Citrus Sinensis ID: 038938

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MGLLDHPSTPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRMSKIPNAYLLQQHENPANPKIWKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLHLIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL
cccccccccHHHHHHHHHHHHHHcccccccccccEEEEccccHHHHHHHHHHHHccccEEEEccccccHHHHHcccccEEEcccccccccHHHHHHccccccEEEEccccccccccccHHHHHcccccEEEEEcccccccccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHHcccc
ccccccccHHHHHHHHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHcccccHHHHcccccccHHHHcccccEEEEEEEcccccHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccHHHccEEEEEccHHHHHHHHHHHHHHcccc
mglldhpstpsrIACSMikdaedkgsispgkqYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRMSkipnayllqqhenpanpkiwkdsggkfDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESavlnggkpglhlIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL
mglldhpstpsRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLAsiassrgykIIVKMPNTYSIQRRMSKIPNAYLLQQHENPANPKIWKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLHLIQGIGIGIIPTVLDIKMLDEVKTVLLCHVvtettkrlalkggll
MGLLDHPSTPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRMSKIPNAYLLQQHENPANPKIWKDSGGKFDALVAgirtggtitgAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLHLiqgigigiiPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL
*******************************QYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRMSKIPNAYLLQQHE**ANPKIWKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLHLIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLA******
***LDHPSTPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRMSKIPNAYLLQQHENPANPKIWKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLHLIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL
*********PSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRMSKIPNAYLLQQHENPANPKIWKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLHLIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL
******PSTPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRMSKIPNAYLLQQHENPANPKIWKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLHLIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALK***L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLLDHPSTPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRMSKIPNAYLLQQHENPANPKIWKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLHLIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query194 2.2.26 [Sep-21-2011]
Q43317325 Cysteine synthase OS=Citr N/A no 0.948 0.566 0.506 4e-44
Q9XEA8325 Cysteine synthase OS=Oryz yes no 0.948 0.566 0.48 3e-43
P80608325 Cysteine synthase OS=Zea N/A no 0.948 0.566 0.488 2e-42
P47999392 Cysteine synthase, chloro no no 0.948 0.469 0.48 8e-42
P47998322 Cysteine synthase OS=Arab no no 0.948 0.571 0.475 2e-41
O81154325 Cysteine synthase OS=Sola N/A no 0.948 0.566 0.475 5e-41
F4K5T2323 Bifunctional cystathionin no no 0.948 0.569 0.497 6e-41
Q43725430 Cysteine synthase, mitoch no no 0.948 0.427 0.48 7e-41
P38076325 Cysteine synthase OS=Trit N/A no 0.948 0.566 0.475 1e-40
O81155386 Cysteine synthase, chloro N/A no 0.948 0.476 0.493 1e-40
>sp|Q43317|CYSK_CITLA Cysteine synthase OS=Citrullus lanatus PE=1 SV=1 Back     alignment and function desciption
 Score =  177 bits (449), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 114/225 (50%), Positives = 144/225 (64%), Gaps = 41/225 (18%)

Query: 8   STPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTY 67
           S   RI  SMI DAE+KG I+PG+  +VL+E TS N GIGLA IA+++GY++I+ MP + 
Sbjct: 47  SVKDRIGYSMISDAENKGLITPGE--SVLIEPTSGNTGIGLAFIAAAKGYRLIICMPASM 104

Query: 68  SIQRRM-----------------------------SKIPNAYLLQQHENPANPKI----- 93
           S++RR                              +K PN+Y+LQQ ENPANPKI     
Sbjct: 105 SLERRTILRAFGAELVLTDPARGMKGAVQKAEEIKAKTPNSYILQQFENPANPKIHYETT 164

Query: 94  ----WKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLH 149
               W+ SGGK DALV+GI TGGT+TGA K+LKE+N  +K+YG+E VESA+L+GGKPG H
Sbjct: 165 GPEIWRGSGGKIDALVSGIGTGGTVTGAGKYLKEQNPNIKLYGVEPVESAILSGGKPGPH 224

Query: 150 LIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL 194
            IQGIG G IP VLD+ +LDEV  V     + ET K LALK GLL
Sbjct: 225 KIQGIGAGFIPGVLDVNLLDEVIQVSSEESI-ETAKLLALKEGLL 268
Produces L-cysteine from O-acetyl-L-serine and hydrogen sulfide. Can also use pyrazole and 3,4-dihydroxypyridine instead of the hydrogen sulfide to produce two plant specific non-protein amino acids beta-pyrazolylalanine and L-mimosine.
Citrullus lanatus (taxid: 3654)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 5EC: 2
>sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 Back     alignment and function description
>sp|P80608|CYSK_MAIZE Cysteine synthase OS=Zea mays PE=1 SV=2 Back     alignment and function description
>sp|P47999|CYSKP_ARATH Cysteine synthase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=OASB PE=1 SV=2 Back     alignment and function description
>sp|P47998|CYSK1_ARATH Cysteine synthase OS=Arabidopsis thaliana GN=OASA1 PE=1 SV=2 Back     alignment and function description
>sp|O81154|CYSK_SOLTU Cysteine synthase OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|F4K5T2|CGL_ARATH Bifunctional cystathionine gamma-lyase/cysteine synthase OS=Arabidopsis thaliana GN=DES1 PE=1 SV=1 Back     alignment and function description
>sp|Q43725|CYSKM_ARATH Cysteine synthase, mitochondrial OS=Arabidopsis thaliana GN=OASC PE=1 SV=3 Back     alignment and function description
>sp|P38076|CYSK_WHEAT Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=2 SV=1 Back     alignment and function description
>sp|O81155|CYSKP_SOLTU Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
363814498 324 uncharacterized protein LOC100775420 [Gl 0.948 0.567 0.52 4e-50
351724467 324 cysteine synthase [Glycine max] gi|12650 0.948 0.567 0.506 3e-48
255542388 332 cysteine synthase, putative [Ricinus com 0.948 0.554 0.546 1e-47
357441515 308 Cysteine synthase [Medicago truncatula] 0.948 0.597 0.571 7e-47
255542386 323 cysteine synthase, putative [Ricinus com 0.948 0.569 0.528 4e-46
224130744 323 predicted protein [Populus trichocarpa] 0.948 0.569 0.542 5e-46
224125560 323 predicted protein [Populus trichocarpa] 0.948 0.569 0.551 1e-45
357441523 376 Cysteine synthase [Medicago truncatula] 0.948 0.489 0.52 2e-45
388508804 323 unknown [Medicago truncatula] 0.948 0.569 0.533 4e-45
255542390 324 cysteine synthase, putative [Ricinus com 0.948 0.567 0.52 5e-45
>gi|363814498|ref|NP_001242884.1| uncharacterized protein LOC100775420 [Glycine max] gi|255645072|gb|ACU23035.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 143/225 (63%), Gaps = 41/225 (18%)

Query: 8   STPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTY 67
           S   RIA SMI+DAE KG I+PGK   VLVE TS N GIGLA IA+ RGYK+ V MP+  
Sbjct: 47  SVKDRIALSMIEDAEKKGLITPGK--TVLVEYTSGNTGIGLAFIAALRGYKLQVTMPSYV 104

Query: 68  SIQRR-----------------------------MSKIPNAYLLQQHENPANP------- 91
           S++R+                             ++K P++++L Q ENPANP       
Sbjct: 105 SLERKIILRAFGAEVYLTDPAKGIDGVIQKAEELLAKTPDSFMLNQFENPANPNIHYETT 164

Query: 92  --KIWKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLH 149
             +IW+DSGGK DALVAGI TGG+I GA +FL+EKN ++K+YG+E  ESAVLNGG+PG H
Sbjct: 165 GPEIWRDSGGKIDALVAGIGTGGSIAGAGRFLREKNPDIKLYGVEPAESAVLNGGQPGKH 224

Query: 150 LIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL 194
           LIQGIG GIIP VLD+  LDEV  V     + ET K LALK GLL
Sbjct: 225 LIQGIGAGIIPKVLDVNFLDEVIQVSSEEAI-ETAKLLALKEGLL 268

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351724467|ref|NP_001235267.1| cysteine synthase [Glycine max] gi|126508784|gb|ABO15567.1| cysteine synthase [Glycine max] Back     alignment and taxonomy information
>gi|255542388|ref|XP_002512257.1| cysteine synthase, putative [Ricinus communis] gi|223548218|gb|EEF49709.1| cysteine synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357441515|ref|XP_003591035.1| Cysteine synthase [Medicago truncatula] gi|355480083|gb|AES61286.1| Cysteine synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|255542386|ref|XP_002512256.1| cysteine synthase, putative [Ricinus communis] gi|223548217|gb|EEF49708.1| cysteine synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224130744|ref|XP_002328365.1| predicted protein [Populus trichocarpa] gi|222838080|gb|EEE76445.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224125560|ref|XP_002319616.1| predicted protein [Populus trichocarpa] gi|222857992|gb|EEE95539.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357441523|ref|XP_003591039.1| Cysteine synthase [Medicago truncatula] gi|355480087|gb|AES61290.1| Cysteine synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388508804|gb|AFK42468.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255542390|ref|XP_002512258.1| cysteine synthase, putative [Ricinus communis] gi|223548219|gb|EEF49710.1| cysteine synthase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
TAIR|locus:2114804324 CYSD1 "cysteine synthase D1" [ 0.618 0.370 0.446 6.5e-39
TAIR|locus:2143754323 DES1 "L-cysteine desulfhydrase 0.623 0.374 0.435 1.3e-38
TAIR|locus:2130419322 OASA1 "O-acetylserine (thiol) 0.623 0.375 0.435 4.5e-38
TAIR|locus:2143814323 CYSD2 "cysteine synthase D2" [ 0.623 0.374 0.442 4.5e-38
TAIR|locus:2080417433 OASC "O-acetylserine (thiol) l 0.623 0.279 0.404 4.8e-35
UNIPROTKB|Q1KLZ2376 CAS1 "L-3-cyanoalanine synthas 0.623 0.321 0.381 1.3e-31
UNIPROTKB|Q43153368 CYSC "Bifunctional L-3-cyanoal 0.623 0.328 0.358 9.3e-31
UNIPROTKB|Q1KLZ1375 CAS2 "L-3-cyanoalanine synthas 0.623 0.322 0.366 3.5e-30
TIGR_CMR|CHY_0808306 CHY_0808 "cysteine synthase A" 0.324 0.205 0.484 1.9e-25
TIGR_CMR|BA_0067307 BA_0067 "cysteine synthase A" 0.319 0.201 0.492 2.8e-24
TAIR|locus:2114804 CYSD1 "cysteine synthase D1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 252 (93.8 bits), Expect = 6.5e-39, Sum P(2) = 6.5e-39
 Identities = 58/130 (44%), Positives = 75/130 (57%)

Query:    74 SKIPNAYLLQQHENPANPK---------IWKDSGGKFDALVAXXXXXXXXXXAEKFLKEK 124
             SK P++ +L+Q +NP+NP+         IW+DS G+ D LVA          + +FLKEK
Sbjct:   140 SKNPDSIMLEQFKNPSNPQTHYRTTGPEIWRDSAGEVDILVAGVGTGGTLSGSGRFLKEK 199

Query:   125 NLEMKVYGIESVESAVLNGGKPGLHLXXXXXXXXXPTVLDIKMLDEVKTVLLCHVVTETT 184
             N + KVYG+E  ESAV++GGKPG HL         P  LD  +LDEV  V     + ET 
Sbjct:   200 NKDFKVYGVEPTESAVISGGKPGTHLIQGIGAGLIPDNLDFNVLDEVIQVTSVEAI-ETA 258

Query:   185 KRLALKGGLL 194
             K LALK GLL
Sbjct:   259 KLLALKEGLL 268
GO:0003824 "catalytic activity" evidence=IEA
GO:0004124 "cysteine synthase activity" evidence=IEA;ISS;IDA;IMP
GO:0006535 "cysteine biosynthetic process from serine" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0019344 "cysteine biosynthetic process" evidence=ISS;RCA;IDA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009069 "serine family amino acid metabolic process" evidence=RCA
GO:0042545 "cell wall modification" evidence=RCA
TAIR|locus:2143754 DES1 "L-cysteine desulfhydrase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130419 OASA1 "O-acetylserine (thiol) lyase (OAS-TL) isoform A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143814 CYSD2 "cysteine synthase D2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080417 OASC "O-acetylserine (thiol) lyase isoform C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ2 CAS1 "L-3-cyanoalanine synthase 1, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
UNIPROTKB|Q43153 CYSC "Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ1 CAS2 "L-3-cyanoalanine synthase 2, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0808 CHY_0808 "cysteine synthase A" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0067 BA_0067 "cysteine synthase A" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
PLN02565322 PLN02565, PLN02565, cysteine synthase 2e-67
PLN00011323 PLN00011, PLN00011, cysteine synthase 1e-63
cd01561291 cd01561, CBS_like, CBS_like: This subgroup include 2e-59
TIGR01139298 TIGR01139, cysK, cysteine synthase A 3e-59
TIGR01136299 TIGR01136, cysKM, cysteine synthase 1e-56
PLN03013429 PLN03013, PLN03013, cysteine synthase 2e-54
PLN02556368 PLN02556, PLN02556, cysteine synthase/L-3-cyanoala 5e-51
COG0031300 COG0031, CysK, Cysteine synthase [Amino acid trans 1e-49
PRK10717330 PRK10717, PRK10717, cysteine synthase A; Provision 3e-34
TIGR01137 454 TIGR01137, cysta_beta, cystathionine beta-synthase 1e-32
TIGR03945304 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate bio 6e-28
TIGR01138290 TIGR01138, cysM, cysteine synthase B 1e-25
PRK11761296 PRK11761, cysM, cysteine synthase B; Provisional 5e-25
cd00640244 cd00640, Trp-synth-beta_II, Tryptophan synthase be 5e-20
pfam00291295 pfam00291, PALP, Pyridoxal-phosphate dependent enz 4e-14
PLN02356423 PLN02356, PLN02356, phosphateglycerate kinase 3e-08
>gnl|CDD|166206 PLN02565, PLN02565, cysteine synthase Back     alignment and domain information 
 Score =  208 bits (531), Expect = 2e-67
 Identities = 115/225 (51%), Positives = 144/225 (64%), Gaps = 41/225 (18%)

Query: 8   STPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTY 67
           S   RI  SMI DAE+KG I PG+  +VL+E TS N GIGLA +A+++GYK+I+ MP + 
Sbjct: 44  SVKDRIGYSMITDAEEKGLIKPGE--SVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASM 101

Query: 68  SIQRRM-----------------------------SKIPNAYLLQQHENPANPK------ 92
           S++RR+                             +K PN+Y+LQQ ENPANPK      
Sbjct: 102 SLERRIILLAFGAELVLTDPAKGMKGAVQKAEEILAKTPNSYILQQFENPANPKIHYETT 161

Query: 93  ---IWKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLH 149
              IWK +GGK DA V+GI TGGTITGA K+LKE+N ++K+YG+E VESAVL+GGKPG H
Sbjct: 162 GPEIWKGTGGKVDAFVSGIGTGGTITGAGKYLKEQNPDIKLYGVEPVESAVLSGGKPGPH 221

Query: 150 LIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL 194
            IQGIG G IP VLD+ +LDEV  V     + ET K LALK GLL
Sbjct: 222 KIQGIGAGFIPGVLDVDLLDEVVQVSSDEAI-ETAKLLALKEGLL 265

Length = 322
>gnl|CDD|177651 PLN00011, PLN00011, cysteine synthase Back     alignment and domain information
>gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>gnl|CDD|233288 TIGR01139, cysK, cysteine synthase A Back     alignment and domain information
>gnl|CDD|233286 TIGR01136, cysKM, cysteine synthase Back     alignment and domain information
>gnl|CDD|178587 PLN03013, PLN03013, cysteine synthase Back     alignment and domain information
>gnl|CDD|178171 PLN02556, PLN02556, cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>gnl|CDD|223110 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182672 PRK10717, PRK10717, cysteine synthase A; Provisional Back     alignment and domain information
>gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|234409 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate biosynthesis protein SbnA Back     alignment and domain information
>gnl|CDD|130208 TIGR01138, cysM, cysteine synthase B Back     alignment and domain information
>gnl|CDD|236972 PRK11761, cysM, cysteine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme Back     alignment and domain information
>gnl|CDD|215204 PLN02356, PLN02356, phosphateglycerate kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
COG0031300 CysK Cysteine synthase [Amino acid transport and m 100.0
PLN03013429 cysteine synthase 100.0
PLN02565322 cysteine synthase 100.0
TIGR01139298 cysK cysteine synthase A. This model distinguishes 100.0
PLN00011323 cysteine synthase 100.0
PLN02556368 cysteine synthase/L-3-cyanoalanine synthase 100.0
PLN02356423 phosphateglycerate kinase 100.0
KOG1252362 consensus Cystathionine beta-synthase and related 100.0
TIGR01136299 cysKM cysteine synthases. This model discriminates 100.0
PRK11761296 cysM cysteine synthase B; Provisional 100.0
TIGR01138290 cysM cysteine synthase B. Alternate name: O-acetyl 100.0
PRK10717330 cysteine synthase A; Provisional 100.0
COG1171347 IlvA Threonine dehydratase [Amino acid transport a 100.0
cd01561291 CBS_like CBS_like: This subgroup includes Cystathi 100.0
TIGR01137 454 cysta_beta cystathionine beta-synthase. Members of 100.0
cd06448316 L-Ser-dehyd Serine dehydratase is a pyridoxal phos 100.0
PLN02970328 serine racemase 100.0
PRK12483 521 threonine dehydratase; Reviewed 100.0
PRK08526 403 threonine dehydratase; Provisional 100.0
PRK08639 420 threonine dehydratase; Validated 100.0
TIGR01127 380 ilvA_1Cterm threonine dehydratase, medium form. A 100.0
TIGR02079 409 THD1 threonine dehydratase. This model represents 100.0
PLN02550 591 threonine dehydratase 100.0
PRK06382 406 threonine dehydratase; Provisional 100.0
cd06447404 D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph 100.0
PRK08813349 threonine dehydratase; Provisional 100.0
PRK08198 404 threonine dehydratase; Provisional 100.0
PRK06608338 threonine dehydratase; Provisional 100.0
PRK07334 403 threonine dehydratase; Provisional 100.0
PRK07476322 eutB threonine dehydratase; Provisional 100.0
PRK08638333 threonine dehydratase; Validated 100.0
PRK06110322 hypothetical protein; Provisional 100.0
TIGR01124 499 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, 100.0
TIGR02991317 ectoine_eutB ectoine utilization protein EutB. Mem 100.0
PRK02991441 D-serine dehydratase; Provisional 100.0
PRK07048321 serine/threonine dehydratase; Validated 100.0
TIGR02035431 D_Ser_am_lyase D-serine ammonia-lyase. This family 100.0
PRK09224 504 threonine dehydratase; Reviewed 100.0
PRK06450338 threonine synthase; Validated 100.0
PRK06815317 hypothetical protein; Provisional 100.0
KOG1250 457 consensus Threonine/serine dehydratases [Amino aci 100.0
PRK08246310 threonine dehydratase; Provisional 100.0
PRK08329347 threonine synthase; Validated 100.0
PRK08197394 threonine synthase; Validated 100.0
cd01562304 Thr-dehyd Threonine dehydratase: The first step in 100.0
PRK06381319 threonine synthase; Validated 100.0
PRK06352351 threonine synthase; Validated 100.0
PRK07591421 threonine synthase; Validated 100.0
KOG1251323 consensus Serine racemase [Signal transduction mec 100.0
cd01563324 Thr-synth_1 Threonine synthase is a pyridoxal phos 100.0
PRK06721352 threonine synthase; Reviewed 100.0
PRK07409353 threonine synthase; Validated 100.0
KOG1481391 consensus Cysteine synthase [Amino acid transport 100.0
PLN02569484 threonine synthase 100.0
PRK06260397 threonine synthase; Validated 100.0
PRK08206399 diaminopropionate ammonia-lyase; Provisional 100.0
cd00640244 Trp-synth-beta_II Tryptophan synthase beta superfa 100.0
PRK05638 442 threonine synthase; Validated 100.0
TIGR03844398 cysteate_syn cysteate synthase. Members of this fa 100.0
TIGR01747376 diampropi_NH3ly diaminopropionate ammonia-lyase fa 100.0
TIGR00260328 thrC threonine synthase. Involved in threonine bio 100.0
TIGR03528396 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem 100.0
TIGR01415419 trpB_rel pyridoxal-phosphate dependent TrpB-like e 100.0
cd06449307 ACCD Aminocyclopropane-1-carboxylate deaminase (AC 100.0
TIGR01275311 ACC_deam_rel pyridoxal phosphate-dependent enzymes 100.0
cd06446365 Trp-synth_B Tryptophan synthase-beta: Trptophan sy 100.0
PRK13028402 tryptophan synthase subunit beta; Provisional 100.0
PRK12391427 tryptophan synthase subunit beta; Reviewed 100.0
PRK04346397 tryptophan synthase subunit beta; Validated 100.0
PF00291306 PALP: Pyridoxal-phosphate dependent enzyme; InterP 100.0
PLN02618410 tryptophan synthase, beta chain 100.0
TIGR00263385 trpB tryptophan synthase, beta subunit. Tryptophan 100.0
PRK03910331 D-cysteine desulfhydrase; Validated 100.0
PRK13802695 bifunctional indole-3-glycerol phosphate synthase/ 100.0
PRK12390337 1-aminocyclopropane-1-carboxylate deaminase; Provi 99.98
TIGR01274337 ACC_deam 1-aminocyclopropane-1-carboxylate deamina 99.97
PRK14045329 1-aminocyclopropane-1-carboxylate deaminase; Provi 99.97
PRK13803610 bifunctional phosphoribosylanthranilate isomerase/ 99.97
COG0498411 ThrC Threonine synthase [Amino acid transport and 99.96
PRK09225462 threonine synthase; Validated 99.87
COG0133396 TrpB Tryptophan synthase beta chain [Amino acid tr 99.87
cd01560460 Thr-synth_2 Threonine synthase catalyzes the final 99.85
KOG1395477 consensus Tryptophan synthase beta chain [Amino ac 99.8
COG2515323 Acd 1-aminocyclopropane-1-carboxylate deaminase [A 99.75
COG1350432 Predicted alternative tryptophan synthase beta-sub 99.75
COG3048443 DsdA D-serine dehydratase [Amino acid transport an 99.6
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 92.02
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 91.95
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.75
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 91.69
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 91.39
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 91.07
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 90.96
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 90.94
PRK10669558 putative cation:proton antiport protein; Provision 90.64
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 90.55
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 90.44
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 90.04
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 90.02
PRK10537393 voltage-gated potassium channel; Provisional 89.87
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 89.73
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 89.59
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 89.43
PLN02740381 Alcohol dehydrogenase-like 89.32
PRK03659601 glutathione-regulated potassium-efflux system prot 89.08
PRK09880343 L-idonate 5-dehydrogenase; Provisional 88.96
PLN02827378 Alcohol dehydrogenase-like 88.76
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 88.73
PRK03562621 glutathione-regulated potassium-efflux system prot 88.33
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 88.3
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 88.19
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 87.97
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 87.65
PRK05993 277 short chain dehydrogenase; Provisional 87.58
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 87.48
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 87.48
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 87.12
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 87.1
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 86.72
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 86.52
PRK12743256 oxidoreductase; Provisional 86.3
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 86.07
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 84.73
COG2130340 Putative NADP-dependent oxidoreductases [General f 84.55
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 84.43
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 84.1
PRK06057255 short chain dehydrogenase; Provisional 84.08
PRK08862227 short chain dehydrogenase; Provisional 84.05
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 83.34
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 83.32
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 83.08
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 82.93
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 82.87
PRK08177225 short chain dehydrogenase; Provisional 82.72
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 81.94
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 81.91
PRK06483236 dihydromonapterin reductase; Provisional 81.73
PRK08340259 glucose-1-dehydrogenase; Provisional 81.42
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 81.29
PRK07060245 short chain dehydrogenase; Provisional 80.87
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 80.56
KOG1197336 consensus Predicted quinone oxidoreductase [Energy 80.43
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 80.35
PRK05884223 short chain dehydrogenase; Provisional 80.18
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 80.09
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.09
PRK08643256 acetoin reductase; Validated 80.07
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.8e-52  Score=332.09  Aligned_cols=188  Identities=46%  Similarity=0.780  Sum_probs=178.0

Q ss_pred             CCCCCCchhhHHHHHHHHHHHHcCCCCCCCccceEEEeCCChHHHHHHHHHHHcCCcEEEEeCCCCCHHHHh--------
Q 038938            2 GLLDHPSTPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRM--------   73 (194)
Q Consensus         2 ~~~ptgS~K~R~a~~~~~~a~~~g~~~~g~~~~~vv~aSsGN~g~a~A~~a~~~Gl~~~iv~p~~~~~~k~~--------   73 (194)
                      ++||+||+|||.|++||.+|+++|.++||.+   +||+||||+|++||++|+.+|+|+++|||++++++|++        
T Consensus        34 ~~NP~gSvKDR~A~~mI~~Ae~~G~l~pG~t---IVE~TSGNTGI~LA~vaa~~Gy~~iivmP~~~S~er~~~l~a~GAe  110 (300)
T COG0031          34 SFNPGGSVKDRIALYMIEDAEKRGLLKPGGT---IVEATSGNTGIALAMVAAAKGYRLIIVMPETMSQERRKLLRALGAE  110 (300)
T ss_pred             hcCCCCchhHHHHHHHHHHHHHcCCCCCCCE---EEEcCCChHHHHHHHHHHHcCCcEEEEeCCCCCHHHHHHHHHcCCE
Confidence            4799999999999999999999999999998   99999999999999999999999999999999999888        


Q ss_pred             ----------------------hhcCC-eEecCCCCCCCchH---------HHHHcCCCCCEEEEecCCchhHHHHHHHH
Q 038938           74 ----------------------SKIPN-AYLLQQHENPANPK---------IWKDSGGKFDALVAGIRTGGTITGAEKFL  121 (194)
Q Consensus        74 ----------------------~~~~~-~~~~~~~~~~~~~~---------i~~q~~~~~d~vv~~vG~GGt~~Gi~~~l  121 (194)
                                            ++.++ +++++||+||.|++         ||+|+++++|+||+++|||||++|++++|
T Consensus       111 vi~t~~~~g~~~~a~~~a~el~~~~p~~~~~~~Qf~NpaN~~aH~~tT~~EI~~~~~g~~d~fVagvGTGGTitGvar~L  190 (300)
T COG0031         111 VILTPGAPGNMKGAIERAKELAAEIPGYAVWLNQFENPANPEAHYETTGPEIWQQTDGKVDAFVAGVGTGGTITGVARYL  190 (300)
T ss_pred             EEEcCCCCCchHHHHHHHHHHHHhCCCceEchhhcCCCccHHHHHhhhHHHHHHHhCCCCCEEEEeCCcchhHHHHHHHH
Confidence                                  34566 77888999999998         99999989999999999999999999999


Q ss_pred             HhhCCCceEEEEecCCcccccCCCCccccccccCCCCCccccccccCCcEEEeCCHHHHHHHHHHHHHhcCCC
Q 038938          122 KEKNLEMKVYGIESVESAVLNGGKPGLHLIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL  194 (194)
Q Consensus       122 ~~~~~~~~vigve~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~vd~~~~V~d~~e~~~a~~~la~~eGi~  194 (194)
                      |+.+|++++|+|||++|+.+..+. +++.++|++.+++|.+++.+.+|+++.|+| +|+++++|+|+++||||
T Consensus       191 k~~~p~i~iv~vdP~~S~~~~~G~-g~~~i~GIG~~~ip~~~~~~~iD~v~~V~d-~~A~~~~r~La~~eGil  261 (300)
T COG0031         191 KERNPNVRIVAVDPEGSVLLSGGE-GPHKIEGIGAGFVPENLDLDLIDEVIRVSD-EEAIATARRLAREEGLL  261 (300)
T ss_pred             HhhCCCcEEEEECCCCCcccCCCC-CCcccCCCCCCcCCcccccccCceEEEECH-HHHHHHHHHHHHHhCee
Confidence            999999999999999998887655 789999999999998889999999999999 99999999999999986

>PLN03013 cysteine synthase Back     alignment and domain information
>PLN02565 cysteine synthase Back     alignment and domain information
>TIGR01139 cysK cysteine synthase A Back     alignment and domain information
>PLN00011 cysteine synthase Back     alignment and domain information
>PLN02556 cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>PLN02356 phosphateglycerate kinase Back     alignment and domain information
>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01136 cysKM cysteine synthases Back     alignment and domain information
>PRK11761 cysM cysteine synthase B; Provisional Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B Back     alignment and domain information
>PRK10717 cysteine synthase A; Provisional Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>PLN02970 serine racemase Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>TIGR02079 THD1 threonine dehydratase Back     alignment and domain information
>PLN02550 threonine dehydratase Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia Back     alignment and domain information
>PRK08813 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06608 threonine dehydratase; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PRK07476 eutB threonine dehydratase; Provisional Back     alignment and domain information
>PRK08638 threonine dehydratase; Validated Back     alignment and domain information
>PRK06110 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>TIGR02991 ectoine_eutB ectoine utilization protein EutB Back     alignment and domain information
>PRK02991 D-serine dehydratase; Provisional Back     alignment and domain information
>PRK07048 serine/threonine dehydratase; Validated Back     alignment and domain information
>TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>PRK06815 hypothetical protein; Provisional Back     alignment and domain information
>KOG1250 consensus Threonine/serine dehydratases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08246 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08329 threonine synthase; Validated Back     alignment and domain information
>PRK08197 threonine synthase; Validated Back     alignment and domain information
>cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>PRK06352 threonine synthase; Validated Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] Back     alignment and domain information
>cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>PRK06721 threonine synthase; Reviewed Back     alignment and domain information
>PRK07409 threonine synthase; Validated Back     alignment and domain information
>KOG1481 consensus Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02569 threonine synthase Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PRK08206 diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family Back     alignment and domain information
>TIGR00260 thrC threonine synthase Back     alignment and domain information
>TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase Back     alignment and domain information
>TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme Back     alignment and domain information
>cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family Back     alignment and domain information
>cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>PRK13028 tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK12391 tryptophan synthase subunit beta; Reviewed Back     alignment and domain information
>PRK04346 tryptophan synthase subunit beta; Validated Back     alignment and domain information
>PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PLN02618 tryptophan synthase, beta chain Back     alignment and domain information
>TIGR00263 trpB tryptophan synthase, beta subunit Back     alignment and domain information
>PRK03910 D-cysteine desulfhydrase; Validated Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase Back     alignment and domain information
>PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09225 threonine synthase; Validated Back     alignment and domain information
>COG0133 TrpB Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>KOG1395 consensus Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1350 Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only] Back     alignment and domain information
>COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1z7y_A322 Crystal Structure Of The Arabidopsis Thaliana O-Ace 8e-38
1z7w_A322 Crystal Structure Of O-Acetylserine Sulfhydrylase F 9e-38
2isq_A320 Crystal Structure Of O-Acetylserine Sulfhydrylase F 1e-37
4aec_A430 Crystal Structure Of The Arabidopsis Thaliana O-Ace 1e-36
3vc3_A344 Crystal Structure Of Beta-Cyanoalanine Synthase K95 6e-29
3vbe_A344 Crystal Structure Of Beta-Cyanoalanine Synthase In 8e-29
4i1y_A314 The Structure Of Cysteine Synthase From Mycobacteri 8e-23
3rr2_A314 Structure Of A Cysteine Synthase (O-Acetylserine Su 8e-23
2q3b_A313 1.8 A Resolution Crystal Structure Of O-Acetylserin 1e-21
2q3d_A313 2.2 A Resolution Crystal Structure Of O-acetylserin 1e-21
2egu_A308 Crystal Structure Of O-Acetylserine Sulfhydrase Fro 3e-21
1ve1_A304 Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfh 4e-20
4air_A354 Leishmania Major Cysteine Synthase Length = 354 8e-19
3t4p_A334 Crystal Structure Of O-Acetyl Serine Sulfhydrylase 3e-18
1d6s_A322 Crystal Structure Of The K41a Mutant Of O-Acetylser 4e-18
1oas_A322 O-Acetylserine Sulfhydrylase From Salmonella Typhim 6e-18
3fca_A291 Genetic Incorporation Of A Metal-Ion Chelating Amin 1e-16
1o58_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase ( 1e-16
2bht_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase B 1e-14
2bhs_A303 Crystal Structure Of Cysteine Synthase B Length = 3 2e-14
2v03_A303 High Resolution Structure And Catalysis Of An O- Ac 2e-14
2jc3_A303 Structure Of O-acetylserine Sulfhydrylase B From Sa 2e-14
1y7l_A316 O-Acetylserine Sulfhydrylase Complex Length = 316 2e-14
1m54_A363 Cystathionine-Beta Synthase: Reduced Vicinal Thiols 6e-13
1jbq_A435 Structure Of Human Cystathionine Beta-Synthase: A U 1e-12
2pqm_A343 Crystal Structure Of Cysteine Synthase (Oass) From 6e-08
3bm5_A338 Crystal Structure Of O-Acetyl-Serine Sulfhydrylase 6e-08
3pc2_A 527 Full Length Structure Of Cystathionine Beta-Synthas 1e-07
3dwg_A325 Crystal Structure Of A Sulfur Carrier Protein Compl 2e-06
3dwi_A323 Crystal Structure Of Mycobacterium Tuberculosis Cys 2e-06
3dki_A326 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobac 2e-06
>pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine Sulfhydrylase K46a Mutant Length = 322 Back     alignment and structure 
Iteration: 1

 Score =  152 bits (385), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 123/225 (54%), Gaps = 41/225 (18%)
Query: 8   STPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTY 67
           S   RI  SMI DAE KG I PG+  +VL+E TS N G+GLA  A+++GYK+I+ MP + 
Sbjct: 44  SVADRIGFSMISDAEKKGLIKPGE--SVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASM 101
Query: 68  SIQRR-----------------------------MSKIPNAYLLQQHENPANPKI----- 93
           S +RR                             ++K PN Y+LQQ ENPANPKI     
Sbjct: 102 STERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETT 161
Query: 94  ----WKDSGGKFDALVAXXXXXXXXXXAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLH 149
               WK +GGK D  V+          A K+LKE+N  +K+YG+E VESA+L+GGKPG H
Sbjct: 162 GPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPH 221
Query: 150 LXXXXXXXXXPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL 194
                     P+VL++ ++DEV  V     + +  ++LALK GLL
Sbjct: 222 KIQGIGAGFIPSVLNVDLIDEVVQVSSDESI-DMARQLALKEGLL 265
>pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana Length = 322 Back     alignment and structure
>pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana In Complex With C-Terminal Peptide From Arabidopsis Serine Acetyltransferase Length = 320 Back     alignment and structure
>pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- Serine-(Thiol)-Lyase C Length = 430 Back     alignment and structure
>pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a Mutant In Soybean Length = 344 Back     alignment and structure
>pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean Length = 344 Back     alignment and structure
>pdb|4I1Y|A Chain A, The Structure Of Cysteine Synthase From Mycobacterium Ulcerans Agy99 Length = 314 Back     alignment and structure
>pdb|3RR2|A Chain A, Structure Of A Cysteine Synthase (O-Acetylserine Sulfhydrylase (Oass)) From Mycobacterium Marinum Atcc Baa-535 M Length = 314 Back     alignment and structure
>pdb|2Q3B|A Chain A, 1.8 A Resolution Crystal Structure Of O-Acetylserine Sulfhydrylase (Oass) Holoenzyme From Mycobacterium Tuberculosis Length = 313 Back     alignment and structure
>pdb|2Q3D|A Chain A, 2.2 A Resolution Crystal Structure Of O-acetylserine Sulfhydrylase (oass) From Mycobacterium Tuberculosis In Complex With The Reaction Intermediate Alpha-aminoacrylate Length = 313 Back     alignment and structure
>pdb|2EGU|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
>pdb|1VE1|A Chain A, Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfhydrylase Length = 304 Back     alignment and structure
>pdb|4AIR|A Chain A, Leishmania Major Cysteine Synthase Length = 354 Back     alignment and structure
>pdb|3T4P|A Chain A, Crystal Structure Of O-Acetyl Serine Sulfhydrylase From Leishmania Donovani In Complex With Designed Tetrapeptide Length = 334 Back     alignment and structure
>pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 Back     alignment and structure
>pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From Salmonella Typhimurium Length = 322 Back     alignment and structure
>pdb|3FCA|A Chain A, Genetic Incorporation Of A Metal-Ion Chelating Amino Acid Into Proteins As Biophysical Probe Length = 291 Back     alignment and structure
>pdb|1O58|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1.80 A Resolution Length = 303 Back     alignment and structure
>pdb|2BHT|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase B Length = 303 Back     alignment and structure
>pdb|2BHS|A Chain A, Crystal Structure Of Cysteine Synthase B Length = 303 Back     alignment and structure
>pdb|2V03|A Chain A, High Resolution Structure And Catalysis Of An O- Acetylserine Sulfhydrylase Length = 303 Back     alignment and structure
>pdb|2JC3|A Chain A, Structure Of O-acetylserine Sulfhydrylase B From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|1Y7L|A Chain A, O-Acetylserine Sulfhydrylase Complex Length = 316 Back     alignment and structure
>pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols Length = 363 Back     alignment and structure
>pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique Pyridoxal 5'- Phosphate Dependent Hemeprotein Length = 435 Back     alignment and structure
>pdb|2PQM|A Chain A, Crystal Structure Of Cysteine Synthase (Oass) From Entamoeba Histolytica At 1.86 A Resolution Length = 343 Back     alignment and structure
>pdb|3BM5|A Chain A, Crystal Structure Of O-Acetyl-Serine Sulfhydrylase From Entamoeba Histolytica In Complex With Cysteine Length = 338 Back     alignment and structure
>pdb|3PC2|A Chain A, Full Length Structure Of Cystathionine Beta-Synthase From Drosophila Length = 527 Back     alignment and structure
>pdb|3DWG|A Chain A, Crystal Structure Of A Sulfur Carrier Protein Complex Found In The Cysteine Biosynthetic Pathway Of Mycobacterium Tuberculosis Length = 325 Back     alignment and structure
>pdb|3DWI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cysm, The Cysteine Synthase B Length = 323 Back     alignment and structure
>pdb|3DKI|A Chain A, 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobacterium Tuberculosis An O-Phosphoserine Dependent Cysteine Synthase Length = 326 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 2e-78
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 3e-78
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 3e-77
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 3e-77
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 1e-76
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 3e-74
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 7e-73
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 3e-71
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 1e-69
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 3e-59
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 5e-58
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 5e-58
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 2e-57
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 8e-53
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Length = 322 Back     alignment and structure
 Score =  235 bits (603), Expect = 2e-78
 Identities = 106/221 (47%), Positives = 138/221 (62%), Gaps = 41/221 (18%)

Query: 12  RIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQR 71
           RI  SMI DAE KG I PG+  +VL+E TS N G+GLA  A+++GYK+I+ MP + S +R
Sbjct: 48  RIGFSMISDAEKKGLIKPGE--SVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTER 105

Query: 72  RM-----------------------------SKIPNAYLLQQHENPANPK---------I 93
           R+                             +K PN Y+LQQ ENPANPK         I
Sbjct: 106 RIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEI 165

Query: 94  WKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLHLIQG 153
           WK +GGK D  V+GI TGGTITGA K+LKE+N  +K+YG+E VESA+L+GGKPG H IQG
Sbjct: 166 WKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQG 225

Query: 154 IGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL 194
           IG G IP+VL++ ++DEV  V     + +  ++LALK GLL
Sbjct: 226 IGAGFIPSVLNVDLIDEVVQVSSDESI-DMARQLALKEGLL 265
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3t4p_A* 3spx_A* 4air_A* Length = 334 Back     alignment and structure
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Length = 430 Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Length = 313 Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Length = 304 Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Length = 343 Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Length = 308 Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Length = 316 Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Length = 303 Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Length = 303 Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3fgp_A* 3dki_A* 3dwi_A* Length = 325 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
3vc3_A344 Beta-cyanoalnine synthase; beta-cyanoalanine synth 100.0
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 100.0
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 100.0
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 100.0
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 100.0
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 100.0
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 100.0
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 100.0
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 100.0
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 100.0
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 100.0
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 100.0
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 100.0
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 100.0
3l6b_A346 Serine racemase; pyridoxal phosphate, PLP, isomera 100.0
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 100.0
4h27_A364 L-serine dehydratase/L-threonine deaminase; PLP de 100.0
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 100.0
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 100.0
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 100.0
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 100.0
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 100.0
3ss7_X442 D-serine dehydratase; type II fold, ALFA,beta-elim 100.0
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyas 100.0
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; H 100.0
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 100.0
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxa 100.0
1f2d_A341 1-aminocyclopropane-1-carboxylate deaminase; carbo 100.0
4d9i_A398 Diaminopropionate ammonia-lyase; fold type II PLP- 100.0
1j0a_A325 1-aminocyclopropane-1-carboxylate deaminase; PLP d 100.0
4d9b_A342 D-cysteine desulfhydrase; fold type II PLP-depende 100.0
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 100.0
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 100.0
1e5x_A486 Threonine synthase; threonine biosynthesis, PLP en 100.0
1v8z_A388 Tryptophan synthase beta chain 1; beta+alpha, rike 100.0
1x1q_A418 Tryptophan synthase beta chain; structural genomic 100.0
1qop_B396 Tryptophan synthase beta chain; lyase, carbon-oxyg 100.0
2o2e_A422 Tryptophan synthase beta chain; amino-acid biosynt 99.98
1vb3_A428 Threonine synthase; PLP-dependent enzyme, lyase; H 99.97
1kl7_A514 Threonine synthase; threonine synthesis, pyridoxal 99.96
4f4f_A468 Threonine synthase; structural genomics, niaid, na 99.95
3v7n_A487 Threonine synthase; ssgcid, structural genomics, s 99.94
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.3
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 94.69
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 94.45
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 94.06
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.02
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 93.72
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 93.48
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.43
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 93.39
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 93.32
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 92.9
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 92.65
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 92.42
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 92.21
4eye_A342 Probable oxidoreductase; structural genomics, niai 92.21
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 92.14
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 92.03
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 91.96
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 91.86
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 91.82
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 91.69
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 91.56
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 91.49
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 91.28
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 91.2
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 91.17
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 91.06
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 90.97
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.93
3gms_A340 Putative NADPH:quinone reductase; structural genom 90.91
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 90.88
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 90.7
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 90.58
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 90.44
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 90.41
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 90.39
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 89.9
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 89.7
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 89.67
3fbg_A346 Putative arginate lyase; structural genomics, unkn 89.5
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 89.18
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 89.04
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 89.03
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 88.9
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 88.65
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 88.64
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 88.58
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 88.41
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 88.04
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 87.51
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 87.18
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 86.61
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 86.49
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 85.69
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 85.66
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 85.16
3gem_A260 Short chain dehydrogenase; structural genomics, AP 85.1
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 85.0
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 84.91
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 84.53
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 84.52
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 84.47
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 84.24
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 83.87
3krt_A456 Crotonyl COA reductase; structural genomics, prote 83.62
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 83.44
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 82.3
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 82.19
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 82.17
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 82.02
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 82.01
1lnq_A336 MTHK channels, potassium channel related protein; 81.54
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 81.35
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 81.23
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 81.09
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 81.05
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 80.81
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 80.25
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 80.25
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 80.22
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 80.03
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 80.02
>3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-47  Score=317.04  Aligned_cols=190  Identities=45%  Similarity=0.772  Sum_probs=175.6

Q ss_pred             CCCCCCchhhHHHHHHHHHHHHcCCCCCCCccceEEEeCCChHHHHHHHHHHHcCCcEEEEeCCCCCHHHHh--------
Q 038938            2 GLLDHPSTPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRM--------   73 (194)
Q Consensus         2 ~~~ptgS~K~R~a~~~~~~a~~~g~~~~g~~~~~vv~aSsGN~g~a~A~~a~~~Gl~~~iv~p~~~~~~k~~--------   73 (194)
                      ++|||||||||+|+++|.+|+++|.+.+|.+  .||++||||||+|+|++|+++|++|+||||+++++.|+.        
T Consensus        58 ~lnptGSfK~RgA~~~i~~a~~~g~l~~g~~--~Vv~aSsGN~g~alA~~aa~~G~~~~IvmP~~~~~~k~~~~~~~GA~  135 (344)
T 3vc3_A           58 MMQPTASIADRPAYAMITDAEEKNLITPGKT--TLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAE  135 (344)
T ss_dssp             GGSTTSBTTHHHHHHHHHHHHHTTCCCTTTC--EEEEECSSHHHHHHHHHHHHHTCEEEEEEETTSCHHHHHHHHHTTCE
T ss_pred             CCCCCCCcHHHHHHHHHHHHHHcCCCCCCCC--EEEEeCCcHHHHHHHHHHHHcCCcEEEEECCCChHHHHHHHHHcCCE
Confidence            4799999999999999999999998888753  399999999999999999999999999999999998877        


Q ss_pred             ---------------------hhcCCeEecCCCCCCCchH---------HHHHcCCCCCEEEEecCCchhHHHHHHHHHh
Q 038938           74 ---------------------SKIPNAYLLQQHENPANPK---------IWKDSGGKFDALVAGIRTGGTITGAEKFLKE  123 (194)
Q Consensus        74 ---------------------~~~~~~~~~~~~~~~~~~~---------i~~q~~~~~d~vv~~vG~GGt~~Gi~~~l~~  123 (194)
                                           .+.+++++++||+||.++.         |++|+++.||+||+|+|+||+++|++.++|+
T Consensus       136 Vv~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~np~~~~a~~~t~g~EI~eq~~~~~d~vv~~vGgGG~~~Gi~~~~k~  215 (344)
T 3vc3_A          136 LILTDPAKGMGGTVKKAYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKS  215 (344)
T ss_dssp             EEEECGGGHHHHHHHHHHHHHHHSTTEECCCTTTCHHHHHHHHHTHHHHHHHHTTTCCCEEEEECSSSHHHHHHHHHHHH
T ss_pred             EEEECCCCcchHHHHHHHHHHhhccCceeccccccchhHHHHHHHHHHHHHHHhCCCceEEEEecCCccchHHHhhhhHh
Confidence                                 3567899999999997664         8999988999999999999999999999999


Q ss_pred             hCCCceEEEEecCCcccccCCCCccccccccCCCCCccccccccCCcEEEeCCHHHHHHHHHHHHHhcCCC
Q 038938          124 KNLEMKVYGIESVESAVLNGGKPGLHLIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL  194 (194)
Q Consensus       124 ~~~~~~vigve~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~vd~~~~V~d~~e~~~a~~~la~~eGi~  194 (194)
                      .+|+++||+|||.+++.+..+++.++.++|++....+...+...+|+++.|+| +|+++++++|+++|||+
T Consensus       216 ~~p~v~vigVep~~s~~l~~~~~~~~~i~g~g~~~~~~~~~~~~~d~~v~v~d-~eai~a~~~L~~~eGi~  285 (344)
T 3vc3_A          216 KNPNVKIYGVEPSESNVLNGGKPGPHHITGNGVGFKPDILDLDVMEKVLEVSS-EDAVNMARVLALKEGLM  285 (344)
T ss_dssp             HCTTCEEEEEEEGGGCGGGTCCCCCCSCTTSCCSSCCTTCCGGGCSEEEEECH-HHHHHHHHHHHHHHCCC
T ss_pred             hCCCceEEEEcCCCChhhcCCCCCCeeEecccccccCcccchhhceEEEEECH-HHHHHHHHHHHHHCCCE
Confidence            99999999999999999988888888899998887777788889999999999 99999999999999986
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* Back     alignment and structure
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Back     alignment and structure
>4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Back     alignment and structure
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* Back     alignment and structure
>4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Back     alignment and structure
>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* Back     alignment and structure
>1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... Back     alignment and structure
>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A Back     alignment and structure
>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Back     alignment and structure
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Back     alignment and structure
>4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} Back     alignment and structure
>3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 194
d1z7wa1320 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (C 3e-22
d1o58a_293 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 3e-22
d1ve1a1302 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (C 2e-17
d1fcja_302 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 7e-13
d1y7la1310 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (C 9e-13
d1jbqa_355 c.79.1.1 (A:) Cystathionine beta-synthase {Human ( 6e-10
d1wkva1382 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (C 3e-09
d2bhsa1292 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (C 2e-06
d1tdja1331 c.79.1.1 (A:5-335) Threonine deaminase {Escherichi 2e-05
d1v71a1318 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (S 9e-05
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 89.6 bits (221), Expect = 3e-22
 Identities = 101/221 (45%), Positives = 131/221 (59%), Gaps = 41/221 (18%)

Query: 12  RIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIV---------- 61
           RI  SMI DAE KG I PG+   VL+E TS N G+GLA  A+++GYK+I+          
Sbjct: 46  RIGFSMISDAEKKGLIKPGES--VLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTER 103

Query: 62  -------------------KMPNTYSIQRRMSKIPNAYLLQQHENPANPK---------I 93
                                      +  ++K PN Y+LQQ ENPANPK         I
Sbjct: 104 RIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEI 163

Query: 94  WKDSGGKFDALVAGIRTGGTITGAEKFLKEKNLEMKVYGIESVESAVLNGGKPGLHLIQG 153
           WK +GGK D  V+GI TGGTITGA K+LKE+N  +K+YG+E VESA+L+GGKPG H IQG
Sbjct: 164 WKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQG 223

Query: 154 IGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL 194
           IG G IP+VL++ ++DEV  V     + +  ++LALK GLL
Sbjct: 224 IGAGFIPSVLNVDLIDEVVQVSSDESI-DMARQLALKEGLL 263
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Length = 293 Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Length = 302 Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Length = 310 Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 382 Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Length = 331 Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1o58a_293 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1ve1a1302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 100.0
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1p5ja_319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 100.0
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 100.0
d1v71a1318 Hypothetical protein C320.14 (SPCC320.14, SPCC330. 100.0
d1ve5a1310 Threonine deaminase {Thermus thermophilus [TaxId: 100.0
d1v8za1386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 99.97
d1v7ca_351 Threonine synthase {Thermus thermophilus [TaxId: 2 99.97
d1qopb_390 Tryptophan synthase, beta-subunit {Salmonella typh 99.97
d1e5xa_477 Threonine synthase {Mouse-ear cress (Arabidopsis t 99.97
d1j0aa_325 1-aminocyclopropane-1-carboxylate deaminase {Archa 99.96
d1tyza_338 1-aminocyclopropane-1-carboxylate deaminase {Pseud 99.95
d1f2da_341 1-aminocyclopropane-1-carboxylate deaminase {Yeast 99.94
d1vb3a1428 Threonine synthase {Escherichia coli [TaxId: 562]} 99.52
d1kl7a_ 511 Threonine synthase {Baker's yeast (Saccharomyces c 97.97
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.77
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.58
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.45
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.38
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.38
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.08
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.05
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.85
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.66
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.58
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 95.58
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.43
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.4
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.39
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.37
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.18
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.17
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.17
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.04
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 94.85
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.68
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.64
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 94.62
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.35
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.69
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 93.27
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 92.83
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 91.86
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 91.52
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 90.18
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.02
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 89.91
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 89.43
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 89.06
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 88.72
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 88.6
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 87.33
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 87.24
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 86.84
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 86.78
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 86.68
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 86.27
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 86.06
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 85.88
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 85.69
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 85.57
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 85.38
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 85.34
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 84.75
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 84.73
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 84.56
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 84.27
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 84.18
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 84.18
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 84.16
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 84.14
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 84.02
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 83.6
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 83.52
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 83.48
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 83.13
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 82.51
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 82.45
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 81.97
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 81.83
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 81.81
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 81.19
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 80.95
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 80.61
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=6.2e-46  Score=302.09  Aligned_cols=190  Identities=56%  Similarity=0.924  Sum_probs=174.9

Q ss_pred             CCCCCCchhhHHHHHHHHHHHHcCCCCCCCccceEEEeCCChHHHHHHHHHHHcCCcEEEEeCCCCCHHHHh--------
Q 038938            2 GLLDHPSTPSRIACSMIKDAEDKGSISPGKQYNVLVEITSANAGIGLASIASSRGYKIIVKMPNTYSIQRRM--------   73 (194)
Q Consensus         2 ~~~ptgS~K~R~a~~~~~~a~~~g~~~~g~~~~~vv~aSsGN~g~a~A~~a~~~Gl~~~iv~p~~~~~~k~~--------   73 (194)
                      ++|||||||||+|.++|.+|+++|.+.++..  .||++||||||+|+|++|+++|++|+||+|+++++.|++        
T Consensus        36 ~~nptGSfKdRgA~~~i~~a~~~g~~~~~~~--~vv~aSsGN~g~a~A~~a~~~g~~~~iv~p~~~~~~k~~~i~~~Ga~  113 (320)
T d1z7wa1          36 MMEPCSSVKDRIGFSMISDAEKKGLIKPGES--VLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVE  113 (320)
T ss_dssp             GGSTTSBTHHHHHHHHHHHHHHTTSCCTTTC--EEEEECSSHHHHHHHHHHHHHTCEEEEEEETTSCHHHHHHHHHTTCE
T ss_pred             CCCCccCcHHHHHHHHHHHHHHcCCCCCCCc--eEEeeCCchHHHHHHHHHHhhccceEEeehhhhhhhhhhhhhccCcc
Confidence            5799999999999999999999998765533  399999999999999999999999999999999998877        


Q ss_pred             ---------------------hhcCCeEecCCCCCCCchH---------HHHHcCCCCCEEEEecCCchhHHHHHHHHHh
Q 038938           74 ---------------------SKIPNAYLLQQHENPANPK---------IWKDSGGKFDALVAGIRTGGTITGAEKFLKE  123 (194)
Q Consensus        74 ---------------------~~~~~~~~~~~~~~~~~~~---------i~~q~~~~~d~vv~~vG~GGt~~Gi~~~l~~  123 (194)
                                           .+.++++++++|+|+.|+.         |++|+.++||+||+|+|+||+++|++++|++
T Consensus       114 vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~g~~t~~~EI~~q~~~~~D~vv~~vGgGg~~~Gi~~~~k~  193 (320)
T d1z7wa1         114 LVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKE  193 (320)
T ss_dssp             EEEECGGGHHHHHHHHHHHHHHHCTTEEECCTTTCTHHHHHHHHTHHHHHHHHTTTCCCEEEEECSSSHHHHHHHHHHHH
T ss_pred             eEEeeccccccccchhHHHHHHhCCCceecccccccchHHHhhhhHHHHHHHhccCCCCEEEeCCCCCcccchhhhhhhh
Confidence                                 4567899999999998765         8999987899999999999999999999999


Q ss_pred             hCCCceEEEEecCCcccccCCCCccccccccCCCCCccccccccCCcEEEeCCHHHHHHHHHHHHHhcCCC
Q 038938          124 KNLEMKVYGIESVESAVLNGGKPGLHLIQGIGIGIIPTVLDIKMLDEVKTVLLCHVVTETTKRLALKGGLL  194 (194)
Q Consensus       124 ~~~~~~vigve~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~vd~~~~V~d~~e~~~a~~~la~~eGi~  194 (194)
                      .+|++++|+|||.+++.+......++.++|++.+.++..+....+|+++.|+| +|+++++++|+++|||+
T Consensus       194 ~~~~~~~igve~~~s~~~~~~~~~~~~~~gig~~~~~~~~~~~~id~~~~V~d-~e~~~a~~~l~~~eGi~  263 (320)
T d1z7wa1         194 QNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSS-DESIDMARQLALKEGLL  263 (320)
T ss_dssp             HCTTCEEEEEEEGGGCGGGTCCCCCCSCTTSCCSSCCTTCCGGGCSEEEEECH-HHHHHHHHHHHHHHSCC
T ss_pred             hhcceeeecccccCCccccCCCCCCceeeeccCCcCcchhhhhhcceeeccCH-HHHHHHHHHHHHHCCEE
Confidence            99999999999999998887777888899999988888888889999999999 99999999999999986
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Back     information, alignment and structure
>d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure