42
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 88.41
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 88.41
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 88.37
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 88.15
3ice_A422 Transcription termination factor RHO; transcriptio 88.14
3kta_A182 Chromosome segregation protein SMC; structural mai 88.05
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 87.86
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 87.58
3l0o_A427 Transcription termination factor RHO; helicase, RH 87.46
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 87.45
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 87.45
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 87.45
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 87.2
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 87.16
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 87.07
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 86.93
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 86.74
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 85.89
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 85.63
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 85.07
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 84.94
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 84.8
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 84.65
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 84.64
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 84.64
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 84.58
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 84.56
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 84.52
1nrj_B218 SR-beta, signal recognition particle receptor beta 84.5
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 84.43
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 84.34
1sgw_A214 Putative ABC transporter; structural genomics, P p 84.18
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 84.09
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 84.0
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 83.81
2wji_A165 Ferrous iron transport protein B homolog; membrane 83.71
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 83.61
1b0u_A262 Histidine permease; ABC transporter, transport pro 83.61
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 83.48
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 83.44
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 83.19
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 83.15
1g6h_A257 High-affinity branched-chain amino acid transport 83.1
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 83.02
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 83.02
1ji0_A240 ABC transporter; ATP binding protein, structural g 82.9
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 82.89
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 82.8
2ged_A193 SR-beta, signal recognition particle receptor beta 82.78
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 82.75
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 82.73
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 82.68
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 82.57
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 82.53
2ghi_A260 Transport protein; multidrug resistance protein, M 82.52
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 82.35
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 82.33
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 82.32
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 82.32
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 82.15
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 81.97
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 81.93
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 81.83
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 81.8
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 81.68
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 81.65
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 81.65
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 81.57
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 81.56
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 81.54
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 81.51
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 81.5
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 81.44
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 81.35
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 81.32
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 81.22
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 81.18
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
Probab=100.00  E-value=6.9e-102  Score=897.88  Aligned_cols=605  Identities=39%  Similarity=0.546  Sum_probs=488.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCCcchHHHhhcCCCcccccccccceeEeeeeeecCCeEEE
Q 038763           11 SRLDEFTQRMSELLRIERDAELEFTQEELNAVPTPDENSDSSKPIEFLVSHGRAPQELCDTICNLFVVSTSTGLGGMHLV   90 (690)
Q Consensus        11 ~~~~~~~~~~~~l~~~e~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~l~~~~~~~g~~g~~~~   90 (690)
                      +++++|+++|.+||++||++|+++++++++++|           +++++++       |+||++|.+.+.++|++|++++
T Consensus         2 ~~~~~~~~~~~~Ll~~E~~~e~~~~~~~~~~~~-----------~~~~~~~-------G~~~~~l~~~~~~~~~~g~~~~   63 (646)
T 4b3f_X            2 AAVESFVTKQLDLLELERDAEVEERRSWQENIS-----------LKELQSR-------GVCLLKLQVSSQRTGLYGRLLV   63 (646)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSC-----------HHHHGGG-------TSEEEEEEEEEEEECSSSCEEE
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCC-----------HHHHHhC-------CceecceEEEEEEecCCCeEEE
Confidence            579999999999999999999999999999988           3455555       5689999999999999999999


Q ss_pred             EEEecC---CCCCCCCCCCCCCEEEEEecCCCCCCCCcceeEEEEEEcCCceEEEEEEecCCCCCccccccCceeEEeEE
Q 038763           91 LFRVEG---NHRLPPTTLSPGDMVCVRVCDSRGACATSCIQGFVHNLGEDGCTISVALESRHGDPTFSKLFGKSVRIDRI  167 (690)
Q Consensus        91 ~~~~~~---~~~~~~~~~~~Gd~V~i~~~~~~~~~~~~~~~g~V~~~~~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~  167 (690)
                      +|....   ...+|+|.|++||+|+|+..++.+.   ..+.|+|++++.  ..|+|+++..... .........++   +
T Consensus        64 ~~~~~~~~~~~~l~~~~~~~Gd~v~~~~~~~~~~---~~~~g~v~~~~~--~~i~v~~~~~~~~-~~~~~~~~~~~---~  134 (646)
T 4b3f_X           64 TFEPRRYGSAAALPSNSFTSGDIVGLYDAANEGS---QLATGILTRVTQ--KSVTVAFDESHDF-QLSLDRENSYR---L  134 (646)
T ss_dssp             EEEESCC---CCCCCCCCCTTCEEEEEETTTTSC---CCEEEEEEEEET--TEEEEECC--------CCCSSCCEE---E
T ss_pred             EEEecCCCCCCCCccCCCCCCCEEEEEecCCCCC---ceEEEEEEEEeC--CEEEEEECCcccc-ccccCCCCcEE---E
Confidence            997642   4478899999999999986554432   357999999987  6899999753211 11111123354   4


Q ss_pred             eeccchhhHHHHHHHHHHHHhccccCCCCchhHHHhhhCCCccchhhhccccccchhhhhcCCCCCCCCHHHHHHHHHHh
Q 038763          168 QGLADTLTYERNCEALMLLQKNGLHKRNPSIAAVVTLFGDKEDVTWLEENDLADWSEVKLDGIMGKTFDDSQKKAIALGL  247 (690)
Q Consensus       168 ~~~~~~~t~~r~~~al~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LN~~Q~~Av~~al  247 (690)
                      ++++|++||+||..||..+....   ..+...+.+.|||..++....... ..        ......||++|++||..||
T Consensus       135 ~~~~~~~~~~r~~~al~~l~~~~---~~~~~~l~~~l~~~~~p~~~~~~~-~~--------~~~~~~LN~~Q~~AV~~al  202 (646)
T 4b3f_X          135 LKLANDVTYRRLKKALIALKKYH---SGPASSLIEVLFGRSAPSPASEIH-PL--------TFFNTCLDTSQKEAVLFAL  202 (646)
T ss_dssp             EEECCHHHHHHHHHHHHHHHTCC---SSTTHHHHHHHTTSSCCCCCCCCC-CC--------CCSSTTCCHHHHHHHHHHH
T ss_pred             EEeccchHHHHHHHHHHHhhhcc---cCchHHHHHHHcCCCCCCCccccC-cc--------cccCCCCCHHHHHHHHHHh
Confidence            56799999999999999997653   234556788899886653221111 01        1122469999999999999


Q ss_pred             cCCCCeEEEeCCCCCChhHHHHHHHHHHHHcCCeEEEEcCChHHHHHHHHHHHhcCCceeecCCCcccCchhccccHHHH
Q 038763          248 NKKRPLLIIQGPPGTGKTGLLKEIIARAVQQGERVLVTAPTNAAVDNMVEKLSDVGLNIVRVGNPARISPAVASKSLGEI  327 (690)
Q Consensus       248 ~~~~~~~lI~GPPGTGKT~tl~~~i~~l~~~g~rVLv~a~SN~AvD~l~erL~~~~~~~vRiG~~~r~~~~~~~~~l~~~  327 (690)
                      .. .+++|||||||||||+|++++|.+++++|.+||||||||.|||+|++||...+.+++|+|+++++.+.+..++++..
T Consensus       203 ~~-~~~~lI~GPPGTGKT~ti~~~I~~l~~~~~~ILv~a~TN~AvD~i~erL~~~~~~ilRlG~~~r~~~~~~~~~l~~~  281 (646)
T 4b3f_X          203 SQ-KELAIIHGPPGTGKTTTVVEIILQAVKQGLKVLCCAPSNIAVDNLVERLALCKQRILRLGHPARLLESIQQHSLDAV  281 (646)
T ss_dssp             HC-SSEEEEECCTTSCHHHHHHHHHHHHHHTTCCEEEEESSHHHHHHHHHHHHHTTCCEEECSCCSSCCHHHHTTBHHHH
T ss_pred             cC-CCceEEECCCCCCHHHHHHHHHHHHHhCCCeEEEEcCchHHHHHHHHHHHhcCCceEEecchhhhhhhhhhhhHHHH
Confidence            75 47999999999999999999999999999999999999999999999999999999999999999999999999877


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhc------chhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCcEEEEcccccch
Q 038763          328 VKSKLASFVAEFERKKSDLRKDLRQCLK------DDSLAAGIRQLLKQLGKTLKKKEKETVKEVLSSAQVVLATNTGAAD  401 (690)
Q Consensus       328 ~~~~l~~~~~~~~~~~~~~~~~l~~~~~------~~~~~~~~~~~~~~l~~~~~~~~~~~~~~il~~a~Vv~~T~~~a~~  401 (690)
                      +...-.      .....++++.+.....      +......+...++.+.+.++..+.....+.+..++||++|+++++.
T Consensus       282 ~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~vv~~t~~~a~~  355 (646)
T 4b3f_X          282 LARSDS------AQIVADIRKDIDQVFVKNKKTQDKREKSNFRNEIKLLRKELKEREEAAMLESLTSANVVLATNTGASA  355 (646)
T ss_dssp             HTTTTC------SSTHHHHHHHHTTSSTTTTC------CCSSHHHHHHHHHHHHHHHHHHHHHHHHHCSEEEEETTTTCS
T ss_pred             HhhchH------HHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcceeeeehhhhhh
Confidence            653210      0000111111111100      0011112344556666777777777888899999999999998876


Q ss_pred             HH---HhcCCCcccc-------------------cceeeecCCCCCCCccccchhhhhcCCCccHHHHHHHhCCCccccc
Q 038763          402 PL---IRRLDTFDLV-------------------GKRCILAGDQCQLAPVILSRKALEGGIGVSLLERAATLHEGVLATK  459 (690)
Q Consensus       402 ~~---l~~~~~fD~v-------------------~~~~VLvGD~~QLpP~v~s~~a~~~gl~~SLfeRl~~~~~~~~~~~  459 (690)
                      ..   ......||+|                   ++++||||||+||||++.+..+...|++.|+|+|+.+.+++.+..+
T Consensus       356 ~~~~~~~~~~~Fd~vIIDEAsQ~~e~~~lipL~~~~~~ILVGD~~QLpP~v~~~~a~~~gl~~SlferL~~~~~~~~v~~  435 (646)
T 4b3f_X          356 DGPLKLLPESYFDVVVIDECAQALEASCWIPLLKARKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEYGARVVRT  435 (646)
T ss_dssp             SSGGGGSCTTCCSEEEETTGGGSCHHHHTTTGGGSSEEEEEECTTSCCCCCSCHHHHHTTTTCCHHHHHHHHHGGGTEEE
T ss_pred             hhHHHhhhhccCCEEEEcCccccchHHHHhhccccceEEEcCCccccCceecchhhhhccccchHHHHHHHhcCCceeee
Confidence            32   1122478987                   7899999999999999999999999999999999998887777789


Q ss_pred             cccccCCchhHHHhhhhccCCCcccCCcccccccccCCCCCCCCCCCCCCeEEEeCCCCCCCCCCCcccccccCCCCCcc
Q 038763          460 LTTQYRMNDAIASWASKEMYGGSLISSSTVASHLLVDTPFVKPTWITQCPLLLLDTRLPYGSLSLGCEEHLDLAGTGSFY  539 (690)
Q Consensus       460 L~~qYRm~~~I~~f~s~~fY~g~L~~~~~v~~~~l~~~~~~~~~~~~~~p~~~~dt~~~~~~~~~~~~e~~~~~~~~S~~  539 (690)
                      |++||||||.|++|+|+.||+|+|.+++++..+.+.+.|..........|++|+|+.+...      .+ .....+.|+.
T Consensus       436 L~~qYRmhp~I~~f~n~~fY~g~L~~~~~~~~~~~~~lp~~~~~~~~~~p~~f~d~~g~~~------~~-~~~~~~~s~~  508 (646)
T 4b3f_X          436 LTVQYRMHQAIMRWASDTMYLGQLTAHSSVARHLLRDLPGVAATEETGVPLLLVDTAGCGL------FE-LEEEDEQSKG  508 (646)
T ss_dssp             CCEESSSCHHHHHHHHHHHSTTCCEECTTTTTCCGGGSTTCCCCTTTTCSEEEEECTTSSC------CC-CC-----CCC
T ss_pred             cccccCCcHHHHhhhHHhhcCCccccCcchhhhhhccccccccccccCCceEEEecCCCcc------cc-ccccCCcccc
Confidence            9999999999999999999999999999998888888887776666778999999985311      11 1223356899


Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCcEEEEcCcHHHHHHHHHHhhcCCCCCCeEEecccCccCccccEEEEEeeecCCCCcc
Q 038763          540 NEGEAEIVVHHVFSLICAGVSPSAIAVQSPYVAQVQHLRERLDDLPEAAGVEVATIDSFQGREADAVIISMVRSNTLGAV  619 (690)
Q Consensus       540 N~~Ea~~v~~~v~~L~~~g~~~~~IgIItpY~~Qv~~l~~~L~~~~~~~~v~V~TVd~fQG~E~dvVIlS~vrsn~~~~~  619 (690)
                      |+.||++|+.+++.|++.|+++++|||||||++|+.+|++.|...  ..+|+|+|||+|||+|+||||+|+||||..+.+
T Consensus       509 N~~EA~~V~~~v~~L~~~gv~~~dIgVItpYraQ~~~l~~~l~~~--~~~i~v~TVd~fQG~E~dvII~S~vrsn~~~~i  586 (646)
T 4b3f_X          509 NPGEVRLVSLHIQALVDAGVPARDIAVVSPYNLQVDLLRQSLVHR--HPELEIKSVDGFQGREKEAVILSFVRSNRKGEV  586 (646)
T ss_dssp             CHHHHHHHHHHHHHHHHHTCCGGGEEEEESCHHHHHHHHHHHTTT--CTTCEEEEGGGGTTCCEEEEEEECCCCCTTCCC
T ss_pred             CHHHHHHHHHHHHHHHhcCCCcCcEEEECCCHHHHHHHHHHHHHh--CCCCEECChhhcccccCCEEEEEeccCCCCCCc
Confidence            999999999999999999999999999999999999999999763  357999999999999999999999999999999


Q ss_pred             cccCCCCceeeeeccccccEEEEecCcccccChHHHHHHHHHHHcCcEEec
Q 038763          620 GFLGDSRRMNVAITRACKHVAVVCDSSTICHNTFLARLLRHIRYFGRVKHA  670 (690)
Q Consensus       620 gfl~d~rRlNVAlTRAk~~LiivG~~~tl~~~~~~~~l~~~~~~~~~~~~~  670 (690)
                      |||.|+||||||+||||++||||||..+|+++++|++|++|++++|+++.+
T Consensus       587 GFl~~~rRlNVAlTRAk~~liivGn~~~l~~~~~~~~li~~~~~~g~~~~~  637 (646)
T 4b3f_X          587 GFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTA  637 (646)
T ss_dssp             CSTTCHHHHHHHHHTEEEEEEEEECHHHHTTSHHHHHHHHHHHHSSEEEEG
T ss_pred             cccCCcCcEEeEhhhhhCeEEEEEchHHhcCCHHHHHHHHHHHHCCCEeeH
Confidence            999999999999999999999999999999999999999999999999875



>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 690
d1uaaa1306 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri 8e-09
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 4e-08
d1w36d1359 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha c 5e-08
g1qhh.1 623 c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac 9e-08
d1pjra1318 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillu 8e-07
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 7e-04
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 0.002
d1odfa_286 c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker' 0.003
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 0.004
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DEXX box DNA helicase
species: Escherichia coli, RepD [TaxId: 562]
 Score = 55.1 bits (131), Expect = 8e-09
 Identities = 15/70 (21%), Positives = 29/70 (41%), Gaps = 8/70 (11%)

Query: 236 DDSQKKAIALGLNKKRPLLIIQGPPGTGKTGLLKEIIARAVQQG----ERVLVTAPTNAA 291
           +  Q++A+        P L++    G+GKT ++   IA  ++        +     TN A
Sbjct: 3   NPGQQQAVE---FVTGPCLVL-AGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKA 58

Query: 292 VDNMVEKLSD 301
              M E++  
Sbjct: 59  AREMKERVGQ 68


>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Length = 359 Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 318 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 286 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query690
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 99.9
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 99.8
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 99.71
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 99.67
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 99.16
d1pjra2 333 DEXX box DNA helicase {Bacillus stearothermophilus 98.54
d1w36b2 395 Exodeoxyribonuclease V beta chain (RecB), N-termin 98.52
d1uaaa2333 DEXX box DNA helicase {Escherichia coli, RepD [Tax 98.43
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.15
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.1
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.04
d1w36d2246 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.03
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.94
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.81
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.7
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.67
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.62
d2qy9a2211 GTPase domain of the signal recognition particle r 97.61
d1okkd2207 GTPase domain of the signal recognition particle r 97.57
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.56
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.55
d1vmaa2213 GTPase domain of the signal recognition particle r 97.53
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.53
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.53
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.46
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 97.41
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 97.34
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.19
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 97.18
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 97.14
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.12
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.11
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.08
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 97.06
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.05
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.05
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 97.03
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.03
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.02
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.0
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.96
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.89
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.87
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.83
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.82
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.82
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 96.71
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 96.67
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.65
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.63
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.59
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.58
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.55
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.5
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.48
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.4
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.32
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.31
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.26
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.23
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.2
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.07
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.01
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.01
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.96
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.96
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.95
d1w36c2470 Exodeoxyribonuclease V gamma chain (RecC), N-termi 95.93
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 95.92
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.9
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.88
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.86
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.86
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.82
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.81
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 95.8
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.71
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 95.71
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.69
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.67
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.64
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.63
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.63
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.6
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.58
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.52
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.51
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 95.48
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.45
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.36
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.27
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.27
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.27
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.27
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.27
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.26
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.24
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.18
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.16
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.16
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.16
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.13
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.1
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.1
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.92
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.91
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.9
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.86
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.85
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 94.84
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.82
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.81
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.81
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.79
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.75
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 94.68
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 94.52
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 94.49
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.46
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.41
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 94.4
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 94.32
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.26
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.97
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.95
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.57
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 93.5
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 93.35
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.34
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.33
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.09
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 93.03
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.0
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 92.84
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.83
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 92.44
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.23
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.01
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.79
d1tuea_205 Replication protein E1 helicase domain {Human papi 91.37
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 91.35
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 91.27
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.26
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 91.09
d1xpua3289 Transcription termination factor Rho, ATPase domai 90.64
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 90.61
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 90.44
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.19
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.07
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 89.64
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.39
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.19
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 89.11
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.07
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 89.02
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 88.6
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 88.08
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 87.84
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.52
d1nrjb_209 Signal recognition particle receptor beta-subunit 87.18
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 86.9
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.76
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.58
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 85.96
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 85.53
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 85.53
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.04
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 84.87
d2fh5b1207 Signal recognition particle receptor beta-subunit 84.42
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 83.66
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 83.57
d2awna2232 Maltose transport protein MalK, N-terminal domain 83.49
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 83.35
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 83.24
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 83.05
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 83.02
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 83.02
d1nz9a_58 N-utilization substance G protein NusG, C-terminal 82.76
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 82.64
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 82.48
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 82.45
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 82.31
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 82.2
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 82.14
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 82.02
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 81.84
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 81.76
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 81.73
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 81.68
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 81.67
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 81.66
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 81.58
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 81.42
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 81.13
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 81.09
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 81.03
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 80.88
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 80.81
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 80.81
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 80.65
d1nppa258 N-utilization substance G protein NusG, C-terminal 80.51
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 80.48
d1g2912240 Maltose transport protein MalK, N-terminal domain 80.29
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 80.22
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 80.19
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 80.01
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure