Citrus Sinensis ID: 038855

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMILDRENDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDPVKGMESLIVVPISKAQALQR
ccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHcccccccccccccccccccccccEEEEEEccccHHHHHHHcccccEEEEccccccccEEEcccccccHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHcccccccccccEEEEEccccccccccccEEEEEccccccccccccccccEEEEEcccHHHHHccc
cccccccHHccEEEEEccHHHHHHHHHHHHHHHHHHHHHHccHccccccccccccccccEccccccccccccccccccccccccEEEEEEccccHHHHHHHHccccEEEEccccccEEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEccccEEEccccccccccEEEEEEccHHHHccc
ealldpylsrysviivdeahertvHTDVLLGLLKKVQNarsksadghsngnnknadsdmildrendtngintlkqcqgrkfpplKLIIMSASldargfseYFGCAKAvhvqgrqfpvEILYtlypepdfldATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLvtvpifsslpseqqmkvfapaaaGFRKVILAtniaetsvtipgikyvidpgfvkarsydpvkgmeSLIVVPISKAQALQR
ealldpylsrysviivdeahertVHTDVLLGLLKKVQNARsksadghsngnnknadsdMILDRENDTNGINTlkqcqgrkfpPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATniaetsvtipgikyvidpGFVKARSYDPVKGMESLIVVPISKAQALQR
EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMILDRENDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDPVKGMESLIVVPISKAQALQR
***LDPYLSRYSVIIVDEAHERTVHTDVLLGLLKK**********************************INTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDPVKGMESLIVVPI********
*ALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMILDRENDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERL******SRKLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDPVKGMESLIVVPISKAQALQ*
EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQ*************NNKNADSDMILDRENDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDPVKGMESLIVVPISKAQALQR
*ALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMILDR*NDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDPVKGMESLIVVPISKA*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMILDRENDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDPVKGMESLIVVPISKAQALQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query260 2.2.26 [Sep-21-2011]
O42643 1168 Pre-mRNA-splicing factor yes no 0.842 0.187 0.507 4e-64
Q09530 1200 Probable pre-mRNA-splicin yes no 0.842 0.182 0.492 4e-63
Q54F05 1160 ATP-dependent RNA helicas no no 0.842 0.188 0.488 2e-62
Q14562 1220 ATP-dependent RNA helicas yes no 0.842 0.179 0.476 3e-62
A2A4P0 1244 ATP-dependent RNA helicas yes no 0.842 0.176 0.476 3e-62
Q03319 719 Probable ATP-dependent RN no no 0.842 0.304 0.469 1e-60
Q38953 1168 Probable pre-mRNA-splicin no no 0.842 0.187 0.484 3e-60
Q767K6 1045 Putative pre-mRNA-splicin no no 0.842 0.209 0.45 4e-59
O60231 1041 Putative pre-mRNA-splicin no no 0.842 0.210 0.446 6e-59
Q7YR39 1044 Putative pre-mRNA-splicin no no 0.842 0.209 0.446 6e-59
>sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 Back     alignment and function desciption
 Score =  244 bits (623), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 132/260 (50%), Positives = 165/260 (63%), Gaps = 41/260 (15%)

Query: 1   EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMI 60
           E L+DP LS+YSVII+DEAHERTV TDVL GLLK                         +
Sbjct: 615 ECLVDPLLSKYSVIILDEAHERTVATDVLFGLLKGT-----------------------V 651

Query: 61  LDRENDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEIL 120
           L R                  P LKLI+ SA+LDA  FS YF       + GR +PVEI+
Sbjct: 652 LKR------------------PDLKLIVTSATLDAERFSSYFYKCPIFTIPGRSYPVEIM 693

Query: 121 YTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKL 180
           YT  PE D+LDA L+T+ Q+HL E PGDILVFLTGQEEI++   ++ ER   L ++  +L
Sbjct: 694 YTKQPEADYLDAALMTVMQIHLSEGPGDILVFLTGQEEIDTSCEILYERSKMLGDSIPEL 753

Query: 181 VTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDP 240
           V +P++S+LPSE Q ++F PA  G RKV++ATNIAETS+TI GI YV+DPGFVK   +DP
Sbjct: 754 VILPVYSALPSEIQSRIFEPAPPGGRKVVIATNIAETSLTIDGIYYVVDPGFVKQSCFDP 813

Query: 241 VKGMESLIVVPISKAQALQR 260
             GM+SLIV PIS+AQA QR
Sbjct: 814 KLGMDSLIVTPISQAQARQR 833
Acts late in the splicing of pre-mRNA. Required for the splicing of introns with a branch nucleotide to 3'-splice site distance greater or equal to 15. Mediates the release of the spliced mRNA from spliceosomes.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description
>sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 Back     alignment and function description
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function description
>sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 Back     alignment and function description
>sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
359473112 713 PREDICTED: putative ATP-dependent RNA he 1.0 0.364 0.765 1e-111
356498004 705 PREDICTED: ATP-dependent RNA helicase DH 0.996 0.367 0.742 1e-106
356502628 705 PREDICTED: ATP-dependent RNA helicase DH 0.996 0.367 0.734 1e-104
255542006 690 ATP-dependent RNA helicase, putative [Ri 0.903 0.340 0.742 1e-102
42562325 717 helicase associated domain-containing pr 1.0 0.362 0.723 1e-102
9797766 726 Strong similarity to RNA helicase (HRH1) 1.0 0.358 0.723 1e-101
326533114 697 predicted protein [Hordeum vulgare subsp 0.961 0.358 0.711 1e-101
224098988 658 predicted protein [Populus trichocarpa] 0.873 0.344 0.742 1e-101
51090786 698 putative RNA helicase [Oryza sativa Japo 0.961 0.358 0.707 2e-99
115466874 386 Os06g0192500 [Oryza sativa Japonica Grou 0.961 0.647 0.711 2e-99
>gi|359473112|ref|XP_002282341.2| PREDICTED: putative ATP-dependent RNA helicase DHX33-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 199/260 (76%), Positives = 224/260 (86%)

Query: 1   EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMI 60
           EALLDP+LSRYSVIIVDEAHERT+HTDVLLGLLK VQNARS+S +   N  N  A+   +
Sbjct: 142 EALLDPFLSRYSVIIVDEAHERTIHTDVLLGLLKNVQNARSRSINKCLNIENTEANYGKL 201

Query: 61  LDRENDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEIL 120
           L REND N ++ LK+CQG KFP LKLIIMSASLDARGFSEYFG A++V++QGRQFPV+I 
Sbjct: 202 LKRENDANCVSILKRCQGVKFPSLKLIIMSASLDARGFSEYFGGARSVYIQGRQFPVDIF 261

Query: 121 YTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKL 180
           YT + EPD++DA LITIFQ+HL+E PGDILVFLTGQEEIESVERLVQERL QLPE S+KL
Sbjct: 262 YTHHAEPDYVDAALITIFQIHLEEGPGDILVFLTGQEEIESVERLVQERLRQLPEGSQKL 321

Query: 181 VTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDP 240
           +TVPIFSSLPSEQQMK F PA AGFRKVILATNIAETSVTIPGIKYVIDPG VKAR+Y+ 
Sbjct: 322 LTVPIFSSLPSEQQMKAFMPAPAGFRKVILATNIAETSVTIPGIKYVIDPGVVKARTYNA 381

Query: 241 VKGMESLIVVPISKAQALQR 260
             G+ESL +V  SKAQALQR
Sbjct: 382 HTGIESLDIVKTSKAQALQR 401

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356498004|ref|XP_003517845.1| PREDICTED: ATP-dependent RNA helicase DHX8-like [Glycine max] Back     alignment and taxonomy information
>gi|356502628|ref|XP_003520120.1| PREDICTED: ATP-dependent RNA helicase DHX8 [Glycine max] Back     alignment and taxonomy information
>gi|255542006|ref|XP_002512067.1| ATP-dependent RNA helicase, putative [Ricinus communis] gi|223549247|gb|EEF50736.1| ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|42562325|ref|NP_173961.3| helicase associated domain-containing protein [Arabidopsis thaliana] gi|332192562|gb|AEE30683.1| helicase associated domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9797766|gb|AAF98584.1|AC013427_27 Strong similarity to RNA helicase (HRH1) from Homo sapiens gb|D50487 and contains a Helicases conserved C-terminal PF|00271 domain. EST gb|AV567077 comes from this gene [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|326533114|dbj|BAJ93529.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|224098988|ref|XP_002311345.1| predicted protein [Populus trichocarpa] gi|222851165|gb|EEE88712.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|51090786|dbj|BAD35264.1| putative RNA helicase [Oryza sativa Japonica Group] gi|51091123|dbj|BAD35820.1| putative RNA helicase [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115466874|ref|NP_001057036.1| Os06g0192500 [Oryza sativa Japonica Group] gi|51090787|dbj|BAD35265.1| RNA helicase-like [Oryza sativa Japonica Group] gi|51091124|dbj|BAD35821.1| RNA helicase-like [Oryza sativa Japonica Group] gi|113595076|dbj|BAF18950.1| Os06g0192500 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
TAIR|locus:2197965 717 AT1G26370 [Arabidopsis thalian 0.992 0.359 0.729 7e-93
DICTYBASE|DDB_G0270110 730 dhx33 "DEAD/DEAH box helicase" 0.723 0.257 0.534 1.2e-61
POMBASE|SPAC10F6.02c 1168 prp22 "ATP-dependent RNA helic 0.696 0.154 0.574 3.3e-60
ASPGD|ASPL0000070923 1241 AN4721 [Emericella nidulans (t 0.696 0.145 0.568 7.1e-60
WB|WBGene00003393 1200 mog-5 [Caenorhabditis elegans 0.765 0.165 0.532 1.3e-59
UNIPROTKB|Q09530 1200 mog-5 "Probable pre-mRNA-splic 0.765 0.165 0.532 1.3e-59
POMBASE|SPAC2G11.11c 719 prh1 "ATP-dependent RNA helica 0.7 0.253 0.554 6.9e-59
UNIPROTKB|F1P306 1168 LOC100858239 "Uncharacterized 0.7 0.155 0.549 1.1e-58
UNIPROTKB|F5H658 1181 DHX8 "ATP-dependent RNA helica 0.7 0.154 0.549 1.2e-58
RGD|1310723 1210 Dhx8 "DEAH (Asp-Glu-Ala-His) b 0.7 0.150 0.549 1.3e-58
TAIR|locus:2197965 AT1G26370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 925 (330.7 bits), Expect = 7.0e-93, P = 7.0e-93
 Identities = 191/262 (72%), Positives = 214/262 (81%)

Query:     1 EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSN-GNNKNADSDM 59
             EALLDP+LSRYSVIIVDEAH+R+VHTDVLL LLKK+Q  RS+     +  GN  +     
Sbjct:   146 EALLDPHLSRYSVIIVDEAHDRSVHTDVLLALLKKIQRTRSQPVSEKTEFGNVASQVQTT 205

Query:    60 ILDREN-DTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVE 118
               D      NG+  LK  QGRK  PLKLIIMSASLDAR FSEYFG AKAVHVQGRQFPV+
Sbjct:   206 TRDANGPQQNGV--LKGYQGRKLSPLKLIIMSASLDARVFSEYFGGAKAVHVQGRQFPVD 263

Query:   119 ILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASR 178
             ILYT++PE D++DATL+TIFQ+H +E PGDILVFLTGQ+EIESVERLVQERL  +PE  R
Sbjct:   264 ILYTVHPESDYVDATLVTIFQIHFEEKPGDILVFLTGQDEIESVERLVQERLQNIPEDKR 323

Query:   179 KLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSY 238
             KL+ + IFS+LPSEQQMKVFAPA  GFRKVILATNIAETS+TIPGI+YVIDPGFVKARSY
Sbjct:   324 KLLPLAIFSALPSEQQMKVFAPAPTGFRKVILATNIAETSITIPGIRYVIDPGFVKARSY 383

Query:   239 DPVKGMESLIVVPISKAQALQR 260
             DP KGMESL VVP SKAQ LQR
Sbjct:   384 DPSKGMESLDVVPASKAQTLQR 405
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003724 "RNA helicase activity" evidence=ISS
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
DICTYBASE|DDB_G0270110 dhx33 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC10F6.02c prp22 "ATP-dependent RNA helicase Prp22" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000070923 AN4721 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
WB|WBGene00003393 mog-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q09530 mog-5 "Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPAC2G11.11c prh1 "ATP-dependent RNA helicase Prh1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1P306 LOC100858239 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F5H658 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1310723 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 3e-86
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 2e-44
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 2e-41
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 7e-41
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 3e-40
smart0049082 smart00490, HELICc, helicase superfamily c-termina 4e-09
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-08
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 5e-08
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  273 bits (700), Expect = 3e-86
 Identities = 112/261 (42%), Positives = 143/261 (54%), Gaps = 46/261 (17%)

Query: 1   EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMI 60
           E   DP LS YSV+I+DEAHER+++TD+LLGLLK +   R                    
Sbjct: 153 EIQNDPLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARRR------------------- 193

Query: 61  LDRENDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEIL 120
                                  LKLIIMSA+LDA  FS YFG A  + ++GR +PVEI 
Sbjct: 194 ---------------------DDLKLIIMSATLDAERFSAYFGNAPVIEIEGRTYPVEIR 232

Query: 121 YTLYPEPD-FLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRK 179
           Y    E D  L   ++    +HL E  G ILVFL GQ EIE     +++  L        
Sbjct: 233 YLPEAEADYILLDAIVAAVDIHLREGSGSILVFLPGQREIERTAEWLEKAEL-----GDD 287

Query: 180 LVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYD 239
           L  +P++ +L +E+Q++VF PA  G RKV+LATNIAETS+TIPGI+YVID G  K + YD
Sbjct: 288 LEILPLYGALSAEEQVRVFEPAPGGKRKVVLATNIAETSLTIPGIRYVIDSGLAKEKRYD 347

Query: 240 PVKGMESLIVVPISKAQALQR 260
           P  G+  L   PISKA A QR
Sbjct: 348 PRTGLTRLETEPISKASADQR 368

Length = 845
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 260
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
PHA02653 675 RNA helicase NPH-II; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 99.95
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.95
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 99.93
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.92
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.92
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.92
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.91
PTZ00110545 helicase; Provisional 99.9
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.9
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.9
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.9
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 99.89
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.89
PTZ00424401 helicase 45; Provisional 99.88
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.88
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.87
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.87
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 99.86
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.86
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.86
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.85
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.85
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.84
KOG0343 758 consensus RNA Helicase [RNA processing and modific 99.84
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 99.84
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.83
KOG0347 731 consensus RNA helicase [RNA processing and modific 99.82
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.81
PRK13767 876 ATP-dependent helicase; Provisional 99.81
PRK01172 674 ski2-like helicase; Provisional 99.81
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.81
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.8
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 99.8
PRK02362 737 ski2-like helicase; Provisional 99.79
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 99.79
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.78
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.78
PRK10689 1147 transcription-repair coupling factor; Provisional 99.77
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.77
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.77
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.77
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.75
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.75
KOG0327397 consensus Translation initiation factor 4F, helica 99.72
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.72
PRK00254 720 ski2-like helicase; Provisional 99.72
PRK09401 1176 reverse gyrase; Reviewed 99.71
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.69
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.69
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.68
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.68
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.68
KOG4284 980 consensus DEAD box protein [Transcription] 99.67
KOG0346 569 consensus RNA helicase [RNA processing and modific 99.65
PRK14701 1638 reverse gyrase; Provisional 99.63
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 99.6
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.59
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.54
COG1202 830 Superfamily II helicase, archaea-specific [General 99.53
PHA02558501 uvsW UvsW helicase; Provisional 99.51
PRK09694 878 helicase Cas3; Provisional 99.5
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.41
PRK13766 773 Hef nuclease; Provisional 99.4
KOG0349 725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.37
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.36
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.35
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.35
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.33
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.32
COG1204 766 Superfamily II helicase [General function predicti 99.32
COG1205 851 Distinct helicase family with a unique C-terminal 99.3
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.24
PRK05580 679 primosome assembly protein PriA; Validated 99.22
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.22
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.2
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.2
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.18
PRK04914 956 ATP-dependent helicase HepA; Validated 99.14
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.13
PRK05298652 excinuclease ABC subunit B; Provisional 99.12
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.12
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.06
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.03
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 98.99
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.96
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 98.95
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.95
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 98.94
smart0049082 HELICc helicase superfamily c-terminal domain. 98.9
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 98.9
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.87
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.82
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.81
KOG0353 695 consensus ATP-dependent DNA helicase [General func 98.8
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 98.72
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.72
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 98.62
KOG0354 746 consensus DEAD-box like helicase [General function 98.6
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.33
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.3
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 98.27
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 98.18
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 98.04
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 98.0
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.0
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.93
COG4096 875 HsdR Type I site-specific restriction-modification 97.87
KOG1123 776 consensus RNA polymerase II transcription initiati 97.85
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.82
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.63
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.47
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 97.45
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.41
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 97.4
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.38
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.34
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 97.22
COG1198 730 PriA Primosomal protein N' (replication factor Y) 97.21
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 97.16
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.07
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.02
CHL00122 870 secA preprotein translocase subunit SecA; Validate 97.0
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 96.85
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 96.83
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 96.76
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 96.74
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 96.66
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 96.36
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.33
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.8
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 95.45
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 95.38
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.37
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 95.29
smart00487201 DEXDc DEAD-like helicases superfamily. 95.11
PRK05580 679 primosome assembly protein PriA; Validated 95.08
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 94.93
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 94.83
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 94.72
TIGR00595 505 priA primosomal protein N'. All proteins in this f 94.64
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 94.42
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 93.83
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 93.11
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 92.78
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 92.66
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 92.57
PRK14873 665 primosome assembly protein PriA; Provisional 92.51
PRK10689 1147 transcription-repair coupling factor; Provisional 92.5
PRK14701 1638 reverse gyrase; Provisional 92.49
KOG0347 731 consensus RNA helicase [RNA processing and modific 92.42
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 91.73
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 91.38
KOG0354 746 consensus DEAD-box like helicase [General function 91.11
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 90.52
KOG0387 923 consensus Transcription-coupled repair protein CSB 90.04
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 90.02
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 89.18
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 88.88
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 88.08
PRK09401 1176 reverse gyrase; Reviewed 87.62
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 85.98
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 85.69
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 85.63
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 85.59
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 85.33
PTZ00110 545 helicase; Provisional 84.81
COG1198 730 PriA Primosomal protein N' (replication factor Y) 83.91
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 83.49
PRK13766 773 Hef nuclease; Provisional 83.42
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 82.94
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 82.92
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 81.18
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-55  Score=435.56  Aligned_cols=218  Identities=62%  Similarity=0.980  Sum_probs=211.6

Q ss_pred             CCccCCCCCcccEEEEecCCcCCcchhHHHHHHHHHHhhccCCcCCCCCCCCCCCCccccccccCCccCccccccccCCC
Q 038855            1 EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMILDRENDTNGINTLKQCQGRK   80 (260)
Q Consensus         1 e~~~d~~L~~~~~vIlDEaher~~~~d~ll~~lk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (260)
                      |++.||.|++|++|||||||||++++|+|+++||++...|+                                       
T Consensus       154 E~l~Dp~LskYsvIIlDEAHERsl~TDiLlGlLKki~~~R~---------------------------------------  194 (674)
T KOG0922|consen  154 EILKDPLLSKYSVIILDEAHERSLHTDILLGLLKKILKKRP---------------------------------------  194 (674)
T ss_pred             HHhcCCccccccEEEEechhhhhhHHHHHHHHHHHHHhcCC---------------------------------------
Confidence            67899999999999999999999999999999999999888                                       


Q ss_pred             CCCceEEEEeccCCHHHHHhhhCCCcEEEecCceeeeeEEEeeCCCcchHHHHHHHHHHHHhhcCCCCEEEEeCCHHHHH
Q 038855           81 FPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIE  160 (260)
Q Consensus        81 ~~~~qlil~SATl~~~~~~~~~~~~~~v~v~~~~~~v~~~~~~~~~~~~~~~~~~~l~~i~~~~~~g~iLVFl~~~~~ve  160 (260)
                        ++|+|+||||+|++.|++||++++++.++|+.|||+++|+..+..+|+++.+.+++++|..+++|+|||||+|+++|+
T Consensus       195 --~LklIimSATlda~kfS~yF~~a~i~~i~GR~fPVei~y~~~p~~dYv~a~~~tv~~Ih~~E~~GDILvFLtGqeEIe  272 (674)
T KOG0922|consen  195 --DLKLIIMSATLDAEKFSEYFNNAPILTIPGRTFPVEILYLKEPTADYVDAALITVIQIHLTEPPGDILVFLTGQEEIE  272 (674)
T ss_pred             --CceEEEEeeeecHHHHHHHhcCCceEeecCCCCceeEEeccCCchhhHHHHHHHHHHHHccCCCCCEEEEeCCHHHHH
Confidence              899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcCccCCCCeEEEEecCCCCHHHHHHHhcccCCCCeEEEEecCcccccCCCCCceEEEeCCCccceeeec
Q 038855          161 SVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARSYDP  240 (260)
Q Consensus       161 ~v~~~L~~~l~~~~~~~~~~~~~~lh~~l~~~~r~~v~~~~~~g~~kVlvaTdiae~gidIp~V~~VId~g~~~~~~yd~  240 (260)
                      .+++.|.++.+.++.+... .+.|+||+|+.++|+++|.+.++|.|||++||||||++||||||.||||+|++|.+.|||
T Consensus       273 ~~~~~l~e~~~~~~~~~~~-~~lply~aL~~e~Q~rvF~p~p~g~RKvIlsTNIAETSlTI~GI~YVVDsG~vK~~~y~p  351 (674)
T KOG0922|consen  273 AACELLRERAKSLPEDCPE-LILPLYGALPSEEQSRVFDPAPPGKRKVILSTNIAETSLTIDGIRYVVDSGFVKQKKYNP  351 (674)
T ss_pred             HHHHHHHHHhhhccccCcc-eeeeecccCCHHHhhccccCCCCCcceEEEEcceeeeeEEecceEEEEcCCceEEEeecc
Confidence            9999999998877765545 789999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCceeeeEEeeehhhhhcC
Q 038855          241 VKGMESLIVVPISKAQALQR  260 (260)
Q Consensus       241 ~~g~~~l~~~~isk~~~~qR  260 (260)
                      .+|+++|.++||||++|.||
T Consensus       352 ~~g~~~L~v~~ISkasA~QR  371 (674)
T KOG0922|consen  352 RTGLDSLIVVPISKASANQR  371 (674)
T ss_pred             ccCccceeEEechHHHHhhh
Confidence            99999999999999999998

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 6e-50
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 6e-50
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  194 bits (492), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 150/267 (56%), Gaps = 48/267 (17%)
Query: 1   EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMI 60
           EA+ D  LSRYS II+DEAHERT+ TD+L+GLLK+V   R                    
Sbjct: 199 EAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRR-------------------- 238
Query: 61  LDRENDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEIL 120
                                P LK+IIMSA+LDA  F  YF  A  + V GR +PVE+ 
Sbjct: 239 ---------------------PDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELY 277
Query: 121 YTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQL--PEASR 178
           YT   + D+LD+ + T+ Q+H  E  GDIL+FLTG++EIE   R +     QL   E   
Sbjct: 278 YTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCG 337
Query: 179 KLVTVPIFSSLPSEQQMKVFAPAAAGF-----RKVILATNIAETSVTIPGIKYVIDPGFV 233
            L   P++ SLP  QQ ++F PA         RKV+++TNIAETS+TI GI YV+DPGF 
Sbjct: 338 PLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFS 397
Query: 234 KARSYDPVKGMESLIVVPISKAQALQR 260
           K + Y+P   +ESL+V PISKA A QR
Sbjct: 398 KQKVYNPRIRVESLLVSPISKASAQQR 424
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 1e-120
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 4e-47
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 5e-46
1yks_A 440 Genome polyprotein [contains: flavivirin protease 1e-44
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 4e-44
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 5e-44
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 7e-44
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-39
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 2e-22
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  358 bits (922), Expect = e-120
 Identities = 116/267 (43%), Positives = 150/267 (56%), Gaps = 48/267 (17%)

Query: 1   EALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMI 60
           EA+ D  LSRYS II+DEAHERT+ TD+L+GLLK+V   R                    
Sbjct: 199 EAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRR-------------------- 238

Query: 61  LDRENDTNGINTLKQCQGRKFPPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEIL 120
                                P LK+IIMSA+LDA  F  YF  A  + V GR +PVE+ 
Sbjct: 239 ---------------------PDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELY 277

Query: 121 YTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLP--EASR 178
           YT   + D+LD+ + T+ Q+H  E  GDIL+FLTG++EIE   R +     QL   E   
Sbjct: 278 YTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCG 337

Query: 179 KLVTVPIFSSLPSEQQMKVFAPAAAGF-----RKVILATNIAETSVTIPGIKYVIDPGFV 233
            L   P++ SLP  QQ ++F PA         RKV+++TNIAETS+TI GI YV+DPGF 
Sbjct: 338 PLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFS 397

Query: 234 KARSYDPVKGMESLIVVPISKAQALQR 260
           K + Y+P   +ESL+V PISKA A QR
Sbjct: 398 KQKVYNPRIRVESLLVSPISKASAQQR 424
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.92
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.91
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.91
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.9
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.9
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.9
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.9
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.89
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.88
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.88
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.88
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.88
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.88
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.87
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.87
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.87
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.86
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.86
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.86
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.86
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.85
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.85
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.85
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.84
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.84
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.83
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.82
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.82
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.8
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.8
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.79
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.78
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.78
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.77
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.76
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.75
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.75
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.74
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.73
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.72
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.7
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.7
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.7
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.7
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.69
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.69
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.68
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.67
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.66
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.66
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.63
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.61
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.6
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.36
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.58
3h1t_A590 Type I site-specific restriction-modification syst 99.57
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.57
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.52
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.48
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.47
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.45
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.4
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.4
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.39
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.26
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.05
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.04
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.01
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.86
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 98.62
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.25
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.95
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.83
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.77
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.74
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.74
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 97.72
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.7
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.65
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.64
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.61
3bor_A237 Human initiation factor 4A-II; translation initiat 97.57
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.54
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.45
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.44
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.19
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.11
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 97.07
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 96.66
3b6e_A216 Interferon-induced helicase C domain-containing P; 96.33
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 94.81
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 94.1
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 93.34
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 92.99
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 92.78
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 92.66
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 92.42
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 91.72
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 91.55
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 91.42
3bor_A237 Human initiation factor 4A-II; translation initiat 90.77
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 90.24
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 89.88
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 89.66
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 88.8
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 88.73
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 88.18
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 88.02
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 87.95
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 87.53
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 86.99
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 86.88
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 86.24
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 85.25
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 85.16
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 84.85
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 84.23
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 83.58
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 82.87
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 81.53
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 81.27
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 80.99
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=2e-37  Score=315.39  Aligned_cols=217  Identities=52%  Similarity=0.788  Sum_probs=199.8

Q ss_pred             ccCCCCCcccEEEEecCCcCCcchhHHHHHHHHHHhhccCCcCCCCCCCCCCCCccccccccCCccCccccccccCCCCC
Q 038855            3 LLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMILDRENDTNGINTLKQCQGRKFP   82 (260)
Q Consensus         3 ~~d~~L~~~~~vIlDEaher~~~~d~ll~~lk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (260)
                      +.++.+.++++|||||+|+|+++.|.++++++.+...++                                         
T Consensus       201 ~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~~~~~-----------------------------------------  239 (773)
T 2xau_A          201 MEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRP-----------------------------------------  239 (773)
T ss_dssp             HHSTTCTTEEEEEECSGGGCCHHHHHHHHHHHHHHHHCT-----------------------------------------
T ss_pred             hhCccccCCCEEEecCccccccchHHHHHHHHHHHHhCC-----------------------------------------
Confidence            357889999999999999999999999999999987766                                         


Q ss_pred             CceEEEEeccCCHHHHHhhhCCCcEEEecCceeeeeEEEeeCCCcchHHHHHHHHHHHHhhcCCCCEEEEeCCHHHHHHH
Q 038855           83 PLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESV  162 (260)
Q Consensus        83 ~~qlil~SATl~~~~~~~~~~~~~~v~v~~~~~~v~~~~~~~~~~~~~~~~~~~l~~i~~~~~~g~iLVFl~~~~~ve~v  162 (260)
                      ..|+++||||++.+.+.+||++++++.++++.+|++++|...+..++....+..+.+++....++++||||||+++++.+
T Consensus       240 ~~~iIl~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~~l~~l~~~~~~~~~g~iLVF~~~~~~i~~l  319 (773)
T 2xau_A          240 DLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDA  319 (773)
T ss_dssp             TCEEEEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHHHHHHHHHHHHHSCSCEEEEECSCHHHHHHH
T ss_pred             CceEEEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHHHHHHHHHHHHhcCCCCEEEECCCHHHHHHH
Confidence            78999999999999999999999999999999999999999888898888888888888887899999999999999999


Q ss_pred             HHHHHHHHhcC--ccCCCCeEEEEecCCCCHHHHHHHhcccC-----CCCeEEEEecCcccccCCCCCceEEEeCCCccc
Q 038855          163 ERLVQERLLQL--PEASRKLVTVPIFSSLPSEQQMKVFAPAA-----AGFRKVILATNIAETSVTIPGIKYVIDPGFVKA  235 (260)
Q Consensus       163 ~~~L~~~l~~~--~~~~~~~~~~~lh~~l~~~~r~~v~~~~~-----~g~~kVlvaTdiae~gidIp~V~~VId~g~~~~  235 (260)
                      ++.|.+.+..+  .....++.+.++||+|++++|.++++.|+     +|.++||||||+||+|||||+|++|||+|+++.
T Consensus       320 ~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~k~  399 (773)
T 2xau_A          320 VRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQ  399 (773)
T ss_dssp             HHHHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTTEEEEEECSEEEE
T ss_pred             HHHHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCccc
Confidence            99998744322  12225889999999999999999999999     999999999999999999999999999999999


Q ss_pred             eeeecCCCceeeeEEeeehhhhhcC
Q 038855          236 RSYDPVKGMESLIVVPISKAQALQR  260 (260)
Q Consensus       236 ~~yd~~~g~~~l~~~~isk~~~~qR  260 (260)
                      ..|||..|++.|.+.|+|++++.||
T Consensus       400 ~~yd~~~g~~~L~~~p~S~~s~~QR  424 (773)
T 2xau_A          400 KVYNPRIRVESLLVSPISKASAQQR  424 (773)
T ss_dssp             EEEETTTTEEEEEEEECCHHHHHHH
T ss_pred             eeeccccCccccccccCCHHHHHhh
Confidence            9999999999999999999999997
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 260
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 1e-21
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-12
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-06
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score = 89.7 bits (222), Expect = 1e-21
 Identities = 19/118 (16%), Positives = 36/118 (30%), Gaps = 15/118 (12%)

Query: 144 EAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMKVFAPAAA 203
                   FL        +   +++    +         V +       +   +      
Sbjct: 34  ADKRPTAWFLPSIRAANVMAASLRKAGKSV---------VVLNRKTFEREYPTIKQKK-- 82

Query: 204 GFRKVILATNIAETSVTIPGIKYVIDPGF-VKARSYDPVKGMESLIVVPISKAQALQR 260
                ILAT+IAE    +  ++ V+D     K    D  + +     + IS + A QR
Sbjct: 83  --PDFILATDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQR 137
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.83
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.78
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.77
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.75
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.74
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.72
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.71
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.71
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.71
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.7
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.64
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.44
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.36
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.35
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.14
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.13
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.04
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.0
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.89
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.14
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.04
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.92
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 97.9
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 97.86
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 97.84
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.83
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 97.82
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 97.81
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 97.81
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 97.79
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.78
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.78
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.62
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 97.35
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 96.98
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 96.8
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.54
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.77
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 95.69
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.39
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 93.42
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.41
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 92.23
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 92.22
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 91.2
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 90.56
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 89.7
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 87.92
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 86.74
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 83.17
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=99.83  E-value=1.2e-20  Score=164.80  Aligned_cols=185  Identities=15%  Similarity=0.142  Sum_probs=135.3

Q ss_pred             cCCCCCcccEEEEecCCcCCcchhHHHHHHHHHHhhccCCcCCCCCCCCCCCCccccccccCCccCccccccccCCCCCC
Q 038855            4 LDPYLSRYSVIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNKNADSDMILDRENDTNGINTLKQCQGRKFPP   83 (260)
Q Consensus         4 ~d~~L~~~~~vIlDEaher~~~~d~ll~~lk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (260)
                      .+..+.++++||+||+|....+...++++++.+... .                                         +
T Consensus        94 ~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~~~-~-----------------------------------------~  131 (305)
T d2bmfa2          94 SPIRVPNYNLIIMDEAHFTDPASIAARGYISTRVEM-G-----------------------------------------E  131 (305)
T ss_dssp             SSSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHHHH-T-----------------------------------------S
T ss_pred             cCccccceeEEEeeeeeecchhhHHHHHHHHHhhcc-c-----------------------------------------c
Confidence            456788999999999998766666677777665433 2                                         5


Q ss_pred             ceEEEEeccCCHHHHHhhhCCCcEEEecCceeeeeEEEeeCCCcchHHHHHHHHHHHHhhcCCCCEEEEeCCHHHHHHHH
Q 038855           84 LKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDFLDATLITIFQVHLDEAPGDILVFLTGQEEIESVE  163 (260)
Q Consensus        84 ~qlil~SATl~~~~~~~~~~~~~~v~v~~~~~~v~~~~~~~~~~~~~~~~~~~l~~i~~~~~~g~iLVFl~~~~~ve~v~  163 (260)
                      .++++||||.......          ......|+.......+..... ...     ....+.++++||||+++++++.++
T Consensus       132 ~~~v~~SAT~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~-~~~-----~~~~~~~~~~lvf~~~~~~~~~l~  195 (305)
T d2bmfa2         132 AAGIFMTATPPGSRDP----------FPQSNAPIMDEEREIPERSWN-SGH-----EWVTDFKGKTVWFVPSIKAGNDIA  195 (305)
T ss_dssp             CEEEEECSSCTTCCCS----------SCCCSSCEEEEECCCCCSCCS-SCC-----HHHHSSCSCEEEECSCHHHHHHHH
T ss_pred             ceEEEeecCCCcceee----------ecccCCcceEEEEeccHHHHH-HHH-----HHHHhhCCCEEEEeccHHHHHHHH
Confidence            7899999998422111          111112222222111111100 000     112345789999999999999999


Q ss_pred             HHHHHHHhcCccCCCCeEEEEecCCCCHHHHHHHhcccCCCCeEEEEecCcccccCCCCCceEEEeCCCccce--eeecC
Q 038855          164 RLVQERLLQLPEASRKLVTVPIFSSLPSEQQMKVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKAR--SYDPV  241 (260)
Q Consensus       164 ~~L~~~l~~~~~~~~~~~~~~lh~~l~~~~r~~v~~~~~~g~~kVlvaTdiae~gidIp~V~~VId~g~~~~~--~yd~~  241 (260)
                      +.|.+.         ++.+..+||++.++.+.    .+++|.+++++||+++++|+|+ ++++|||+|.....  .||+.
T Consensus       196 ~~L~~~---------~~~~~~l~~~~~~~~~~----~~~~~~~~~lvaT~~~~~G~~~-~~~~Vi~~~~~~~~~~~~~~~  261 (305)
T d2bmfa2         196 ACLRKN---------GKKVIQLSRKTFDSEYI----KTRTNDWDFVVTTDISEMGANF-KAERVIDPRRCMKPVILTDGE  261 (305)
T ss_dssp             HHHHHH---------TCCCEECCTTCHHHHGG----GGGTSCCSEEEECGGGGTTCCC-CCSEEEECCEEEEEEEECSSS
T ss_pred             HHHHhC---------CCCEEEeCCcChHHHHh----hhhccchhhhhhhHHHHhcCCC-CccEEEEcCCceeeeEecCCC
Confidence            999884         77899999999776544    5678899999999999999999 79999999988874  48899


Q ss_pred             CCceeeeEEeeehhhhhcC
Q 038855          242 KGMESLIVVPISKAQALQR  260 (260)
Q Consensus       242 ~g~~~l~~~~isk~~~~qR  260 (260)
                      .++..+...|+|+++..||
T Consensus       262 ~~~~~~~~~~~s~~~~~Qr  280 (305)
T d2bmfa2         262 ERVILAGPMPVTHSSAAQR  280 (305)
T ss_dssp             CEEEEEEEEECCHHHHHHH
T ss_pred             CceEEeccccCCHHHHhhh
Confidence            9999999999999999997
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure