Citrus Sinensis ID: 038933


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MEPVSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKHHVILGKEVEVKKAIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDIKEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVEVKRSHPKDRIDKFMNCYDCNNSNFGFGFGGGFSYGYDGFFYFYPAFQIHQCYGSPSAGRGGLLVPANPVCPSYGLCMNGYCNGSFHQMAESTADGSNSTGDHASGLEAPATRKLSHIDDLSSLKVGAVTVENQRAGVEFHDSTVLPSTKCKQTGTVSTHIIFSEFS
ccccccccEEEccccccccHHHHHHHHHccccEEEEEEEcccccccccccEEEEEccHHHHHHHHcccccEEccEEEccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHccccEEEEEEEEcccccccccEEEEEEcccHHHHHHHHcccEEEccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccc
cccHHHHEEEEEcccccccHHHHHHHHHHHccEEEEEEEEccccccEEEEEEEEEccHHHHHHHHcccccEEccEEcEEEEccccccccccccccccccccccccccccHEEEEEcccccccHHHHHHHHHHHccEEEEEEEEccccccEEEEEEEEEccHHHHHHHHcccccEEccEEcEEEEccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccc
MEPVSLRKLFvggvsretnEETLREYFSQYGTVEETLIIRSRltghgrgfGFVIFTKISMAEDALQHKHHVILGKEVevkkaipkghkleesnghsgncvgdddteintkkifvgglpldikEEEFKSYFEsfgtvtdapvicdketgrprgfgfitfdseDAANNVLQTRFHKLKYKMVEvkrshpkdridkfmncydcnnsnfgfgfgggfsygydgffyfypafqihqcygspsagrggllvpanpvcpsyglcmngycngsfhqmaestadgsnstgdhasgleapatrklshiddlsslkvgavtvenqragvefhdstvlpstkckqtgtvstHIIFSEFS
mepvslrklfvggvsretneetLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKHHVILGKEVEVKKAIPKghkleesnghsgncvgdddteINTKKIFVGGLPLDIKEEEFKSYFEsfgtvtdapvicDKETGRPRGFGFITFDSEDAANNVLQTrfhklkykmvevkrshpkdriDKFMNCYDCNNSNFGFGFGGGFSYGYDGFFYFYPAFQIHQCYGSPSAGRGGLLVPANPVCPSYGLCMNGYCNGSFHQMAESTADGSNSTGDHASGLEAPATRKLSHIDDLSSLKVGAVTVENQRAgvefhdstvlpstkckqtgtvsthiifsefs
MEPVSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKHHVILGKEVEVKKAIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDIkeeefksyfesfGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVEVKRSHPKDRIDKFMNCYDCNNSNfgfgfgggfsygydgffyfyPAFQIHQCYGSPSAGRGGLLVPANPVCPSYGLCMNGYCNGSFHQMAESTADGSNSTGDHASGLEAPATRKLSHIDDLSSLKVGAVTVENQRAGVEFHDSTVLPSTKCKQTGTVSTHIIFSEFS
********LFVGGVS****EETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKHHVILGKEVEVKKA****************CVGDDDTEINTKKIFVGGLPLDIKEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVEVKRSHPKDRIDKFMNCYDCNNSNFGFGFGGGFSYGYDGFFYFYPAFQIHQCYGSPSAGRGGLLVPANPVCPSYGLCMNGYCNGSFH************************************LKVGAVTVENQRAGVEFHDSTVLPSTKCKQTGTVSTHIIF****
***VSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKHHVILGKEVEVKKA************************INTKKIFVGGLPLDIKEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVEV************************************************************************************************************************************************************THIIFSEFS
MEPVSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKHHVILGKEVEVKKAIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDIKEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVEVKRSHPKDRIDKFMNCYDCNNSNFGFGFGGGFSYGYDGFFYFYPAFQIHQCYGSPSAGRGGLLVPANPVCPSYGLCMNGYCNGSFHQMA*************ASGLEAPATRKLSHIDDLSSLKVGAVTVENQRAGVEFHDSTVLPSTKCKQTGTVSTHIIFSEFS
*EPVSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKHHVILGKEVEVKKAIP**********************INTKKIFVGGLPLDIKEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVEVKRSHP************CNNSNFGFGFGGGFSYGYDGFFYFYPAFQIHQCYGSPSAGRGGLLVPANPVCPSYGLCMNGYCNGSFHQMAESTADGSNSTGDHASGLEAPATRKLSHIDDLSSLKVGAV*V****************************HII*S*FS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPVSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKHHVILGKEVEVKKAIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDIKEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVEVKRSHPKDRIDKFMNCYDCNNSNFGFGFGGGFSYGYDGFFYFYPAFQIHQCYGSPSAGRGGLLVPANPVCPSYGLCMNGYCNGSFHQMAESTADGSNSTGDHASGLEAPATRKLSHIDDLSSLKVGAVTVENQRAGVEFHDSTVLPSTKCKQTGTVSTHIIFSEFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query347 2.2.26 [Sep-21-2011]
Q8W034411 Heterogeneous nuclear rib no no 0.515 0.435 0.494 1e-45
Q96EP5407 DAZ-associated protein 1 no no 0.524 0.447 0.412 2e-36
Q9JII5406 DAZ-associated protein 1 yes no 0.524 0.448 0.412 2e-36
Q98SJ2360 DAZ-associated protein 1 N/A no 0.524 0.505 0.426 4e-36
Q99383534 Nuclear polyadenylated RN yes no 0.466 0.303 0.392 1e-35
O43347362 RNA-binding protein Musas no no 0.484 0.464 0.417 3e-34
Q61474362 RNA-binding protein Musas no no 0.484 0.464 0.417 5e-34
Q8K3P4362 RNA-binding protein Musas no no 0.484 0.464 0.417 5e-34
Q9VVE5369 RNA-binding protein Musas no no 0.484 0.455 0.406 6e-34
O94432474 Uncharacterized RNA-bindi yes no 0.504 0.369 0.373 3e-33
>sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  183 bits (465), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 128/186 (68%), Gaps = 7/186 (3%)

Query: 8   KLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQH 67
           KLFVGG+S ET+E+ LRE+F+ YG V + +++R +LTG  RGFGFVIF+  S+ +  LQ 
Sbjct: 7   KLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE 66

Query: 68  KHHVILGKEVEVKKAIPKGHKLEESNGHSGNC----VGDDDTEINTKKIFVGGLPLDIKE 123
           KH +   +EV+VK+A+ +  + ++ +G +GN         D    TKKIFVGGLP  + +
Sbjct: 67  KHSIDT-REVDVKRAMSR--EEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTD 123

Query: 124 EEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVEVK 183
           EEF+ YFE +G VTD  ++ D+ T RPRGFGF++FDSEDA ++VL   FH L  K VEVK
Sbjct: 124 EEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVK 183

Query: 184 RSHPKD 189
           R+ PKD
Sbjct: 184 RALPKD 189




Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection.
Arabidopsis thaliana (taxid: 3702)
>sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=2 SV=2 Back     alignment and function description
>sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 Back     alignment and function description
>sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 Back     alignment and function description
>sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 Back     alignment and function description
>sp|Q61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1 Back     alignment and function description
>sp|Q8K3P4|MSI1H_RAT RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 Back     alignment and function description
>sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
116787926 476 unknown [Picea sitchensis] 0.654 0.476 0.458 9e-50
414883901 448 TPA: hypothetical protein ZEAMMB73_81482 0.740 0.573 0.421 2e-45
356527120 513 PREDICTED: uncharacterized protein LOC10 0.521 0.352 0.532 3e-45
357447957 522 RNA-binding protein, putative [Medicago 0.521 0.346 0.516 3e-45
115473043 472 Os07g0584500 [Oryza sativa Japonica Grou 0.694 0.510 0.438 7e-45
357459939 481 Heterogeneous nuclear ribonucleoprotein 0.521 0.376 0.521 9e-45
356501604 477 PREDICTED: uncharacterized protein LOC10 0.521 0.379 0.521 1e-44
356566592 479 PREDICTED: uncharacterized protein LOC10 0.521 0.377 0.521 1e-44
115486383 467 Os11g0637700 [Oryza sativa Japonica Grou 0.510 0.379 0.516 1e-44
357122209 472 PREDICTED: uncharacterized protein LOC10 0.694 0.510 0.434 1e-44
>gi|116787926|gb|ABK24693.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
 Score =  203 bits (517), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 121/264 (45%), Positives = 161/264 (60%), Gaps = 37/264 (14%)

Query: 8   KLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQH 67
           K+F+GG+S ET+EE LR+YFS+YG V +T+I++ RLTG  RGFGFV+F+  S+ + ALQ 
Sbjct: 7   KIFIGGISWETSEERLRDYFSKYGEVVQTVIMKDRLTGRARGFGFVVFSDPSIVDIALQE 66

Query: 68  KHHVILGKEVEVKKAIPKGHKLEESNGHSGNCVGDDDTE------INTKKIFVGGLPLDI 121
           KH  I G+ VE KKA+P+    E+ N  + N   ++D++      + TKKIFVGGLP ++
Sbjct: 67  KH-TIDGRAVEAKKAVPR---SEQQNTRT-NSYNNNDSQGYGGGSVRTKKIFVGGLPANL 121

Query: 122 KEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVE 181
            EE+FK+YF+ FG +TD  V+ D  T RPRGFGFI+FDSEDA  +VLQ  FH+L  K+VE
Sbjct: 122 TEEDFKNYFQQFGNITDVVVMYDHNTQRPRGFGFISFDSEDAVESVLQKSFHQLNEKLVE 181

Query: 182 VKRSHPKD-------RIDKFMNCYDCNNSNFGFGFGGGFSYGYDGFFYFYPAFQIHQCYG 234
           VKR+ PKD       R       Y+ + SN G         GY+G          +  YG
Sbjct: 182 VKRALPKDASPGAAGRGAGGYQGYNNSTSNTG---------GYEGRM-------DNNRYG 225

Query: 235 S-PSAGRGGLLV--PANPVCPSYG 255
             P AGRGG     P     PSYG
Sbjct: 226 QPPPAGRGGFPSYGPTGYGTPSYG 249




Source: Picea sitchensis

Species: Picea sitchensis

Genus: Picea

Family: Pinaceae

Order: Coniferales

Class: Coniferopsida

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|414883901|tpg|DAA59915.1| TPA: hypothetical protein ZEAMMB73_814821 [Zea mays] Back     alignment and taxonomy information
>gi|356527120|ref|XP_003532161.1| PREDICTED: uncharacterized protein LOC100805131 [Glycine max] Back     alignment and taxonomy information
>gi|357447957|ref|XP_003594254.1| RNA-binding protein, putative [Medicago truncatula] gi|355483302|gb|AES64505.1| RNA-binding protein, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|115473043|ref|NP_001060120.1| Os07g0584500 [Oryza sativa Japonica Group] gi|38175737|dbj|BAC55617.2| putative heterogeneous nuclear ribonucleoprotein A1 [Oryza sativa Japonica Group] gi|113611656|dbj|BAF22034.1| Os07g0584500 [Oryza sativa Japonica Group] gi|215695373|dbj|BAG90564.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357459939|ref|XP_003600251.1| Heterogeneous nuclear ribonucleoprotein A1 [Medicago truncatula] gi|355489299|gb|AES70502.1| Heterogeneous nuclear ribonucleoprotein A1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356501604|ref|XP_003519614.1| PREDICTED: uncharacterized protein LOC100814628 [Glycine max] Back     alignment and taxonomy information
>gi|356566592|ref|XP_003551514.1| PREDICTED: uncharacterized protein LOC100794390 [Glycine max] Back     alignment and taxonomy information
>gi|115486383|ref|NP_001068335.1| Os11g0637700 [Oryza sativa Japonica Group] gi|108864610|gb|ABA94921.2| RNA-binding protein, putative, expressed [Oryza sativa Japonica Group] gi|113645557|dbj|BAF28698.1| Os11g0637700 [Oryza sativa Japonica Group] gi|215697828|dbj|BAG92021.1| unnamed protein product [Oryza sativa Japonica Group] gi|215740693|dbj|BAG97349.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357122209|ref|XP_003562808.1| PREDICTED: uncharacterized protein LOC100836006 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
TAIR|locus:2077392 495 AT3G07810 [Arabidopsis thalian 0.521 0.365 0.467 2.5e-41
TAIR|locus:2050992404 AT2G33410 [Arabidopsis thalian 0.521 0.448 0.434 2.2e-38
TAIR|locus:2133862455 AT4G26650 [Arabidopsis thalian 0.541 0.413 0.471 2.6e-38
TAIR|locus:2129590411 AT4G14300 [Arabidopsis thalian 0.515 0.435 0.462 5.5e-38
TAIR|locus:2173967 460 AT5G55550 [Arabidopsis thalian 0.521 0.393 0.473 1.9e-37
ZFIN|ZDB-GENE-070212-1407 dazap1 "DAZ associated protein 0.521 0.444 0.390 2.7e-34
UNIPROTKB|E1BAK6396 DAZAP1 "Uncharacterized protei 0.524 0.459 0.384 5.6e-34
UNIPROTKB|E2R6E4407 DAZAP1 "Uncharacterized protei 0.524 0.447 0.384 5.6e-34
UNIPROTKB|Q96EP5407 DAZAP1 "DAZ-associated protein 0.524 0.447 0.384 5.6e-34
UNIPROTKB|I3LB68406 DAZAP1 "Uncharacterized protei 0.524 0.448 0.384 5.6e-34
TAIR|locus:2077392 AT3G07810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 418 (152.2 bits), Expect = 2.5e-41, Sum P(2) = 2.5e-41
 Identities = 85/182 (46%), Positives = 114/182 (62%)

Query:     8 KLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQH 67
             KLF+GG+S +TNEE L+EYFS +G V E +I++ R TG  RGFGFV+F   ++AE  +  
Sbjct:     7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITE 66

Query:    68 KHHVILGKEVEVKKAIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDIXXXXXX 127
             KH++  G+ VE KKA+P+  +   +  +S +  G       T+KIFVGGLP  +      
Sbjct:    67 KHNID-GRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFK 125

Query:   128 XXXXXXGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVEVKRSHP 187
                   GT TD  V+ D  T RPRGFGFIT+DSE+A   VL   FH+L  KMVEVKR+ P
Sbjct:   126 TYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVP 185

Query:   188 KD 189
             K+
Sbjct:   186 KE 187


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005576 "extracellular region" evidence=ISM
TAIR|locus:2050992 AT2G33410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133862 AT4G26650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129590 AT4G14300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173967 AT5G55550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070212-1 dazap1 "DAZ associated protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAK6 DAZAP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6E4 DAZAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96EP5 DAZAP1 "DAZ-associated protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LB68 DAZAP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 7e-31
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 6e-27
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 9e-25
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 3e-24
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-22
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 3e-22
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 5e-22
smart0036073 smart00360, RRM, RNA recognition motif 5e-20
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 6e-20
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 7e-20
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 9e-20
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 5e-19
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 5e-19
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 9e-19
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 2e-18
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-18
smart0036073 smart00360, RRM, RNA recognition motif 3e-18
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 3e-18
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 4e-18
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 5e-18
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 6e-18
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 4e-17
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 5e-17
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 6e-17
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 8e-17
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 1e-16
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 1e-16
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 2e-16
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 3e-16
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 3e-16
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 4e-16
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 5e-16
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 5e-16
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 6e-16
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 1e-15
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 2e-15
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 2e-15
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 2e-15
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 2e-15
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 3e-15
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 3e-15
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 4e-15
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 5e-15
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 5e-15
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 7e-15
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 1e-14
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 1e-14
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-14
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-14
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 1e-14
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 2e-14
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 2e-14
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 3e-14
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 4e-14
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 5e-14
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 7e-14
pfam0007670 pfam00076, RRM_1, RNA recognition motif 7e-14
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 8e-14
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 8e-14
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 9e-14
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-13
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 1e-13
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 1e-13
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-13
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 1e-13
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 1e-13
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-13
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 2e-13
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 2e-13
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 3e-13
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 4e-13
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 4e-13
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-12
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 1e-12
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 2e-12
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 3e-12
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 3e-12
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-12
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 4e-12
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 4e-12
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 4e-12
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 5e-12
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-12
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 6e-12
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 7e-12
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 7e-12
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 8e-12
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-11
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 1e-11
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-11
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 3e-11
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 5e-11
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 6e-11
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 7e-11
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 9e-11
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 9e-11
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 9e-11
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 1e-10
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 1e-10
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 2e-10
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-10
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 2e-10
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 2e-10
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 3e-10
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 4e-10
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 4e-10
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-10
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 6e-10
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 6e-10
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 7e-10
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 8e-10
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 8e-10
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 9e-10
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 1e-09
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 1e-09
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 1e-09
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 1e-09
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 1e-09
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 2e-09
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 2e-09
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 2e-09
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 2e-09
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 2e-09
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 2e-09
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 2e-09
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 2e-09
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-09
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 3e-09
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 4e-09
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 6e-09
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 6e-09
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 6e-09
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 7e-09
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 7e-09
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 7e-09
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 7e-09
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 9e-09
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 9e-09
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-08
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 1e-08
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 1e-08
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 1e-08
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 1e-08
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-08
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-08
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 2e-08
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-08
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 2e-08
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 2e-08
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-08
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 3e-08
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 3e-08
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 3e-08
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 3e-08
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 4e-08
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 4e-08
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 4e-08
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 4e-08
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 4e-08
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 4e-08
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 5e-08
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 6e-08
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 8e-08
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 8e-08
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 1e-07
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 1e-07
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 1e-07
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 1e-07
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 1e-07
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 1e-07
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 1e-07
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-07
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 2e-07
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-07
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 2e-07
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 2e-07
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 2e-07
cd1246483 cd12464, RRM_G3BP2, RNA recognition motif in ras G 2e-07
cd1272681 cd12726, RRM2_CPEB2_like, RNA recognition motif 2 2e-07
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 3e-07
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 3e-07
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 3e-07
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 3e-07
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 3e-07
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 3e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 4e-07
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 5e-07
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 5e-07
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 5e-07
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 5e-07
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 5e-07
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 5e-07
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 6e-07
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 7e-07
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 7e-07
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 7e-07
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 8e-07
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 8e-07
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 8e-07
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 9e-07
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 9e-07
cd1272492 cd12724, RRM1_CPEB2_like, RNA recognition motif 1 9e-07
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-06
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 1e-06
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-06
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 1e-06
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 1e-06
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 1e-06
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 1e-06
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 1e-06
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 1e-06
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 2e-06
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 2e-06
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 2e-06
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 2e-06
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-06
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 2e-06
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 3e-06
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 3e-06
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 3e-06
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 3e-06
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 3e-06
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 3e-06
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 3e-06
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 3e-06
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 3e-06
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 3e-06
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 4e-06
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 4e-06
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 5e-06
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 5e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 5e-06
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 5e-06
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 6e-06
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 6e-06
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 6e-06
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 6e-06
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 6e-06
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 6e-06
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 7e-06
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 7e-06
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 8e-06
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 8e-06
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 8e-06
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-05
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-05
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 1e-05
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 1e-05
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 1e-05
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-05
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-05
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 1e-05
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 1e-05
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1e-05
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 1e-05
cd1226586 cd12265, RRM_SLT11, RNA recognition motif of pre-m 1e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 1e-05
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 1e-05
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 1e-05
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 1e-05
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 2e-05
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 2e-05
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 2e-05
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 2e-05
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2e-05
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 2e-05
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 2e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 2e-05
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 2e-05
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 2e-05
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 2e-05
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 2e-05
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 2e-05
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-05
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 3e-05
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 3e-05
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 3e-05
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 3e-05
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 3e-05
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 3e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 3e-05
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 3e-05
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 4e-05
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 4e-05
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 4e-05
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 4e-05
cd1253483 cd12534, RRM_SARFH, RNA recognition motif in Droso 4e-05
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 4e-05
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 4e-05
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 4e-05
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 4e-05
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 5e-05
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 5e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 5e-05
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 5e-05
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 5e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 6e-05
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 6e-05
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 6e-05
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 6e-05
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 7e-05
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 7e-05
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 7e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 8e-05
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 8e-05
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 8e-05
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 8e-05
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 9e-05
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 9e-05
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 9e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 9e-05
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 9e-05
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 9e-05
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 9e-05
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 1e-04
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 1e-04
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 1e-04
cd12723100 cd12723, RRM1_CPEB1, RNA recognition motif 1 in cy 1e-04
cd1275287 cd12752, RRM1_RBM5, RNA recognition motif 1 in ver 1e-04
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 1e-04
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 1e-04
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 1e-04
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 1e-04
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 1e-04
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 2e-04
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 2e-04
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 2e-04
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-04
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 2e-04
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 2e-04
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 2e-04
cd12444112 cd12444, RRM1_CPEBs, RNA recognition motif 1 in cy 2e-04
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-04
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 3e-04
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 3e-04
cd1253586 cd12535, RRM_FUS_TAF15, RNA recognition motif in v 3e-04
cd12302110 cd12302, RRM_scSet1p_like, RNA recognition motif i 3e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 3e-04
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 3e-04
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 3e-04
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 3e-04
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 4e-04
cd1250880 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 4e-04
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 4e-04
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 4e-04
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 5e-04
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 5e-04
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 6e-04
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 6e-04
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 6e-04
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 6e-04
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 6e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 6e-04
cd1234875 cd12348, RRM1_SHARP, RNA recognition motif 1 in SM 6e-04
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 6e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 7e-04
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 7e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 7e-04
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 7e-04
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 7e-04
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 8e-04
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 8e-04
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 8e-04
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 8e-04
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 8e-04
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 0.001
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 0.001
cd1246483 cd12464, RRM_G3BP2, RNA recognition motif in ras G 0.001
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 0.001
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 0.001
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 0.001
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.001
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 0.001
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 0.001
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 0.001
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 0.001
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 0.001
cd1250477 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 0.001
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 0.001
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 0.001
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.001
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 0.001
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 0.002
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 0.002
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 0.002
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 0.002
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 0.002
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 0.002
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 0.002
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 0.002
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 0.002
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 0.002
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 0.002
cd1236078 cd12360, RRM_cwf2, RNA recognition motif in yeast 0.002
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 0.003
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 0.003
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 0.003
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 0.003
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 0.003
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 0.003
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 0.004
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 0.004
cd1250377 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition m 0.004
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 0.004
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
 Score =  111 bits (280), Expect = 7e-31
 Identities = 44/80 (55%), Positives = 56/80 (70%)

Query: 108 NTKKIFVGGLPLDIKEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNV 167
            TKKIFVGGLP ++ E + + YF  FGTVT+  V+ D E  RPRGFGFITF+SED+ + V
Sbjct: 1   RTKKIFVGGLPPNVTETDLRKYFSQFGTVTEVVVMYDHEKKRPRGFGFITFESEDSVDQV 60

Query: 168 LQTRFHKLKYKMVEVKRSHP 187
           +   FH +  K VEVKR+ P
Sbjct: 61  VNEHFHDINGKKVEVKRAEP 80


This subfamily corresponds to the RRM2 of DAZAP1 or DAZ-associated protein 1, also termed proline-rich RNA binding protein (Prrp), a multi-functional ubiquitous RNA-binding protein expressed most abundantly in the testis and essential for normal cell growth, development, and spermatogenesis. DAZAP1 is a shuttling protein whose acetylated is predominantly nuclear and the nonacetylated form is in cytoplasm. DAZAP1 also functions as a translational regulator that activates translation in an mRNA-specific manner. DAZAP1 was initially identified as a binding partner of Deleted in Azoospermia (DAZ). It also interacts with numerous hnRNPs, including hnRNP U, hnRNP U like-1, hnRNPA1, hnRNPA/B, and hnRNP D, suggesting DAZAP1 might associate and cooperate with hnRNP particles to regulate adenylate-uridylate-rich elements (AU-rich element or ARE)-containing mRNAs. DAZAP1 contains two N-terminal RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a C-terminal proline-rich domain. . Length = 80

>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras GTPase-activating protein-binding protein 2 (G3BP2) and similar proteins Back     alignment and domain information
>gnl|CDD|241170 cd12726, RRM2_CPEB2_like, RNA recognition motif 2 found in cytoplasmic polyadenylation element-binding protein CPEB-2, CPEB-3, CPEB-4 and similar protiens Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|241168 cd12724, RRM1_CPEB2_like, RNA recognition motif 1 in cytoplasmic polyadenylation element-binding protein CPEB-2, CPEB-3, CPEB-4 and similar protiens Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila melanogaster RNA-binding protein cabeza and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241167 cd12723, RRM1_CPEB1, RNA recognition motif 1 in cytoplasmic polyadenylation element-binding protein 1 (CPEB-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241196 cd12752, RRM1_RBM5, RNA recognition motif 1 in vertebrate RNA-binding protein 5 (RBM5) Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240890 cd12444, RRM1_CPEBs, RNA recognition motif 1 in cytoplasmic polyadenylation element-binding protein CPEB-1, CPEB-2, CPEB-3, CPEB-4 and similar protiens Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240979 cd12535, RRM_FUS_TAF15, RNA recognition motif in vertebrate fused in Ewing's sarcoma protein (FUS), TATA-binding protein-associated factor 15 (TAF15) and similar proteins Back     alignment and domain information
>gnl|CDD|240748 cd12302, RRM_scSet1p_like, RNA recognition motif in budding yeast Saccharomyces cerevisiae SET domain-containing protein 1 (scSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240952 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 2 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras GTPase-activating protein-binding protein 2 (G3BP2) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240948 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240947 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 347
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.98
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.97
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.97
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.97
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.97
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.97
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.96
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.96
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.96
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.95
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.94
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.94
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.93
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.93
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.93
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.93
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.93
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.93
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.89
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.89
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.88
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.88
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.87
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.87
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.86
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.86
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.83
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.82
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.81
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.81
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.79
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.78
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.77
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.73
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.69
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 99.67
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.67
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.67
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.66
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.65
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.65
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.61
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.6
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.6
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.6
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.59
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.58
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.57
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.55
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 99.54
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.54
KOG0122270 consensus Translation initiation factor 3, subunit 99.52
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.52
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.52
PLN03120260 nucleic acid binding protein; Provisional 99.51
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.51
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 99.51
KOG0122270 consensus Translation initiation factor 3, subunit 99.5
KOG0129520 consensus Predicted RNA-binding protein (RRM super 99.49
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.49
PLN03120260 nucleic acid binding protein; Provisional 99.48
KOG4207256 consensus Predicted splicing factor, SR protein su 99.47
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.45
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.44
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.44
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.44
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.42
PLN03121243 nucleic acid binding protein; Provisional 99.41
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.41
PLN03213 759 repressor of silencing 3; Provisional 99.41
PLN03121243 nucleic acid binding protein; Provisional 99.4
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.4
smart0036272 RRM_2 RNA recognition motif. 99.39
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.39
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 99.38
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.38
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.37
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.36
smart0036071 RRM RNA recognition motif. 99.35
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.34
KOG4207256 consensus Predicted splicing factor, SR protein su 99.33
smart0036272 RRM_2 RNA recognition motif. 99.33
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.33
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.32
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.31
smart0036071 RRM RNA recognition motif. 99.31
PLN03213 759 repressor of silencing 3; Provisional 99.31
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.3
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.3
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 99.3
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.3
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.3
KOG0108435 consensus mRNA cleavage and polyadenylation factor 99.28
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.23
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.22
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.21
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.2
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.19
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.18
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.18
KOG4210285 consensus Nuclear localization sequence binding pr 99.14
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 99.12
smart0036170 RRM_1 RNA recognition motif. 99.1
smart0036170 RRM_1 RNA recognition motif. 99.1
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.07
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.05
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.03
KOG0153377 consensus Predicted RNA-binding protein (RRM super 99.0
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 98.97
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.96
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.95
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.95
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 98.93
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.92
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.92
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 98.89
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.87
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.85
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.8
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.78
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.74
KOG0226290 consensus RNA-binding proteins [General function p 98.74
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.71
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 98.71
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.63
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.59
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.59
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.58
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.58
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.54
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.52
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.52
KOG1995351 consensus Conserved Zn-finger protein [General fun 98.5
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.5
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.46
KOG0226290 consensus RNA-binding proteins [General function p 98.45
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 98.44
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.41
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 98.21
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.15
KOG0151 877 consensus Predicted splicing regulator, contains R 98.09
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.05
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.03
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.01
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.0
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.98
KOG4660 549 consensus Protein Mei2, essential for commitment t 97.88
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.75
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.74
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.68
KOG0151 877 consensus Predicted splicing regulator, contains R 97.66
KOG4210285 consensus Nuclear localization sequence binding pr 97.65
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 97.55
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.53
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.53
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.5
KOG1855484 consensus Predicted RNA-binding protein [General f 97.47
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.24
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.23
KOG1855484 consensus Predicted RNA-binding protein [General f 97.14
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.12
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.11
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.69
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.68
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.63
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.6
KOG2314 698 consensus Translation initiation factor 3, subunit 96.55
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.52
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.35
KOG3152278 consensus TBP-binding protein, activator of basal 96.26
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.2
KOG3152278 consensus TBP-binding protein, activator of basal 96.2
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.17
KOG2314 698 consensus Translation initiation factor 3, subunit 96.15
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.03
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 96.01
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 95.8
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 95.67
KOG1996378 consensus mRNA splicing factor [RNA processing and 95.59
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 95.2
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 94.41
KOG1996378 consensus mRNA splicing factor [RNA processing and 94.39
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 94.3
PF15023166 DUF4523: Protein of unknown function (DUF4523) 94.12
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 94.06
KOG2135526 consensus Proteins containing the RNA recognition 94.05
KOG2591 684 consensus c-Mpl binding protein, contains La domai 93.94
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 93.86
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 93.55
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 93.47
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 92.73
KOG2135526 consensus Proteins containing the RNA recognition 92.48
KOG2591 684 consensus c-Mpl binding protein, contains La domai 92.31
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 91.77
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 91.12
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 90.87
KOG2068327 consensus MOT2 transcription factor [Transcription 89.73
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 89.46
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 88.6
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 88.09
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 87.67
KOG2068327 consensus MOT2 transcription factor [Transcription 86.47
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 86.46
PF14111153 DUF4283: Domain of unknown function (DUF4283) 85.98
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 84.82
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 84.82
KOG3973465 consensus Uncharacterized conserved glycine-rich p 82.3
PF0753068 PRE_C2HC: Associated with zinc fingers; InterPro: 81.86
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 80.51
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
Probab=100.00  E-value=3e-36  Score=282.72  Aligned_cols=170  Identities=22%  Similarity=0.419  Sum_probs=152.6

Q ss_pred             CCCCCeEEEcCCCCCCcHHHHHHHhccCCCeEEEEEEecCCCCCcceEEEEEEcchhHHHHHHHhcC-ceEeCeEeeeee
Q 038933            3 PVSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKH-HVILGKEVEVKK   81 (347)
Q Consensus         3 ~~~~r~l~V~nLp~~~te~~L~~~F~~~G~v~~v~i~~~~~tg~~kG~aFVeF~~~~~a~~Al~~~~-~~~~gr~i~v~~   81 (347)
                      ....++|||+|||+++|+++|+++|++||+|++|+|++|+.+++++|||||+|.++++|++|++.++ ..+.+++|.|.+
T Consensus       104 ~~~~~~LfVgnLp~~~te~~L~~lF~~~G~V~~v~i~~d~~tg~srGyaFVeF~~~e~A~~Ai~~LnG~~l~gr~i~V~~  183 (346)
T TIGR01659       104 NNSGTNLIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAFVDFGSEADSQRAIKNLNGITVRNKRLKVSY  183 (346)
T ss_pred             CCCCcEEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCccCcEEEEEEccHHHHHHHHHHcCCCccCCceeeeec
Confidence            4567899999999999999999999999999999999999999999999999999999999998866 788999999998


Q ss_pred             cccCCCccccCCCCCCCCCCCCCCCCCcceEEEcCCCCCCCHHHHHHhhhcCceeEeecccccCCCCCceeEEEEEEcCh
Q 038933           82 AIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDIKEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSE  161 (347)
Q Consensus        82 a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~V~nLp~~~t~e~L~~~F~~~G~v~~v~i~~~~~~~~~~G~afV~F~~~  161 (347)
                      +.+...                  .....+|||+|||+++|+++|+++|++||.|+.++|++++.+++++|+|||+|++.
T Consensus       184 a~p~~~------------------~~~~~~lfV~nLp~~vtee~L~~~F~~fG~V~~v~i~~d~~tg~~kG~aFV~F~~~  245 (346)
T TIGR01659       184 ARPGGE------------------SIKDTNLYVTNLPRTITDDQLDTIFGKYGQIVQKNILRDKLTGTPRGVAFVRFNKR  245 (346)
T ss_pred             cccccc------------------ccccceeEEeCCCCcccHHHHHHHHHhcCCEEEEEEeecCCCCccceEEEEEECCH
Confidence            754221                  12246899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHh-CCceeCC--eEEEEEecCCCCC
Q 038933          162 DAANNVLQT-RFHKLKY--KMVEVKRSHPKDR  190 (347)
Q Consensus       162 e~a~~Al~~-~~~~i~g--~~i~v~~a~~~~~  190 (347)
                      ++|++||+. ++..+.+  +.|.|.++..+..
T Consensus       246 e~A~~Ai~~lng~~~~g~~~~l~V~~a~~~~~  277 (346)
T TIGR01659       246 EEAQEAISALNNVIPEGGSQPLTVRLAEEHGK  277 (346)
T ss_pred             HHHHHHHHHhCCCccCCCceeEEEEECCcccc
Confidence            999999996 7777765  6889998876544



This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF14111 DUF4283: Domain of unknown function (DUF4283) Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown] Back     alignment and domain information
>PF07530 PRE_C2HC: Associated with zinc fingers; InterPro: IPR006579 This domain is present in proteins found exclusively in the arthropods, including a number of Drosophila species, the silk moth and the gypsy moth Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 3e-31
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 1e-09
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 1e-24
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-24
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 1e-24
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 1e-24
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 1e-24
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 2e-24
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 1e-13
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 6e-07
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 2e-13
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 1e-05
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 8e-13
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 7e-05
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 2e-12
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 2e-12
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 2e-06
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 5e-12
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 3e-04
2mss_A75 Musashi1 Rbd2, Nmr Length = 75 5e-11
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 1e-10
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 2e-10
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 3e-10
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 1e-04
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 1e-09
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 3e-06
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 1e-09
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 9e-07
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 5e-09
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 1e-08
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 3e-08
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 2e-07
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 3e-07
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 4e-07
1wtb_A79 Complex Structure Of The C-Terminal Rna-Binding Dom 3e-07
1wtb_A79 Complex Structure Of The C-Terminal Rna-Binding Dom 5e-05
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 3e-07
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 4e-07
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 5e-07
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 5e-07
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 7e-07
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 9e-07
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 1e-06
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 2e-06
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 5e-06
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 2e-06
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 3e-06
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 3e-06
1iqt_A75 Solution Structure Of The C-Terminal Rna-Binding Do 3e-06
1iqt_A75 Solution Structure Of The C-Terminal Rna-Binding Do 4e-04
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 4e-06
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 4e-06
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 5e-06
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 7e-06
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 1e-05
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 1e-05
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 1e-05
2dnk_A105 Solution Structure Of Rna Binding Domain In Bruno-L 2e-05
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 2e-05
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 2e-05
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 2e-05
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 3e-05
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 3e-05
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 6e-04
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 4e-05
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 5e-05
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 7e-05
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 7e-05
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 7e-05
2dgq_A108 Solution Structure Of The N-Terminal Rna Binding Do 1e-04
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 1e-04
1wf0_A88 Solution Structure Of Rrm Domain In Tar Dna-Binding 1e-04
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 1e-04
1sxl_A97 Resonance Assignments And Solution Structure Of The 1e-04
2yh0_A198 Solution Structure Of The Closed Conformation Of Hu 2e-04
2dgp_A106 Solution Structure Of The N-Terminal Rna Binding Do 5e-04
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 5e-04
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 5e-04
3nnh_A88 Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuug 6e-04
3d2w_A89 Crystal Structure Of Mouse Tdp-43 Rrm2 Domain In Co 6e-04
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 6e-04
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 9e-04
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure

Iteration: 1

Score = 132 bits (332), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 68/181 (37%), Positives = 106/181 (58%), Gaps = 19/181 (10%) Query: 8 KLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQH 67 K+F+GG++ +T E+ LREYF +YGTV + I++ TG RGFGF+ F K S ++ ++ Sbjct: 5 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKT 64 Query: 68 KHHVILGKEVEVKKAIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDIXXXXXX 127 H++ GK ++ K+AIP+ D + T KIFVGG+ D+ Sbjct: 65 -QHILDGKVIDPKRAIPR------------------DEQDKTGKIFVGGIGPDVRPKEFE 105 Query: 128 XXXXXXGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVEVKRSHP 187 GT+ DA ++ DK+TG+ RGFGF+T+DS DA + V Q +F K + +E+KR+ P Sbjct: 106 EFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEP 165 Query: 188 K 188 + Sbjct: 166 R 166
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|2MSS|A Chain A, Musashi1 Rbd2, Nmr Length = 75 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|1WTB|A Chain A, Complex Structure Of The C-Terminal Rna-Binding Domain Of Hnrnp D (Auf1) With Telomere Dna Length = 79 Back     alignment and structure
>pdb|1WTB|A Chain A, Complex Structure Of The C-Terminal Rna-Binding Domain Of Hnrnp D (Auf1) With Telomere Dna Length = 79 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|1IQT|A Chain A, Solution Structure Of The C-Terminal Rna-Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein D0 (Auf1) Length = 75 Back     alignment and structure
>pdb|1IQT|A Chain A, Solution Structure Of The C-Terminal Rna-Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein D0 (Auf1) Length = 75 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2DNK|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 4 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|2DGQ|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 6 Rna-Binding Protein Length = 108 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1WF0|A Chain A, Solution Structure Of Rrm Domain In Tar Dna-Binding Protein- 43 Length = 88 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|2YH0|A Chain A, Solution Structure Of The Closed Conformation Of Human U2af65 Tandem Rrm1 And Rrm2 Domains Length = 198 Back     alignment and structure
>pdb|2DGP|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 4 Rna-Binding Protein Length = 106 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|3NNH|A Chain A, Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuuguuu Rna Length = 88 Back     alignment and structure
>pdb|3D2W|A Chain A, Crystal Structure Of Mouse Tdp-43 Rrm2 Domain In Complex Wit Length = 89 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 8e-75
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-27
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-70
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-29
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-51
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-20
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-47
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-21
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-46
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-20
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-43
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-20
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-16
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-43
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-16
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 8e-43
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 8e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-16
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-39
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-37
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-18
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 7e-36
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 5e-32
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 9e-36
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-30
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-35
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-12
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-34
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 5e-33
2cqd_A116 RNA-binding region containing protein 1; RNA recog 3e-33
2cqd_A116 RNA-binding region containing protein 1; RNA recog 7e-32
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-33
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-33
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 4e-33
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 6e-33
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 7e-33
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 9e-33
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 5e-30
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-32
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-32
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-32
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 4e-29
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 2e-31
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-31
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-31
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-30
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-30
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 7e-30
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 1e-27
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-25
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-27
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 9e-25
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-26
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 8e-25
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 3e-25
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 5e-21
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 7e-25
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 8e-22
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 8e-24
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-22
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-22
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 7e-20
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 4e-22
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 6e-21
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 8e-22
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-18
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-21
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 6e-18
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-21
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-17
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 4e-21
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-20
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 7e-21
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 7e-16
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-20
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-16
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-20
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-16
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-20
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-17
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-20
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-16
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-20
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-17
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-20
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 9e-08
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 5e-20
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-16
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 5e-20
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-18
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-20
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-17
2dnl_A114 Cytoplasmic polyadenylation element binding protei 6e-20
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-16
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 7e-20
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 8e-10
1x4e_A85 RNA binding motif, single-stranded interacting pro 8e-20
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-16
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 8e-20
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 3e-17
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 9e-20
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-19
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 9e-20
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 5e-16
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 9e-20
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-15
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-19
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 4e-18
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-19
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-16
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-19
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-18
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 9e-19
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-17
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-18
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 8e-17
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-18
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 7e-17
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-18
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-17
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-18
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 7e-17
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-18
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 3e-17
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-18
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 5e-16
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 4e-18
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 7e-16
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 5e-18
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 1e-11
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 5e-18
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 4e-16
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-18
3n9u_C156 Cleavage and polyadenylation specificity factor S; 2e-14
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 5e-18
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 9e-16
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-18
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-07
2cph_A107 RNA binding motif protein 19; RNA recognition moti 7e-18
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-17
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 8e-18
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-14
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 8e-18
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 7e-17
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 8e-18
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-14
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 8e-18
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 8e-14
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 9e-18
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 8e-13
3p5t_L90 Cleavage and polyadenylation specificity factor S; 1e-17
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-13
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-17
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 6e-16
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-17
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-12
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-17
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-15
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-17
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-16
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-17
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-12
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-17
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 3e-16
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-17
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 5e-16
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-17
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 4e-11
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-17
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-14
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 4e-17
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 9e-17
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 4e-17
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-16
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 7e-17
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 3e-16
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 8e-17
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 5e-16
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 1e-16
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 5e-13
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 2e-16
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 9e-12
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-16
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 6e-14
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-16
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-15
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 7e-16
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 6e-12
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 8e-16
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 9e-16
2dis_A109 Unnamed protein product; structural genomics, RRM 8e-16
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-14
2div_A99 TRNA selenocysteine associated protein; structural 8e-16
2div_A99 TRNA selenocysteine associated protein; structural 5e-13
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 8e-16
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 5e-12
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-15
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-14
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-15
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-12
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-15
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-13
3q2s_C229 Cleavage and polyadenylation specificity factor S; 3e-15
3q2s_C229 Cleavage and polyadenylation specificity factor S; 3e-14
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-15
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-14
2cpj_A99 Non-POU domain-containing octamer-binding protein; 4e-15
2cpj_A99 Non-POU domain-containing octamer-binding protein; 6e-14
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 5e-15
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-11
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 5e-15
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-14
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 5e-15
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-14
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 6e-15
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-13
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-14
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 5e-13
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-14
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-12
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-14
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 4e-11
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-14
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-13
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-14
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-13
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-14
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 1e-10
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-14
2kt5_A124 RNA and export factor-binding protein 2; chaperone 3e-14
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-14
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-10
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 6e-14
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 1e-06
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-14
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 1e-12
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-13
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 4e-13
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-13
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 8e-13
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-13
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 3e-13
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 3e-13
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-12
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 4e-13
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-12
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-13
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 6e-10
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 7e-13
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 4e-08
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 9e-13
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-07
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 9e-13
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-12
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 1e-12
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-06
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-12
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-10
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-12
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 9e-10
2i2y_A150 Fusion protein consists of immunoglobin G- binding 3e-12
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-11
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 5e-12
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 6e-07
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 5e-12
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-11
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 7e-12
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-11
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 7e-12
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 3e-10
1x5p_A97 Negative elongation factor E; structure genomics, 1e-11
1x5p_A97 Negative elongation factor E; structure genomics, 2e-09
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-11
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 6e-09
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-11
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-09
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-11
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-07
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-11
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-07
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-06
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-06
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-11
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-09
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 6e-11
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 8e-11
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 6e-11
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 8e-11
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 7e-11
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-10
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-10
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 8e-10
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-10
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-09
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 3e-10
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 5e-08
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-09
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 7e-08
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-09
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-08
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-09
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-08
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-09
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 5e-08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 3e-09
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-06
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-09
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-06
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-08
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 7e-09
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-07
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 1e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 6e-08
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 5e-08
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 9e-08
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 5e-08
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 2e-05
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 6e-08
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-07
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 7e-08
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 4e-07
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 8e-08
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 9e-08
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 2e-05
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1e-07
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-07
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-06
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 2e-07
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-06
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 6e-07
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 4e-06
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 2e-04
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-04
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 4e-04
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 6e-04
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
 Score =  228 bits (583), Expect = 8e-75
 Identities = 63/192 (32%), Positives = 108/192 (56%), Gaps = 12/192 (6%)

Query: 2   EPVSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMA 61
           EP  LRKLF+GG+S ET +E+LR +F Q+GT+ + +++R   T   RGFGFV +  +   
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 62  EDALQHKHHVILGKEVEVKKAIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDI 121
           + A+  + H + G+ VE K+A+ +    E+S              +  KKIFVGG+  D 
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSR----EDSQR--------PGAHLTVKKIFVGGIKEDT 116

Query: 122 KEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVE 181
           +E   + YFE +G +    ++ D+ +G+ RGF F+TFD  D+ + ++  ++H +     E
Sbjct: 117 EEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCE 176

Query: 182 VKRSHPKDRIDK 193
           V+++  K  +  
Sbjct: 177 VRKALSKQEMAS 188


>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.98
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.98
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.98
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.97
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.97
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.97
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.97
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.96
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.96
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.96
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.96
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.96
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.9
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.88
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.83
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.82
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.82
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.82
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.81
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.81
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.8
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.8
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.8
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.8
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.79
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.78
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.78
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.78
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.78
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.77
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.77
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.77
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.77
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.77
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.77
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.77
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.77
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.77
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.77
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.77
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.76
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.76
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.76
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.76
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.76
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.76
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.76
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.76
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.76
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.76
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.76
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.76
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.76
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.76
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.76
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.76
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.76
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.76
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.76
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.75
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.75
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.75
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.75
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.75
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.75
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.75
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.75
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.75
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.75
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.75
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.75
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.75
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.75
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.75
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.75
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.75
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.75
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.75
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.75
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.75
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.75
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.75
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.75
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.75
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.74
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.74
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.74
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.74
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.74
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.74
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.74
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.74
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.74
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.74
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.74
2div_A99 TRNA selenocysteine associated protein; structural 99.74
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.74
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.74
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.74
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.74
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.74
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.74
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.74
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.74
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.74
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.74
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.74
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.73
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.73
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.73
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.73
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.73
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.73
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.73
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.73
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.73
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.73
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.73
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.73
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.73
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.73
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.73
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.73
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.73
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.73
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.73
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.73
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.73
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.73
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.73
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.73
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.73
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.73
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.73
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.72
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.72
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.72
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.72
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.72
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.72
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.72
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.72
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.72
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.72
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.72
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.72
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.72
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.72
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.72
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.72
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.72
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.72
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.72
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.72
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.72
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.72
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.72
2dis_A109 Unnamed protein product; structural genomics, RRM 99.72
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.72
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.72
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.72
2div_A99 TRNA selenocysteine associated protein; structural 99.72
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.71
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.71
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.71
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.71
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.71
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.71
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.71
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.71
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.71
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.71
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.71
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.71
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.71
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.71
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.71
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.7
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.7
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.7
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.7
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.7
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.7
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.7
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.7
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.7
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.7
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.7
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.7
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.7
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.7
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.7
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.7
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.69
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.69
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.69
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.69
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.69
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.69
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.69
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.69
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.69
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.69
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.69
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.69
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.69
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.69
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.68
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.68
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.68
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.68
2dis_A109 Unnamed protein product; structural genomics, RRM 99.68
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.68
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.68
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.68
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.68
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.68
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.68
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.68
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.68
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.68
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.67
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.67
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.67
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.67
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.67
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.67
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.67
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.67
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.66
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.66
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.66
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.66
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.66
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.66
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.66
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.66
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.66
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.66
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.65
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.65
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.65
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.47
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.65
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.65
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.65
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.65
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.65
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.65
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.65
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.65
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.65
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.64
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.64
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.64
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.64
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.64
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.64
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.64
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.64
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.64
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.64
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.44
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.64
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.63
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.63
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.63
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.63
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.63
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.63
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.63
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.63
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.63
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.63
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.62
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.62
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.62
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.62
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.62
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.62
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.62
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.62
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.61
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.61
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.61
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.61
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.61
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.61
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.61
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.61
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.61
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.6
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.6
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.6
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.6
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.6
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.6
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.6
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.6
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.6
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.59
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.59
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.59
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.59
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.59
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.59
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.59
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.59
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.59
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.58
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.58
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.58
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.58
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.58
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.58
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.58
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.58
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.58
1x5p_A97 Negative elongation factor E; structure genomics, 99.58
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.57
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.57
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.57
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.57
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.56
1x5p_A97 Negative elongation factor E; structure genomics, 99.56
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.55
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.55
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.55
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.55
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.54
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.54
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.53
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.53
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.53
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.52
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.51
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.51
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.5
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.49
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.49
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.49
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.49
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.48
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.46
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.45
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.43
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.43
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.41
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.4
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.39
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.38
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.37
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.36
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.35
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.34
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.33
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.33
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.33
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.32
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.32
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.17
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.16
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.14
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.11
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.03
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.01
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.91
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.8
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.78
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.6
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.58
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.5
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.5
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.23
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.18
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.96
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.45
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.28
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.26
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.24
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.14
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.12
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.06
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.86
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.73
2l9b_A109 MRNA 3'-END-processing protein RNA15; 3' END mRNA 96.58
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.49
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.44
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.24
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.08
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.76
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.41
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 95.21
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 89.33
4eba_G174 RNA15, KLLA0F09383P; HAT domain, heat repeat, monk 86.29
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 84.66
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
Probab=100.00  E-value=7.4e-37  Score=265.04  Aligned_cols=179  Identities=34%  Similarity=0.703  Sum_probs=155.4

Q ss_pred             CCCCCCeEEEcCCCCCCcHHHHHHHhccCCCeEEEEEEecCCCCCcceEEEEEEcchhHHHHHHHhcCceEeCeEeeeee
Q 038933            2 EPVSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKHHVILGKEVEVKK   81 (347)
Q Consensus         2 e~~~~r~l~V~nLp~~~te~~L~~~F~~~G~v~~v~i~~~~~tg~~kG~aFVeF~~~~~a~~Al~~~~~~~~gr~i~v~~   81 (347)
                      ++.+.++|||+|||+++|+++|+++|++||.|.+|+++.++.+++++|||||+|.+.++|++||+.++..+.|+.|.|.+
T Consensus         9 ~~~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~A~~~~~~~~~g~~l~v~~   88 (196)
T 1l3k_A            9 EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKR   88 (196)
T ss_dssp             CCGGGGEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEE
T ss_pred             CCCCCCEEEEeCCCCCCCHHHHHHHHHhCCCEEEEEEEEcCCCCCccceEEEEeCCHHHHHHHHhcCCCEECCEEeeeec
Confidence            46778999999999999999999999999999999999999899999999999999999999999977899999999999


Q ss_pred             cccCCCccccCCCCCCCCCCCCCCCCCcceEEEcCCCCCCCHHHHHHhhhcCceeEeecccccCCCCCceeEEEEEEcCh
Q 038933           82 AIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDIKEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSE  161 (347)
Q Consensus        82 a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~V~nLp~~~t~e~L~~~F~~~G~v~~v~i~~~~~~~~~~G~afV~F~~~  161 (347)
                      +.........            ......++|||+|||+++|+++|+++|++||.|..+.++.++.+++++|||||+|.+.
T Consensus        89 ~~~~~~~~~~------------~~~~~~~~l~V~nLp~~~t~~~l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~F~~~  156 (196)
T 1l3k_A           89 AVSREDSQRP------------GAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDH  156 (196)
T ss_dssp             CCC-----------------------CCSEEEEECCTTTCCHHHHHHHHTTTSCEEEEEEEECTTTCCEEEEEEEEESSH
T ss_pred             ccCccccccc------------ccCCCcceEEEeCCCCCCCHHHHHHHHhcCCCeEEEEEeecCCCCCccceEEEEECCH
Confidence            8665432211            1234568999999999999999999999999999999999998999999999999999


Q ss_pred             HHHHHHHHhCCceeCCeEEEEEecCCCCCCC
Q 038933          162 DAANNVLQTRFHKLKYKMVEVKRSHPKDRID  192 (347)
Q Consensus       162 e~a~~Al~~~~~~i~g~~i~v~~a~~~~~~~  192 (347)
                      ++|.+|+++++..|+|+.|.|.++.++....
T Consensus       157 ~~A~~A~~~~~~~~~G~~i~v~~a~~k~~~~  187 (196)
T 1l3k_A          157 DSVDKIVIQKYHTVNGHNCEVRKALSKQEMA  187 (196)
T ss_dssp             HHHHHHHHCSCCEETTEECEEEECC------
T ss_pred             HHHHHHHHhCCcEECCEEEEEEecCChhHhc
Confidence            9999999988999999999999999887654



>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l9b_A MRNA 3'-END-processing protein RNA15; 3' END mRNA maturation, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>4eba_G RNA15, KLLA0F09383P; HAT domain, heat repeat, monkeytail, CLP1, PCF11, structural RNA binding protein complex; 3.30A {Kluyveromyces lactis} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 347
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 7e-32
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-13
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-13
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-21
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 6e-17
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 9e-21
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-17
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-19
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-17
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-18
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-16
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-17
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 4e-17
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-17
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-17
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 9e-17
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-15
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-16
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 4e-16
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-15
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-14
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-14
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-14
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-14
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-12
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-14
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-13
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-14
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-12
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 2e-14
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 4e-13
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 7e-14
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-11
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 7e-14
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 7e-12
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-13
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 8e-12
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-13
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-11
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-13
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-12
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 5e-13
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 8e-13
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 5e-13
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 6e-12
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 8e-13
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 5e-10
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-12
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 4e-11
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-12
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-12
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-11
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 4e-12
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-09
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-12
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-10
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 5e-12
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 8e-11
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-12
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 4e-10
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 6e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 6e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 4e-11
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 7e-12
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-10
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 7e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-10
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 8e-12
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-10
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-11
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-11
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-11
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-10
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-11
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-11
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 6e-10
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-11
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-08
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-11
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-08
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 3e-11
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 7e-10
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 6e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 7e-11
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-07
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 8e-11
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 9e-11
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 8e-11
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 9e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 8e-11
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 7e-09
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 9e-10
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-10
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 6e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 4e-10
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 5e-10
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 5e-10
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 1e-09
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 6e-10
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 6e-10
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 1e-09
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 1e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-09
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-07
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-09
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-09
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 2e-09
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 5e-07
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 4e-08
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 4e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 5e-09
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 9e-09
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-07
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 1e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-08
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-08
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-06
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 5e-08
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 6e-05
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-07
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 8e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 7e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 6e-07
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 3e-05
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 3e-06
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-05
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 9e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-04
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 3e-05
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 9e-04
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 6e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 1e-04
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-04
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-04
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 1e-04
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 0.003
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.004
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-04
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 4e-04
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 0.003
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 5e-04
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 0.001
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 0.003
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.002
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.003
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 0.003
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  116 bits (290), Expect = 7e-32
 Identities = 61/187 (32%), Positives = 104/187 (55%), Gaps = 12/187 (6%)

Query: 2   EPVSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMA 61
           EP  LRKLF+GG+S ET +E+LR +F Q+GT+ + +++R   T   RGFGFV +  +   
Sbjct: 2   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 61

Query: 62  EDALQHKHHVILGKEVEVKKAIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDI 121
           + A+  + H + G+ VE K+A+ +                     +  KKIFVGG+  D 
Sbjct: 62  DAAMNARPHKVDGRVVEPKRAVSR------------EDSQRPGAHLTVKKIFVGGIKEDT 109

Query: 122 KEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDSEDAANNVLQTRFHKLKYKMVE 181
           +E   + YFE +G +    ++ D+ +G+ RGF F+TFD  D+ + ++  ++H +     E
Sbjct: 110 EEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCE 169

Query: 182 VKRSHPK 188
           V+++  K
Sbjct: 170 VRKALSK 176


>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 100.0
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.86
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.83
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.82
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.82
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.82
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.82
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.81
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.81
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.81
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.81
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.81
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.81
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.81
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.81
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.81
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.81
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.81
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.81
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.8
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.8
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.8
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.8
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.8
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.8
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.8
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.8
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.8
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.8
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.8
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.8
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.8
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.8
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.79
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.79
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.79
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.79
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.79
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.79
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.79
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.78
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.78
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.78
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.78
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.78
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.78
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.78
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.78
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.78
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.77
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.77
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.77
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.76
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.76
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.76
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.76
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.76
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.76
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.76
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.75
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.75
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.75
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.75
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.75
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.75
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.75
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.75
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.75
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.75
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.75
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.74
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.74
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.74
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.74
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.74
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.73
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.73
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.73
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.72
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.72
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.72
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.72
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.71
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.7
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.7
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.7
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.7
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.7
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.7
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.7
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.69
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.69
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.69
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.69
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.69
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.69
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.69
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.68
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.68
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.68
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.68
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.68
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.67
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.67
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.67
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.67
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.67
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.66
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.66
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.66
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.66
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.66
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.66
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.65
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.65
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.65
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.65
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.65
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.65
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.64
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.64
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.64
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.63
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.63
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.63
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.63
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.62
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.62
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.62
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.62
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.62
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.62
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.62
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.62
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.62
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.62
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.61
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.61
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.59
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.59
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.59
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.58
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.58
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.57
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.57
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.54
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.53
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.48
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.46
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.46
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.41
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.37
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.37
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.37
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.35
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.3
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.28
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.27
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.23
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.18
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.15
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.55
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.09
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.99
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.79
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.69
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.36
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.29
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.34
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.7e-35  Score=251.24  Aligned_cols=178  Identities=34%  Similarity=0.700  Sum_probs=161.3

Q ss_pred             CCCCCCCeEEEcCCCCCCcHHHHHHHhccCCCeEEEEEEecCCCCCcceEEEEEEcchhHHHHHHHhcCceEeCeEeeee
Q 038933            1 MEPVSLRKLFVGGVSRETNEETLREYFSQYGTVEETLIIRSRLTGHGRGFGFVIFTKISMAEDALQHKHHVILGKEVEVK   80 (347)
Q Consensus         1 ~e~~~~r~l~V~nLp~~~te~~L~~~F~~~G~v~~v~i~~~~~tg~~kG~aFVeF~~~~~a~~Al~~~~~~~~gr~i~v~   80 (347)
                      .||++.|+|||+|||+++|+++|+++|++||.|.++.+++++.+++++|||||+|.+.++|++|+..++..+..+.+.+.
T Consensus         1 ~ep~~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~   80 (183)
T d1u1qa_           1 KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPK   80 (183)
T ss_dssp             CCCHHHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEE
T ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhh
Confidence            47888899999999999999999999999999999999999999999999999999999999999999889999999888


Q ss_pred             ecccCCCccccCCCCCCCCCCCCCCCCCcceEEEcCCCCCCCHHHHHHhhhcCceeEeecccccCCCCCceeEEEEEEcC
Q 038933           81 KAIPKGHKLEESNGHSGNCVGDDDTEINTKKIFVGGLPLDIKEEEFKSYFESFGTVTDAPVICDKETGRPRGFGFITFDS  160 (347)
Q Consensus        81 ~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~V~nLp~~~t~e~L~~~F~~~G~v~~v~i~~~~~~~~~~G~afV~F~~  160 (347)
                      +..........            ......++|||+|||+.+|+++|+++|+.||.|..+.++.+..+++++|+|||+|.+
T Consensus        81 ~~~~~~~~~~~------------~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~  148 (183)
T d1u1qa_          81 RAVSREDSQRP------------GAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDD  148 (183)
T ss_dssp             ECCCTTGGGST------------TTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESC
T ss_pred             hhhhccccccc------------ccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECC
Confidence            87554433222            223456799999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHhCCceeCCeEEEEEecCCCCC
Q 038933          161 EDAANNVLQTRFHKLKYKMVEVKRSHPKDR  190 (347)
Q Consensus       161 ~e~a~~Al~~~~~~i~g~~i~v~~a~~~~~  190 (347)
                      .++|++|++++++.++|+.|+|.+|.++..
T Consensus       149 ~e~A~~Al~~~~~~~~G~~i~V~~A~~k~e  178 (183)
T d1u1qa_         149 HDSVDKIVIQKYHTVNGHNCEVRKALSKQE  178 (183)
T ss_dssp             HHHHHHHHTSSCEEETTEEEEEEECCCHHH
T ss_pred             HHHHHHHHHhCCCeECCEEEEEEecCCccc
Confidence            999999999888999999999999987654



>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure