Citrus Sinensis ID: 038808

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----

MLQLRESDNEVSEANSDASEESIIKSETDEPVTTTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITKDHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFIQECPKLVSTPGSFPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIEDG

ccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEccccccccccEEEEEcccccEEEcccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEccccccccccccccccccccccccccccc

ccEEEcccccccccccccHHHHHHHccccccccccccccHHEEEEEccccccccccccccccccccccEcEcccccccccEEEEcccccccEccccccccccccccEEEEccHHHHHcccHHccccccHcEEEEccccccccccccccccccEEEEcccHHcccHHHccccccccHHHHEEcccc

mlqlresdnevseansdaseesiiksetdepvtttntyplldhLFLDRSCDSLkmfitrpipkspnldsvsitkDHMSLAILdikqcpkivsfperglplatpnlklFVILDWKILEVIPNLRHSLSFLTELFIqecpklvstpgsfpetlRKLSIVschkfrprrdwrLHKLENLRSLINIEDG

mlqlresdnevseansdaseesiiksetdepvtttnTYPLLDHLFLDRSCDSLKMFitrpipkspnldsvsiTKDHMSLAILDIKQCPKIVSFperglplatpnlKLFVILDWKILEVIPNLRHSLSFLTELFIQECPKLVSTPGSFPETLRKLsivschkfrprrdwrlhklenlrsliniedg

MLQLRESDNEVSEANSDASEESIIKSETDEPVTTTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITKDHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFIQECPKLVSTPGSFPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIEDG

*********************************TTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITKDHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFIQECPKLVSTPGSFPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLI*****

MLQLRESDNEVSEANSDA****************TNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITKDHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFIQECPKLVSTPGSFPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIEDG

**********************IIKSETDEPVTTTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITKDHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFIQECPKLVSTPGSFPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIEDG

*LQ**ESDNEVSEANSDASEESIIKSETDEPVTTTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITKDHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFIQECPKLVSTPGSFPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIE**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLQLRESDNEVSEANSDASEESIIKSETDEPVTTTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITKDHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFIQECPKLVSTPGSFPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIEDG

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		185	2.2.26 [Sep-21-2011]
Q9LRR5		1424	Putative disease resistan	yes	no	0.810	0.105	0.360	6e-19

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function desciption

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 90/172 (52%), Gaps = 22/172 (12%)

Query: 30   EPVTTTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSI---------------TK 74
            E +  T +Y  L++LF+  SC +L  F   P+   P L S+SI                 
Sbjct: 1156 ESLQPTRSYSQLEYLFIGSSCSNLVNF---PLSLFPKLRSLSIRDCESFKTFSIHAGLGD 1212

Query: 75   DHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFI 134
            D ++L  L+I+ CP + +FP+ GLP  TP L   ++ + K L+ +P     L+ L  LFI
Sbjct: 1213 DRIALESLEIRDCPNLETFPQGGLP--TPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFI 1270

Query: 135  QECPKLVSTPGS-FPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIEDG 185
             +CP++ + PG  FP  LR L I  C K  PR +W L  LENLR+L  I+ G
Sbjct: 1271 IKCPEIETIPGGGFPSNLRTLCISLCDKLTPRIEWGLRDLENLRNL-EIDGG 1321

Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		185
297834328		1429	hypothetical protein ARALYDRAFT_478870 [	0.810	0.104	0.372	2e-18
15231860		1424	LRR and NB-ARC domain-containing disease	0.810	0.105	0.360	3e-17
357461235		494	TIR-NBS-LRR type disease resistance prot	0.762	0.285	0.368	9e-16
225465962		1290	PREDICTED: putative disease resistance R	0.789	0.113	0.384	3e-15
147844597		1289	hypothetical protein VITISV_035224 [Viti	0.783	0.112	0.380	4e-15
359495054		1347	PREDICTED: putative disease resistance R	0.810	0.111	0.378	5e-14
357461299		481	NBS-type resistance protein RGC2 [Medica	0.762	0.293	0.356	1e-13
357461309		618	NBS-type resistance protein RGC2 [Medica	0.762	0.228	0.356	1e-13
357461303		424	NBS-type resistance protein RGC2 [Medica	0.762	0.332	0.356	1e-13
225449961		1318	PREDICTED: putative disease resistance p	0.767	0.107	0.368	1e-13

>gi\|297834328\|ref\|XP_002885046.1\| hypothetical protein ARALYDRAFT_478870 [Arabidopsis lyrata subsp. lyrata] gi\|297330886\|gb\|EFH61305.1\| hypothetical protein ARALYDRAFT_478870 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 90/172 (52%), Gaps = 22/172 (12%)

Query: 30   EPVTTTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSI---------------TK 74
            E +  T +Y  L++LF+  SC +L  F   P+   P L S+SI                 
Sbjct: 1161 ESLQPTRSYSQLEYLFIGSSCSNLVNF---PLSLFPKLKSLSIRDCESFKTFSIHAGLGD 1217

Query: 75   DHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFI 134
            D ++L  L+I+ CP +V+FP+ GLP  TP L   ++ + K L  +P     L+ L  LFI
Sbjct: 1218 DRIALESLEIRDCPNLVTFPQGGLP--TPKLSSMLLSNCKKLRALPEKLFGLTSLLSLFI 1275

Query: 135  QECPKLVSTPGS-FPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIEDG 185
             +CP++ + PG  FP  LR L I  C K  PR +W L  LENLR+L  IE G
Sbjct: 1276 VKCPEIETIPGGGFPSNLRTLCISICDKLTPRIEWGLRDLENLRNL-EIEGG 1326

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|15231860|ref|NP_188064.1| LRR and NB-ARC domain-containing disease resistance protein [Arabidopsis thaliana] gi|46396003|sp|Q9LRR5.1|DRL21_ARATH RecName: Full=Putative disease resistance protein At3g14460 gi|11994216|dbj|BAB01338.1| disease resistance comples protein [Arabidopsis thaliana] gi|332642008|gb|AEE75529.1| LRR and NB-ARC domain-containing disease resistance protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|357461235\|ref\|XP_003600899.1\| TIR-NBS-LRR type disease resistance protein [Medicago truncatula] gi\|355489947\|gb\|AES71150.1\| TIR-NBS-LRR type disease resistance protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|225465962\|ref\|XP_002269685.1\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147844597\|emb\|CAN80064.1\| hypothetical protein VITISV_035224 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359495054\|ref\|XP_002267622.2\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357461299\|ref\|XP_003600931.1\| NBS-type resistance protein RGC2 [Medicago truncatula] gi\|355489979\|gb\|AES71182.1\| NBS-type resistance protein RGC2 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357461309\|ref\|XP_003600936.1\| NBS-type resistance protein RGC2 [Medicago truncatula] gi\|355489984\|gb\|AES71187.1\| NBS-type resistance protein RGC2 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357461303\|ref\|XP_003600933.1\| NBS-type resistance protein RGC2 [Medicago truncatula] gi\|355489981\|gb\|AES71184.1\| NBS-type resistance protein RGC2 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|225449961\|ref\|XP_002271133.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		185
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.810	0.105	0.360	1.9e-18

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 237 (88.5 bits), Expect = 1.9e-18, P = 1.9e-18
 Identities = 62/172 (36%), Positives = 90/172 (52%)

Query:    30 EPVTTTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITK--------------- 74
             E +  T +Y  L++LF+  SC +L  F   P+   P L S+SI                 
Sbjct:  1156 ESLQPTRSYSQLEYLFIGSSCSNLVNF---PLSLFPKLRSLSIRDCESFKTFSIHAGLGD 1212

Query:    75 DHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFI 134
             D ++L  L+I+ CP + +FP+ GLP  TP L   ++ + K L+ +P     L+ L  LFI
Sbjct:  1213 DRIALESLEIRDCPNLETFPQGGLP--TPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFI 1270

Query:   135 QECPKLVSTPGS-FPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIEDG 185
              +CP++ + PG  FP  LR L I  C K  PR +W L  LENLR+L  I+ G
Sbjct:  1271 IKCPEIETIPGGGFPSNLRTLCISLCDKLTPRIEWGLRDLENLRNL-EIDGG 1321


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.319   0.136   0.400    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      185       185   0.00080  110 3  11 22  0.44    32
                                                     31  0.41    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  582 (62 KB)
  Total size of DFA:  153 KB (2091 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  20.03u 0.11s 20.14t   Elapsed:  00:00:01
  Total cpu time:  20.03u 0.11s 20.14t   Elapsed:  00:00:01
  Start:  Mon May 20 23:35:58 2013   End:  Mon May 20 23:35:59 2013

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh2_kg.3__1571__AT3G14460.1	annotation not avaliable (1429 aa)
		(Arabidopsis lyrata)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		185
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.36
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.34
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.25
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.18
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.96
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.95
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.8
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.76
PRK15386		426	type III secretion protein GogB; Provisional	98.72
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.64
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.63
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.62
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.59
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.54
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.53
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.52
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.42
PRK15386		426	type III secretion protein GogB; Provisional	98.42
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.35
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.32
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.28
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.18
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.11
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.06
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.02
KOG4237		498	consensus Extracellular matrix protein slit, conta	97.99
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.91
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	97.86
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.83
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	97.82
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	97.72
PLN03150		623	hypothetical protein; Provisional	97.7
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	97.69
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.59
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.55
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.51
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.44
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	97.37
PLN03150		623	hypothetical protein; Provisional	97.34
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.32
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.31
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.25
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.2
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.18
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	97.1
KOG4341		483	consensus F-box protein containing LRR [General fu	97.01
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.83
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	96.6
KOG4341		483	consensus F-box protein containing LRR [General fu	96.58
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.45
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.96
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	95.78
KOG3864		221	consensus Uncharacterized conserved protein [Funct	95.47
KOG3864		221	consensus Uncharacterized conserved protein [Funct	95.4
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.3
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.26
KOG2982		418	consensus Uncharacterized conserved protein [Funct	95.23
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	95.12
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	95.11
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.97
KOG1947		482	consensus Leucine rich repeat proteins, some prote	94.96
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	94.73
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.7
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	94.39
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	94.06
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	92.81
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	91.61
smart00370		26	LRR Leucine-rich repeats, outliers.	91.61
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	90.5
KOG2123		388	consensus Uncharacterized conserved protein [Funct	90.25
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	89.75
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	89.3
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	86.75
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	83.85

>PLN03210 Resistant to P	Back alignment and domain information

Probab=99.36  E-value=4.6e-12  Score=119.41  Aligned_cols=128  Identities=25%  Similarity=0.448  Sum_probs=81.2

Q ss_pred             CCCCCCCCEEEEccccccccccCCCCCCCCCCccEEEcCC-----------CCCCCcEEeeeCCCCCcccCCCC------
Q 038808           35 TNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITK-----------DHMSLAILDIKQCPKIVSFPERG------   97 (185)
Q Consensus        35 ~~~l~~L~~L~l~~~C~~l~~lp~~~~~~l~~L~~L~l~~-----------~l~~L~~L~l~~c~~l~~l~~~~------   97 (185)
                      ...+++|+.|++.+ |..+..+|. .+.++++|+.|++++           .+++|+.|++++|..++.+|...      
T Consensus       653 ls~l~~Le~L~L~~-c~~L~~lp~-si~~L~~L~~L~L~~c~~L~~Lp~~i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L  730 (1153)
T PLN03210        653 LSMATNLETLKLSD-CSSLVELPS-SIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWL  730 (1153)
T ss_pred             cccCCcccEEEecC-CCCccccch-hhhccCCCCEEeCCCCCCcCccCCcCCCCCCCEEeCCCCCCccccccccCCcCee
Confidence            34456666666666 666666665 455566666666654           35566666666665444332100      


Q ss_pred             ---------CCC---------------------------------CCCCccEEEeecCcCCccccccCCCCCCCCEEeec
Q 038808           98 ---------LPL---------------------------------ATPNLKLFVILDWKILEVIPNLRHSLSFLTELFIQ  135 (185)
Q Consensus        98 ---------~~~---------------------------------~~~~L~~L~l~~c~~L~~lp~~~~~l~~L~~L~l~  135 (185)
                               ++.                                 ..++|+.|++++|+.+..+|..++++++|+.|++.
T Consensus       731 ~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls  810 (1153)
T PLN03210        731 DLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIE  810 (1153)
T ss_pred             ecCCCccccccccccccccccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECC
Confidence                     000                                 01356667777777777778778888888888888


Q ss_pred             CCCCCccCCC--ccccCCceeeeecCCCCCCC
Q 038808          136 ECPKLVSTPG--SFPETLRKLSIVSCHKFRPR  165 (185)
Q Consensus       136 ~c~~L~~lp~--~l~~~L~~L~l~~c~~l~~~  165 (185)
                      +|+.++.+|.  .++ +|+.|++.+|..+..+
T Consensus       811 ~C~~L~~LP~~~~L~-sL~~L~Ls~c~~L~~~  841 (1153)
T PLN03210        811 NCINLETLPTGINLE-SLESLDLSGCSRLRTF  841 (1153)
T ss_pred             CCCCcCeeCCCCCcc-ccCEEECCCCCccccc
Confidence            8888888887  344 7888888887766544

syringae 6; Provisional

>PLN03210 Resistant to P	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		185
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.6
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.6
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.59
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.58
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.57
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.56
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.56
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.55
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.54
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.53
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.5
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.5
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.49
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.49
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.48
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.47
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.46
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.44
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.44
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.44
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.43
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.43
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.42
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.41
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.41
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.4
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.39
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.38
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.38
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.38
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.37
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.37
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.37
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.37
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.36
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.35
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.35
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.35
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.35
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.34
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.34
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.33
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.33
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.33
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.33
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.32
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.32
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.31
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.31
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.3
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.3
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.3
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.3
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.29
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.29
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.28
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.28
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.28
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.28
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.28
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.27
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.27
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.27
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.27
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.26
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.26
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.25
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.25
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.24
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.24
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.23
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.22
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.22
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.22
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.21
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.21
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.21
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.21
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.21
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.2
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.2
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.2
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.2
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.2
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.19
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.18
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.16
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.16
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.16
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.16
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.14
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.13
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.13
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.12
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.12
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.11
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.1
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.06
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.05
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.04
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.04
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.02
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.01
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.99
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.97
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.97
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.96
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.95
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.94
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.93
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.92
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.92
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.92
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.91
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.83
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.81
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.79
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.76
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.75
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.75
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.73
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.71
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.7
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.6
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	98.59
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.57
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	98.54
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.54
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.5
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.47
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.37
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	98.31
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	98.3
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	98.29
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.29
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.27
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.21
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.2
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	98.19
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.1
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.02
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.99
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.78
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.63
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.46
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.46
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.39
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.29
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.21
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.04
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	96.91
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	96.13
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	95.95
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.86
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	95.65
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	93.91
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	90.21

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

Probab=99.60  E-value=3.8e-14  Score=111.84  Aligned_cols=142  Identities=20%  Similarity=0.305  Sum_probs=98.7

Q ss_pred             CCCCCCCCCEEEEccccccccccCCCCCCCCCCccEEEcCC------------CCCCCcEEeeeCCCCCcccCCCCCCCC
Q 038808           34 TTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITK------------DHMSLAILDIKQCPKIVSFPERGLPLA  101 (185)
Q Consensus        34 ~~~~l~~L~~L~l~~~C~~l~~lp~~~~~~l~~L~~L~l~~------------~l~~L~~L~l~~c~~l~~l~~~~~~~~  101 (185)
                      .+..+++|++|++++  ++++.+|.+.|..+++|++|++++            .+++|++|+++++ .+..++...+. .
T Consensus        56 ~~~~l~~L~~L~l~~--n~l~~i~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n-~l~~~~~~~~~-~  131 (270)
T 2o6q_A           56 AFHRLTKLRLLYLND--NKLQTLPAGIFKELKNLETLWVTDNKLQALPIGVFDQLVNLAELRLDRN-QLKSLPPRVFD-S  131 (270)
T ss_dssp             SSSSCTTCCEEECCS--SCCSCCCTTTTSSCTTCCEEECCSSCCCCCCTTTTTTCSSCCEEECCSS-CCCCCCTTTTT-T
T ss_pred             HhcCCCCCCEEECCC--CccCeeChhhhcCCCCCCEEECCCCcCCcCCHhHcccccCCCEEECCCC-ccCeeCHHHhC-c
Confidence            345667777777777  567777776667777777777765            4667777777764 45666554432 3


Q ss_pred             CCCccEEEeecCcCCcccccc-CCCCCCCCEEeecCCCCCccCCC-c---cccCCceeeeecCCCCCCCchhhccCCCcc
Q 038808          102 TPNLKLFVILDWKILEVIPNL-RHSLSFLTELFIQECPKLVSTPG-S---FPETLRKLSIVSCHKFRPRRDWRLHKLENL  176 (185)
Q Consensus       102 ~~~L~~L~l~~c~~L~~lp~~-~~~l~~L~~L~l~~c~~L~~lp~-~---l~~~L~~L~l~~c~~l~~~~~~~l~~l~sL  176 (185)
                      +++|++|+++++ .+..+|.. +..+++|++|++++| .+..++. .   ++ +|+.|++.++ .+..++...+..+++|
T Consensus       132 l~~L~~L~Ls~n-~l~~~~~~~~~~l~~L~~L~L~~n-~l~~~~~~~~~~l~-~L~~L~L~~N-~l~~~~~~~~~~l~~L  207 (270)
T 2o6q_A          132 LTKLTYLSLGYN-ELQSLPKGVFDKLTSLKELRLYNN-QLKRVPEGAFDKLT-ELKTLKLDNN-QLKRVPEGAFDSLEKL  207 (270)
T ss_dssp             CTTCCEEECCSS-CCCCCCTTTTTTCTTCCEEECCSS-CCSCCCTTTTTTCT-TCCEEECCSS-CCSCCCTTTTTTCTTC
T ss_pred             CcCCCEEECCCC-cCCccCHhHccCCcccceeEecCC-cCcEeChhHhccCC-CcCEEECCCC-cCCcCCHHHhccccCC
Confidence            557888888775 46666654 677888888888887 6666665 2   34 8888888775 5677776667888888


Q ss_pred             cccccccC
Q 038808          177 RSLINIED  184 (185)
Q Consensus       177 ~~L~~l~~  184 (185)
                      +.| ++++
T Consensus       208 ~~L-~l~~  214 (270)
T 2o6q_A          208 KML-QLQE  214 (270)
T ss_dssp             CEE-ECCS
T ss_pred             CEE-EecC
Confidence            888 7754

PyMOL of 2o6q

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		185
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.5
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.45
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.41
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.41
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.36
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.35
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.31
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.28
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.27
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.25
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.24
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.17
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.15
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.15
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.11
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.1
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.09
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.07
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.01
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.99
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.99
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.96
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.96
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.85
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.78
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.73
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.68
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.67
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.65
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.63
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.17
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.16
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	96.65
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	96.25
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	96.2
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.13
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	95.15
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	94.67
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	92.74
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	91.61
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	89.55

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.50  E-value=1.4e-13  Score=106.59  Aligned_cols=136  Identities=17%  Similarity=0.183  Sum_probs=86.0

Q ss_pred             CCCCEEEEccccccccccCCCCCCCCCCccEEEcCC----------CCCCCcEEeeeCCCCCcccCCCCCCCCCCCccEE
Q 038808           39 PLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITK----------DHMSLAILDIKQCPKIVSFPERGLPLATPNLKLF  108 (185)
Q Consensus        39 ~~L~~L~l~~~C~~l~~lp~~~~~~l~~L~~L~l~~----------~l~~L~~L~l~~c~~l~~l~~~~~~~~~~~L~~L  108 (185)
                      +++++|++++  ++++.+|.+.|.++++|++|++++          .+++|++|+++++ .+..++.....  +++|+.|
T Consensus        31 ~~l~~L~Ls~--N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~~~~l~~L~~L~Ls~N-~l~~~~~~~~~--l~~L~~L  105 (266)
T d1p9ag_          31 KDTTILHLSE--NLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHN-QLQSLPLLGQT--LPALTVL  105 (266)
T ss_dssp             TTCCEEECTT--SCCSEEEGGGGTTCTTCCEEECTTSCCCEEECCSCCTTCCEEECCSS-CCSSCCCCTTT--CTTCCEE
T ss_pred             cCCCEEECcC--CcCCCcCHHHhhccccccccccccccccccccccccccccccccccc-ccccccccccc--ccccccc
Confidence            5678888877  677777776777777777777776          5677777777764 34444332222  3456666


Q ss_pred             EeecCc-----------------------CCccccc-cCCCCCCCCEEeecCCCCCccCCC-c---cccCCceeeeecCC
Q 038808          109 VILDWK-----------------------ILEVIPN-LRHSLSFLTELFIQECPKLVSTPG-S---FPETLRKLSIVSCH  160 (185)
Q Consensus       109 ~l~~c~-----------------------~L~~lp~-~~~~l~~L~~L~l~~c~~L~~lp~-~---l~~~L~~L~l~~c~  160 (185)
                      +++++.                       .+..+|. .+..+++|+.+++++| +++.++. .   ++ +|++|+++++ 
T Consensus       106 ~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N-~l~~~~~~~~~~l~-~L~~L~Ls~N-  182 (266)
T d1p9ag_         106 DVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANN-NLTELPAGLLNGLE-NLDTLLLQEN-  182 (266)
T ss_dssp             ECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTS-CCSCCCTTTTTTCT-TCCEEECCSS-
T ss_pred             cccccccceeeccccccccccccccccccccceeccccccccccchhcccccc-cccccCcccccccc-ccceeecccC-
Confidence            665443                       2333333 2345677777777776 6666665 2   33 7788888764 


Q ss_pred             CCCCCchhhccCCCcccccccccC
Q 038808          161 KFRPRRDWRLHKLENLRSLINIED  184 (185)
Q Consensus       161 ~l~~~~~~~l~~l~sL~~L~~l~~  184 (185)
                      .++.+|. ++..+++|+.| +++|
T Consensus       183 ~L~~lp~-~~~~~~~L~~L-~L~~  204 (266)
T d1p9ag_         183 SLYTIPK-GFFGSHLLPFA-FLHG  204 (266)
T ss_dssp             CCCCCCT-TTTTTCCCSEE-ECCS
T ss_pred             CCcccCh-hHCCCCCCCEE-EecC
Confidence            4677766 45667777777 7654

PyMOL of d1p9ag_

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure