Citrus Sinensis ID: 038808
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 185 | ||||||
| 297834328 | 1429 | hypothetical protein ARALYDRAFT_478870 [ | 0.810 | 0.104 | 0.372 | 2e-18 | |
| 15231860 | 1424 | LRR and NB-ARC domain-containing disease | 0.810 | 0.105 | 0.360 | 3e-17 | |
| 357461235 | 494 | TIR-NBS-LRR type disease resistance prot | 0.762 | 0.285 | 0.368 | 9e-16 | |
| 225465962 | 1290 | PREDICTED: putative disease resistance R | 0.789 | 0.113 | 0.384 | 3e-15 | |
| 147844597 | 1289 | hypothetical protein VITISV_035224 [Viti | 0.783 | 0.112 | 0.380 | 4e-15 | |
| 359495054 | 1347 | PREDICTED: putative disease resistance R | 0.810 | 0.111 | 0.378 | 5e-14 | |
| 357461299 | 481 | NBS-type resistance protein RGC2 [Medica | 0.762 | 0.293 | 0.356 | 1e-13 | |
| 357461309 | 618 | NBS-type resistance protein RGC2 [Medica | 0.762 | 0.228 | 0.356 | 1e-13 | |
| 357461303 | 424 | NBS-type resistance protein RGC2 [Medica | 0.762 | 0.332 | 0.356 | 1e-13 | |
| 225449961 | 1318 | PREDICTED: putative disease resistance p | 0.767 | 0.107 | 0.368 | 1e-13 |
| >gi|297834328|ref|XP_002885046.1| hypothetical protein ARALYDRAFT_478870 [Arabidopsis lyrata subsp. lyrata] gi|297330886|gb|EFH61305.1| hypothetical protein ARALYDRAFT_478870 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 97.8 bits (242), Expect = 2e-18, Method: Compositional matrix adjust.
Identities = 64/172 (37%), Positives = 90/172 (52%), Gaps = 22/172 (12%)
Query: 30 EPVTTTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSI---------------TK 74
E + T +Y L++LF+ SC +L F P+ P L S+SI
Sbjct: 1161 ESLQPTRSYSQLEYLFIGSSCSNLVNF---PLSLFPKLKSLSIRDCESFKTFSIHAGLGD 1217
Query: 75 DHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFI 134
D ++L L+I+ CP +V+FP+ GLP TP L ++ + K L +P L+ L LFI
Sbjct: 1218 DRIALESLEIRDCPNLVTFPQGGLP--TPKLSSMLLSNCKKLRALPEKLFGLTSLLSLFI 1275
Query: 135 QECPKLVSTPGS-FPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIEDG 185
+CP++ + PG FP LR L I C K PR +W L LENLR+L IE G
Sbjct: 1276 VKCPEIETIPGGGFPSNLRTLCISICDKLTPRIEWGLRDLENLRNL-EIEGG 1326
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|15231860|ref|NP_188064.1| LRR and NB-ARC domain-containing disease resistance protein [Arabidopsis thaliana] gi|46396003|sp|Q9LRR5.1|DRL21_ARATH RecName: Full=Putative disease resistance protein At3g14460 gi|11994216|dbj|BAB01338.1| disease resistance comples protein [Arabidopsis thaliana] gi|332642008|gb|AEE75529.1| LRR and NB-ARC domain-containing disease resistance protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357461235|ref|XP_003600899.1| TIR-NBS-LRR type disease resistance protein [Medicago truncatula] gi|355489947|gb|AES71150.1| TIR-NBS-LRR type disease resistance protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225465962|ref|XP_002269685.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147844597|emb|CAN80064.1| hypothetical protein VITISV_035224 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359495054|ref|XP_002267622.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357461299|ref|XP_003600931.1| NBS-type resistance protein RGC2 [Medicago truncatula] gi|355489979|gb|AES71182.1| NBS-type resistance protein RGC2 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357461309|ref|XP_003600936.1| NBS-type resistance protein RGC2 [Medicago truncatula] gi|355489984|gb|AES71187.1| NBS-type resistance protein RGC2 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357461303|ref|XP_003600933.1| NBS-type resistance protein RGC2 [Medicago truncatula] gi|355489981|gb|AES71184.1| NBS-type resistance protein RGC2 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225449961|ref|XP_002271133.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 185 | ||||||
| TAIR|locus:2091662 | 1424 | AT3G14460 [Arabidopsis thalian | 0.810 | 0.105 | 0.360 | 1.9e-18 |
| TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 237 (88.5 bits), Expect = 1.9e-18, P = 1.9e-18
Identities = 62/172 (36%), Positives = 90/172 (52%)
Query: 30 EPVTTTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITK--------------- 74
E + T +Y L++LF+ SC +L F P+ P L S+SI
Sbjct: 1156 ESLQPTRSYSQLEYLFIGSSCSNLVNF---PLSLFPKLRSLSIRDCESFKTFSIHAGLGD 1212
Query: 75 DHMSLAILDIKQCPKIVSFPERGLPLATPNLKLFVILDWKILEVIPNLRHSLSFLTELFI 134
D ++L L+I+ CP + +FP+ GLP TP L ++ + K L+ +P L+ L LFI
Sbjct: 1213 DRIALESLEIRDCPNLETFPQGGLP--TPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFI 1270
Query: 135 QECPKLVSTPGS-FPETLRKLSIVSCHKFRPRRDWRLHKLENLRSLINIEDG 185
+CP++ + PG FP LR L I C K PR +W L LENLR+L I+ G
Sbjct: 1271 IKCPEIETIPGGGFPSNLRTLCISLCDKLTPRIEWGLRDLENLRNL-EIDGG 1321
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.319 0.136 0.400 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 185 185 0.00080 110 3 11 22 0.44 32
31 0.41 35
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 582 (62 KB)
Total size of DFA: 153 KB (2091 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 20.03u 0.11s 20.14t Elapsed: 00:00:01
Total cpu time: 20.03u 0.11s 20.14t Elapsed: 00:00:01
Start: Mon May 20 23:35:58 2013 End: Mon May 20 23:35:59 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh2_kg.3__1571__AT3G14460.1 | annotation not avaliable (1429 aa) | |||||||
(Arabidopsis lyrata) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.36 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.34 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.25 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.18 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.96 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.95 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.8 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.76 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.72 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.64 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.63 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.62 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.59 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.54 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.53 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.52 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.42 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.42 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.35 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.32 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.28 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.18 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.11 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.06 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.02 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.99 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 97.91 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.86 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.83 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.82 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.72 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.7 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.69 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.59 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.55 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 97.51 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.44 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.37 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.34 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 97.32 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.31 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 97.25 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.2 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.18 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 97.1 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.01 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.83 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.6 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 96.58 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.45 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.96 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 95.78 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 95.47 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 95.4 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.3 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.26 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.23 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 95.12 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.11 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.97 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 94.96 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.73 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.7 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 94.39 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 94.06 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 92.81 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 91.61 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 91.61 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 90.5 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 90.25 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 89.75 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 89.3 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 86.75 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 83.85 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=99.36 E-value=4.6e-12 Score=119.41 Aligned_cols=128 Identities=25% Similarity=0.448 Sum_probs=81.2
Q ss_pred CCCCCCCCEEEEccccccccccCCCCCCCCCCccEEEcCC-----------CCCCCcEEeeeCCCCCcccCCCC------
Q 038808 35 TNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITK-----------DHMSLAILDIKQCPKIVSFPERG------ 97 (185)
Q Consensus 35 ~~~l~~L~~L~l~~~C~~l~~lp~~~~~~l~~L~~L~l~~-----------~l~~L~~L~l~~c~~l~~l~~~~------ 97 (185)
...+++|+.|++.+ |..+..+|. .+.++++|+.|++++ .+++|+.|++++|..++.+|...
T Consensus 653 ls~l~~Le~L~L~~-c~~L~~lp~-si~~L~~L~~L~L~~c~~L~~Lp~~i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L 730 (1153)
T PLN03210 653 LSMATNLETLKLSD-CSSLVELPS-SIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWL 730 (1153)
T ss_pred cccCCcccEEEecC-CCCccccch-hhhccCCCCEEeCCCCCCcCccCCcCCCCCCCEEeCCCCCCccccccccCCcCee
Confidence 34456666666666 666666665 455566666666654 35566666666665444332100
Q ss_pred ---------CCC---------------------------------CCCCccEEEeecCcCCccccccCCCCCCCCEEeec
Q 038808 98 ---------LPL---------------------------------ATPNLKLFVILDWKILEVIPNLRHSLSFLTELFIQ 135 (185)
Q Consensus 98 ---------~~~---------------------------------~~~~L~~L~l~~c~~L~~lp~~~~~l~~L~~L~l~ 135 (185)
++. ..++|+.|++++|+.+..+|..++++++|+.|++.
T Consensus 731 ~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls 810 (1153)
T PLN03210 731 DLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIE 810 (1153)
T ss_pred ecCCCccccccccccccccccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECC
Confidence 000 01356667777777777778778888888888888
Q ss_pred CCCCCccCCC--ccccCCceeeeecCCCCCCC
Q 038808 136 ECPKLVSTPG--SFPETLRKLSIVSCHKFRPR 165 (185)
Q Consensus 136 ~c~~L~~lp~--~l~~~L~~L~l~~c~~l~~~ 165 (185)
+|+.++.+|. .++ +|+.|++.+|..+..+
T Consensus 811 ~C~~L~~LP~~~~L~-sL~~L~Ls~c~~L~~~ 841 (1153)
T PLN03210 811 NCINLETLPTGINLE-SLESLDLSGCSRLRTF 841 (1153)
T ss_pred CCCCcCeeCCCCCcc-ccCEEECCCCCccccc
Confidence 8888888887 344 7888888887766544
|
syringae 6; Provisional |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.6 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.6 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.59 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.58 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.57 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.56 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.56 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.55 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.54 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.53 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.5 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.5 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.49 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.49 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.48 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.47 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.46 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.44 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.44 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.44 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.43 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.43 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.42 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.41 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.41 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.4 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.39 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.38 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.38 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.38 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.37 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.37 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.37 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.37 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.36 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.35 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.35 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.35 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.35 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.34 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.34 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.33 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.33 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.33 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.33 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.32 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.32 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.31 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.31 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.3 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.3 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.3 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.3 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.29 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.29 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.28 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.28 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.28 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.28 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.28 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.27 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.27 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.27 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.27 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.26 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.26 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.25 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.25 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.24 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.24 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.23 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.22 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.22 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.22 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.21 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.21 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.21 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.21 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.21 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.2 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.2 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.2 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.2 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.2 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.19 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.18 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.16 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.16 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.16 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.16 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.14 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.13 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.13 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.13 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.12 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.12 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.12 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.1 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.09 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.06 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.05 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.04 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.04 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.02 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.01 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.99 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.97 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.97 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.96 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.95 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.94 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.93 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.92 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.92 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.92 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.91 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.83 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.81 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.79 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.76 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.75 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.75 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.73 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.71 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.7 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.6 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.59 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.57 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.54 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.54 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.5 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.47 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.37 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.31 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.3 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.29 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.29 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.27 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.21 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.2 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.19 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.1 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.02 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.99 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.78 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.63 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.46 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.46 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.39 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.29 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.21 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.91 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.13 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.95 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.86 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.65 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 93.91 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 90.21 |
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
Probab=99.60 E-value=3.8e-14 Score=111.84 Aligned_cols=142 Identities=20% Similarity=0.305 Sum_probs=98.7
Q ss_pred CCCCCCCCCEEEEccccccccccCCCCCCCCCCccEEEcCC------------CCCCCcEEeeeCCCCCcccCCCCCCCC
Q 038808 34 TTNTYPLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITK------------DHMSLAILDIKQCPKIVSFPERGLPLA 101 (185)
Q Consensus 34 ~~~~l~~L~~L~l~~~C~~l~~lp~~~~~~l~~L~~L~l~~------------~l~~L~~L~l~~c~~l~~l~~~~~~~~ 101 (185)
.+..+++|++|++++ ++++.+|.+.|..+++|++|++++ .+++|++|+++++ .+..++...+. .
T Consensus 56 ~~~~l~~L~~L~l~~--n~l~~i~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n-~l~~~~~~~~~-~ 131 (270)
T 2o6q_A 56 AFHRLTKLRLLYLND--NKLQTLPAGIFKELKNLETLWVTDNKLQALPIGVFDQLVNLAELRLDRN-QLKSLPPRVFD-S 131 (270)
T ss_dssp SSSSCTTCCEEECCS--SCCSCCCTTTTSSCTTCCEEECCSSCCCCCCTTTTTTCSSCCEEECCSS-CCCCCCTTTTT-T
T ss_pred HhcCCCCCCEEECCC--CccCeeChhhhcCCCCCCEEECCCCcCCcCCHhHcccccCCCEEECCCC-ccCeeCHHHhC-c
Confidence 345667777777777 567777776667777777777765 4667777777764 45666554432 3
Q ss_pred CCCccEEEeecCcCCcccccc-CCCCCCCCEEeecCCCCCccCCC-c---cccCCceeeeecCCCCCCCchhhccCCCcc
Q 038808 102 TPNLKLFVILDWKILEVIPNL-RHSLSFLTELFIQECPKLVSTPG-S---FPETLRKLSIVSCHKFRPRRDWRLHKLENL 176 (185)
Q Consensus 102 ~~~L~~L~l~~c~~L~~lp~~-~~~l~~L~~L~l~~c~~L~~lp~-~---l~~~L~~L~l~~c~~l~~~~~~~l~~l~sL 176 (185)
+++|++|+++++ .+..+|.. +..+++|++|++++| .+..++. . ++ +|+.|++.++ .+..++...+..+++|
T Consensus 132 l~~L~~L~Ls~n-~l~~~~~~~~~~l~~L~~L~L~~n-~l~~~~~~~~~~l~-~L~~L~L~~N-~l~~~~~~~~~~l~~L 207 (270)
T 2o6q_A 132 LTKLTYLSLGYN-ELQSLPKGVFDKLTSLKELRLYNN-QLKRVPEGAFDKLT-ELKTLKLDNN-QLKRVPEGAFDSLEKL 207 (270)
T ss_dssp CTTCCEEECCSS-CCCCCCTTTTTTCTTCCEEECCSS-CCSCCCTTTTTTCT-TCCEEECCSS-CCSCCCTTTTTTCTTC
T ss_pred CcCCCEEECCCC-cCCccCHhHccCCcccceeEecCC-cCcEeChhHhccCC-CcCEEECCCC-cCCcCCHHHhccccCC
Confidence 557888888775 46666654 677888888888887 6666665 2 34 8888888775 5677776667888888
Q ss_pred cccccccC
Q 038808 177 RSLINIED 184 (185)
Q Consensus 177 ~~L~~l~~ 184 (185)
+.| ++++
T Consensus 208 ~~L-~l~~ 214 (270)
T 2o6q_A 208 KML-QLQE 214 (270)
T ss_dssp CEE-ECCS
T ss_pred CEE-EecC
Confidence 888 7754
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.5 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.45 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.41 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.41 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.36 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.35 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.31 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.28 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.27 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.25 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.24 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.17 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.15 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.15 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.11 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.1 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.09 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.07 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.01 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.99 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.99 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.96 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.96 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.85 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.78 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.73 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.68 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.67 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.65 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.63 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.17 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.16 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.65 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.25 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.2 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.13 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 95.15 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 94.67 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 92.74 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 91.61 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 89.55 |
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Ngr ectodomain-like domain: von Willebrand factor binding domain of glycoprotein Ib alpha species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.50 E-value=1.4e-13 Score=106.59 Aligned_cols=136 Identities=17% Similarity=0.183 Sum_probs=86.0
Q ss_pred CCCCEEEEccccccccccCCCCCCCCCCccEEEcCC----------CCCCCcEEeeeCCCCCcccCCCCCCCCCCCccEE
Q 038808 39 PLLDHLFLDRSCDSLKMFITRPIPKSPNLDSVSITK----------DHMSLAILDIKQCPKIVSFPERGLPLATPNLKLF 108 (185)
Q Consensus 39 ~~L~~L~l~~~C~~l~~lp~~~~~~l~~L~~L~l~~----------~l~~L~~L~l~~c~~l~~l~~~~~~~~~~~L~~L 108 (185)
+++++|++++ ++++.+|.+.|.++++|++|++++ .+++|++|+++++ .+..++..... +++|+.|
T Consensus 31 ~~l~~L~Ls~--N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~~~~l~~L~~L~Ls~N-~l~~~~~~~~~--l~~L~~L 105 (266)
T d1p9ag_ 31 KDTTILHLSE--NLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHN-QLQSLPLLGQT--LPALTVL 105 (266)
T ss_dssp TTCCEEECTT--SCCSEEEGGGGTTCTTCCEEECTTSCCCEEECCSCCTTCCEEECCSS-CCSSCCCCTTT--CTTCCEE
T ss_pred cCCCEEECcC--CcCCCcCHHHhhccccccccccccccccccccccccccccccccccc-ccccccccccc--ccccccc
Confidence 5678888877 677777776777777777777776 5677777777764 34444332222 3456666
Q ss_pred EeecCc-----------------------CCccccc-cCCCCCCCCEEeecCCCCCccCCC-c---cccCCceeeeecCC
Q 038808 109 VILDWK-----------------------ILEVIPN-LRHSLSFLTELFIQECPKLVSTPG-S---FPETLRKLSIVSCH 160 (185)
Q Consensus 109 ~l~~c~-----------------------~L~~lp~-~~~~l~~L~~L~l~~c~~L~~lp~-~---l~~~L~~L~l~~c~ 160 (185)
+++++. .+..+|. .+..+++|+.+++++| +++.++. . ++ +|++|+++++
T Consensus 106 ~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N-~l~~~~~~~~~~l~-~L~~L~Ls~N- 182 (266)
T d1p9ag_ 106 DVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANN-NLTELPAGLLNGLE-NLDTLLLQEN- 182 (266)
T ss_dssp ECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTS-CCSCCCTTTTTTCT-TCCEEECCSS-
T ss_pred cccccccceeeccccccccccccccccccccceeccccccccccchhcccccc-cccccCcccccccc-ccceeecccC-
Confidence 665443 2333333 2345677777777776 6666665 2 33 7788888764
Q ss_pred CCCCCchhhccCCCcccccccccC
Q 038808 161 KFRPRRDWRLHKLENLRSLINIED 184 (185)
Q Consensus 161 ~l~~~~~~~l~~l~sL~~L~~l~~ 184 (185)
.++.+|. ++..+++|+.| +++|
T Consensus 183 ~L~~lp~-~~~~~~~L~~L-~L~~ 204 (266)
T d1p9ag_ 183 SLYTIPK-GFFGSHLLPFA-FLHG 204 (266)
T ss_dssp CCCCCCT-TTTTTCCCSEE-ECCS
T ss_pred CCcccCh-hHCCCCCCCEE-EecC
Confidence 4677766 45667777777 7654
|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|