Citrus Sinensis ID: 038977
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 145 | ||||||
| 255557999 | 573 | AMP dependent CoA ligase, putative [Rici | 1.0 | 0.253 | 0.875 | 4e-68 | |
| 315419007 | 574 | 4CL [Gossypium hirsutum] | 0.986 | 0.249 | 0.888 | 1e-67 | |
| 253509565 | 573 | 4-coumarate:CoA ligase 1 [Gossypium hirs | 0.986 | 0.249 | 0.888 | 1e-67 | |
| 225454787 | 570 | PREDICTED: 4-coumarate--CoA ligase 2 [Vi | 0.986 | 0.250 | 0.874 | 2e-67 | |
| 371534669 | 570 | Coumaroyl-CoA ligase [Vitis vinifera] | 0.986 | 0.250 | 0.874 | 2e-67 | |
| 297737319 | 512 | unnamed protein product [Vitis vinifera] | 0.986 | 0.279 | 0.874 | 3e-67 | |
| 268528133 | 574 | 4-coumarate:CoA ligase 2 [Gossypium hirs | 0.986 | 0.249 | 0.874 | 5e-67 | |
| 166091746 | 583 | 4-coumarate:CoA ligase 1 [Ruta graveolen | 1.0 | 0.248 | 0.877 | 3e-66 | |
| 326366171 | 604 | 4-coumarate-CoA ligase [Prunus avium] | 0.993 | 0.238 | 0.840 | 4e-65 | |
| 164523614 | 582 | 4-coumarate CoA ligase 1 [Ruta graveolen | 1.0 | 0.249 | 0.863 | 1e-64 |
| >gi|255557999|ref|XP_002520028.1| AMP dependent CoA ligase, putative [Ricinus communis] gi|223540792|gb|EEF42352.1| AMP dependent CoA ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 262 bits (669), Expect = 4e-68, Method: Compositional matrix adjust.
Identities = 127/145 (87%), Positives = 137/145 (94%)
Query: 1 YLNDPEATAATIDVEGLLHTGDIGYVDHDDEVFIVDRVKEIIKFKGFQVPPAEIEALLLS 60
YLNDPEATA TIDVEG LHTGDIGYVD DDE+FIVDRVKEIIKFKGFQVPPAE+EALLL+
Sbjct: 429 YLNDPEATANTIDVEGWLHTGDIGYVDDDDEIFIVDRVKEIIKFKGFQVPPAELEALLLN 488
Query: 61 HPSIADATVVPQKDEVAGEVPVAFVVRSNGFELTEEAIKEYIAKQVVFYKRLHKVHFVHA 120
HPSIADA VVPQKDEVAGEVPVAFVVRSNGFEL+EE +KEYIAKQVVFYK+LHKV+F+HA
Sbjct: 489 HPSIADAAVVPQKDEVAGEVPVAFVVRSNGFELSEEDVKEYIAKQVVFYKKLHKVYFIHA 548
Query: 121 IPKSPSGKILRKDLIAKLASSMPLN 145
IPKSPSGKILRKDL AKLA+ PL+
Sbjct: 549 IPKSPSGKILRKDLKAKLATPSPLS 573
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|315419007|gb|ADU15550.1| 4CL [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|253509565|gb|ACT32027.1| 4-coumarate:CoA ligase 1 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|225454787|ref|XP_002274994.1| PREDICTED: 4-coumarate--CoA ligase 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|371534669|gb|AEX32786.1| Coumaroyl-CoA ligase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737319|emb|CBI26520.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|268528133|gb|ACZ06243.1| 4-coumarate:CoA ligase 2 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|166091746|gb|ABY81910.1| 4-coumarate:CoA ligase 1 [Ruta graveolens] | Back alignment and taxonomy information |
|---|
| >gi|326366171|gb|ADZ54779.1| 4-coumarate-CoA ligase [Prunus avium] | Back alignment and taxonomy information |
|---|
| >gi|164523614|gb|ABY60842.1| 4-coumarate CoA ligase 1 [Ruta graveolens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 145 | ||||||
| TAIR|locus:2015003 | 561 | 4CL3 "4-coumarate:CoA ligase 3 | 0.951 | 0.245 | 0.826 | 1.4e-57 | |
| TAIR|locus:2094771 | 570 | 4CL5 "4-coumarate:CoA ligase 5 | 0.951 | 0.242 | 0.717 | 1.4e-48 | |
| TAIR|locus:2017602 | 561 | 4CL1 "4-coumarate:CoA ligase 1 | 0.979 | 0.253 | 0.661 | 6e-48 | |
| TAIR|locus:2094716 | 556 | 4CL2 "4-coumarate:CoA ligase 2 | 0.979 | 0.255 | 0.647 | 2.6e-47 | |
| TAIR|locus:2115673 | 544 | AT4G05160 [Arabidopsis thalian | 0.979 | 0.261 | 0.563 | 4.6e-41 | |
| TAIR|locus:2034392 | 546 | OPCL1 "OPC-8:0 CoA ligase1" [A | 0.965 | 0.256 | 0.581 | 1.2e-40 | |
| TAIR|locus:2034403 | 550 | AT1G20500 [Arabidopsis thalian | 0.965 | 0.254 | 0.546 | 1.1e-37 | |
| TAIR|locus:2034423 | 565 | AT1G20480 [Arabidopsis thalian | 0.965 | 0.247 | 0.560 | 1.3e-36 | |
| TAIR|locus:2015499 | 542 | ACOS5 "acyl-CoA synthetase 5" | 0.965 | 0.258 | 0.55 | 7.2e-36 | |
| TAIR|locus:2158559 | 562 | AT5G63380 [Arabidopsis thalian | 0.951 | 0.245 | 0.517 | 4.2e-35 |
| TAIR|locus:2015003 4CL3 "4-coumarate:CoA ligase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 592 (213.5 bits), Expect = 1.4e-57, P = 1.4e-57
Identities = 114/138 (82%), Positives = 127/138 (92%)
Query: 1 YLNDPEATAATIDVEGLLHTGDIGYVDHDDEVFIVDRVKEIIKFKGFQVPPAEIEALLLS 60
YLNDPEAT+ATID EG LHTGDIGYVD DDE+FIVDR+KE+IKFKGFQVPPAE+E+LL++
Sbjct: 423 YLNDPEATSATIDEEGWLHTGDIGYVDEDDEIFIVDRLKEVIKFKGFQVPPAELESLLIN 482
Query: 61 HPSIADATVVPQKDEVAGEVPVAFVVRSNGFELTEEAIKEYIAKQVVFYKRLHKVHFVHA 120
H SIADA VVPQ DEVAGEVPVAFVVRSNG ++TEE +KEY+AKQVVFYKRLHKV FV +
Sbjct: 483 HHSIADAAVVPQNDEVAGEVPVAFVVRSNGNDITEEDVKEYVAKQVVFYKRLHKVFFVAS 542
Query: 121 IPKSPSGKILRKDLIAKL 138
IPKSPSGKILRKDL AKL
Sbjct: 543 IPKSPSGKILRKDLKAKL 560
|
|
| TAIR|locus:2094771 4CL5 "4-coumarate:CoA ligase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2017602 4CL1 "4-coumarate:CoA ligase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094716 4CL2 "4-coumarate:CoA ligase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115673 AT4G05160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034392 OPCL1 "OPC-8:0 CoA ligase1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034403 AT1G20500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034423 AT1G20480 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015499 ACOS5 "acyl-CoA synthetase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2158559 AT5G63380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 145 | |||
| PLN02246 | 537 | PLN02246, PLN02246, 4-coumarate--CoA ligase | 2e-99 | |
| cd05904 | 504 | cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) | 1e-83 | |
| cd05911 | 487 | cd05911, Firefly_Luc_like, Firefly luciferase of l | 2e-65 | |
| PLN02574 | 560 | PLN02574, PLN02574, 4-coumarate--CoA ligase-like | 2e-57 | |
| PLN02330 | 546 | PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 | 4e-52 | |
| cd05917 | 347 | cd05917, FACL_like_2, Uncharacterized subfamily of | 1e-48 | |
| COG0318 | 534 | COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ | 9e-48 | |
| cd05936 | 468 | cd05936, FC-FACS_FadD_like, Prokaryotic long-chain | 2e-46 | |
| PRK06187 | 521 | PRK06187, PRK06187, long-chain-fatty-acid--CoA lig | 8e-45 | |
| PRK07656 | 513 | PRK07656, PRK07656, long-chain-fatty-acid--CoA lig | 3e-43 | |
| cd05929 | 342 | cd05929, BACL_like, Bacterial Bile acid CoA ligase | 2e-42 | |
| cd04433 | 338 | cd04433, AFD_class_I, Adenylate forming domain, Cl | 1e-41 | |
| cd05935 | 430 | cd05935, LC_FACS_like, Putative long-chain fatty a | 4e-40 | |
| cd05912 | 407 | cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase | 2e-38 | |
| cd05926 | 345 | cd05926, FACL_fum10p_like, Subfamily of fatty acid | 3e-36 | |
| PRK03640 | 483 | PRK03640, PRK03640, O-succinylbenzoic acid--CoA li | 1e-34 | |
| cd05922 | 350 | cd05922, FACL_like_6, Uncharacterized subfamily of | 1e-33 | |
| cd05934 | 421 | cd05934, FACL_DitJ_like, Uncharacterized subfamily | 5e-32 | |
| PRK06178 | 567 | PRK06178, PRK06178, acyl-CoA synthetase; Validated | 3e-31 | |
| PRK07059 | 557 | PRK07059, PRK07059, Long-chain-fatty-acid--CoA lig | 4e-31 | |
| cd12119 | 517 | cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth | 1e-30 | |
| COG0365 | 528 | COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat | 2e-30 | |
| cd05972 | 430 | cd05972, MACS_like, Medium-chain acyl-CoA syntheta | 6e-30 | |
| cd05920 | 483 | cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l | 2e-29 | |
| PRK08314 | 546 | PRK08314, PRK08314, long-chain-fatty-acid--CoA lig | 2e-29 | |
| cd05941 | 430 | cd05941, MCS, Malonyl-CoA synthetase (MCS) | 9e-29 | |
| PRK05605 | 573 | PRK05605, PRK05605, long-chain-fatty-acid--CoA lig | 1e-28 | |
| PRK08315 | 559 | PRK08315, PRK08315, AMP-binding domain protein; Va | 2e-28 | |
| cd05971 | 439 | cd05971, MACS_like_3, Uncharacterized subfamily of | 5e-28 | |
| PRK08008 | 517 | PRK08008, caiC, putative crotonobetaine/carnitine- | 5e-28 | |
| cd05903 | 437 | cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li | 6e-28 | |
| cd05969 | 443 | cd05969, MACS_like_4, Uncharacterized subfamily of | 7e-28 | |
| cd05974 | 433 | cd05974, MACS_like_1, Uncharacterized subfamily of | 7e-28 | |
| PRK05677 | 562 | PRK05677, PRK05677, long-chain-fatty-acid--CoA lig | 1e-27 | |
| cd12118 | 520 | cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt | 4e-27 | |
| PRK12492 | 562 | PRK12492, PRK12492, long-chain-fatty-acid--CoA lig | 6e-27 | |
| PRK07787 | 471 | PRK07787, PRK07787, acyl-CoA synthetase; Validated | 6e-27 | |
| PRK12583 | 558 | PRK12583, PRK12583, acyl-CoA synthetase; Provision | 1e-26 | |
| PRK08316 | 523 | PRK08316, PRK08316, acyl-CoA synthetase; Validated | 4e-26 | |
| PRK07470 | 528 | PRK07470, PRK07470, acyl-CoA synthetase; Validated | 5e-26 | |
| PRK08974 | 560 | PRK08974, PRK08974, long-chain-fatty-acid--CoA lig | 1e-25 | |
| cd05944 | 359 | cd05944, FACL_like_4, Uncharacterized subfamily of | 2e-25 | |
| TIGR01923 | 436 | TIGR01923, menE, O-succinylbenzoate-CoA ligase | 2e-25 | |
| cd05959 | 506 | cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and | 3e-25 | |
| pfam00501 | 412 | pfam00501, AMP-binding, AMP-binding enzyme | 3e-25 | |
| cd05967 | 607 | cd05967, PrpE, Propionyl-CoA synthetase (PrpE) | 4e-25 | |
| PRK07786 | 542 | PRK07786, PRK07786, long-chain-fatty-acid--CoA lig | 2e-24 | |
| cd05928 | 530 | cd05928, MACS_euk, Eukaryotic Medium-chain acyl-Co | 2e-24 | |
| PRK08751 | 560 | PRK08751, PRK08751, putative long-chain fatty acyl | 3e-24 | |
| PRK09088 | 488 | PRK09088, PRK09088, acyl-CoA synthetase; Validated | 4e-24 | |
| PRK07788 | 549 | PRK07788, PRK07788, acyl-CoA synthetase; Validated | 4e-24 | |
| PRK06839 | 496 | PRK06839, PRK06839, acyl-CoA synthetase; Validated | 2e-23 | |
| PRK06188 | 524 | PRK06188, PRK06188, acyl-CoA synthetase; Validated | 3e-23 | |
| PRK06710 | 563 | PRK06710, PRK06710, long-chain-fatty-acid--CoA lig | 3e-23 | |
| cd05970 | 537 | cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA s | 3e-23 | |
| cd05919 | 436 | cd05919, BCL_like, Benzoate CoA ligase (BCL) and s | 4e-23 | |
| PRK12406 | 509 | PRK12406, PRK12406, long-chain-fatty-acid--CoA lig | 8e-23 | |
| PRK06087 | 547 | PRK06087, PRK06087, short chain acyl-CoA synthetas | 2e-22 | |
| cd05973 | 440 | cd05973, MACS_like_2, Uncharacterized subfamily of | 4e-22 | |
| PRK13383 | 516 | PRK13383, PRK13383, acyl-CoA synthetase; Provision | 5e-22 | |
| cd05968 | 474 | cd05968, AACS_like, Uncharacterized acyl-CoA synth | 5e-22 | |
| PRK06145 | 497 | PRK06145, PRK06145, acyl-CoA synthetase; Validated | 7e-22 | |
| PRK07529 | 632 | PRK07529, PRK07529, AMP-binding domain protein; Va | 1e-21 | |
| PRK08276 | 502 | PRK08276, PRK08276, long-chain-fatty-acid--CoA lig | 1e-21 | |
| PRK06164 | 540 | PRK06164, PRK06164, acyl-CoA synthetase; Validated | 2e-21 | |
| cd05907 | 456 | cd05907, VL_LC_FACS_like, Long-chain fatty acid Co | 2e-21 | |
| cd05930 | 445 | cd05930, A_NRPS, The adenylation domain of nonribo | 3e-21 | |
| cd05945 | 447 | cd05945, DltA, D-alanine:D-alanyl carrier protein | 4e-21 | |
| TIGR02188 | 625 | TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase | 4e-21 | |
| cd05966 | 602 | cd05966, ACS, Acetyl-CoA synthetase (also known as | 8e-21 | |
| PRK07638 | 487 | PRK07638, PRK07638, acyl-CoA synthetase; Validated | 1e-20 | |
| PRK08162 | 545 | PRK08162, PRK08162, acyl-CoA synthetase; Validated | 2e-20 | |
| cd05923 | 495 | cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) | 3e-20 | |
| cd12117 | 474 | cd12117, A_NRPS_Srf_like, The adenylation domain o | 5e-20 | |
| PRK13382 | 537 | PRK13382, PRK13382, acyl-CoA synthetase; Provision | 5e-20 | |
| cd12115 | 449 | cd12115, A_NRPS_Sfm_like, The adenylation domain o | 6e-20 | |
| PRK13295 | 547 | PRK13295, PRK13295, cyclohexanecarboxylate-CoA lig | 2e-19 | |
| COG1021 | 542 | COG1021, EntE, Peptide arylation enzymes [Secondar | 4e-19 | |
| TIGR03205 | 541 | TIGR03205, pimA, dicarboxylate--CoA ligase PimA | 8e-19 | |
| PRK10524 | 629 | PRK10524, prpE, propionyl-CoA synthetase; Provisio | 1e-18 | |
| PRK08308 | 414 | PRK08308, PRK08308, acyl-CoA synthetase; Validated | 1e-18 | |
| PRK13391 | 511 | PRK13391, PRK13391, acyl-CoA synthetase; Provision | 2e-18 | |
| PRK07514 | 504 | PRK07514, PRK07514, malonyl-CoA synthase; Validate | 2e-18 | |
| PRK00174 | 637 | PRK00174, PRK00174, acetyl-CoA synthetase; Provisi | 4e-18 | |
| TIGR03208 | 538 | TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate | 5e-18 | |
| COG1022 | 613 | COG1022, FAA1, Long-chain acyl-CoA synthetases (AM | 1e-17 | |
| cd12116 | 438 | cd12116, A_NRPS_Ta1_like, The adenylation domain o | 1e-17 | |
| cd12114 | 476 | cd12114, A_NRPS_TlmIV_like, The adenylation domain | 1e-17 | |
| cd05932 | 504 | cd05932, LC_FACS_bac, Bacterial long-chain fatty a | 1e-17 | |
| cd05958 | 487 | cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) | 3e-17 | |
| PRK06155 | 542 | PRK06155, PRK06155, crotonobetaine/carnitine-CoA l | 3e-17 | |
| cd05931 | 547 | cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | 3e-17 | |
| PLN03102 | 579 | PLN03102, PLN03102, acyl-activating enzyme; Provis | 3e-17 | |
| PRK04319 | 570 | PRK04319, PRK04319, acetyl-CoA synthetase; Provisi | 4e-17 | |
| cd05915 | 509 | cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetase | 5e-17 | |
| PRK07798 | 533 | PRK07798, PRK07798, acyl-CoA synthetase; Validated | 1e-16 | |
| TIGR02275 | 526 | TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP | 1e-16 | |
| cd05924 | 365 | cd05924, FACL_like_5, Uncharacterized subfamily of | 1e-16 | |
| TIGR02316 | 628 | TIGR02316, propion_prpE, propionate--CoA ligase | 2e-16 | |
| PLN02479 | 567 | PLN02479, PLN02479, acetate-CoA ligase | 2e-16 | |
| TIGR02262 | 508 | TIGR02262, benz_CoA_lig, benzoate-CoA ligase famil | 2e-16 | |
| cd05918 | 447 | cd05918, A_NRPS_SidN3_like, The adenylation (A) do | 4e-16 | |
| PRK13390 | 501 | PRK13390, PRK13390, acyl-CoA synthetase; Provision | 6e-16 | |
| PLN02654 | 666 | PLN02654, PLN02654, acetate-CoA ligase | 9e-16 | |
| PRK10946 | 536 | PRK10946, entE, enterobactin synthase subunit E; P | 2e-15 | |
| TIGR03098 | 517 | TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-form | 3e-15 | |
| PRK07445 | 452 | PRK07445, PRK07445, O-succinylbenzoic acid--CoA li | 4e-15 | |
| PRK07867 | 529 | PRK07867, PRK07867, acyl-CoA synthetase; Validated | 1e-14 | |
| PRK06018 | 542 | PRK06018, PRK06018, putative acyl-CoA synthetase; | 5e-14 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 1e-13 | |
| PRK07008 | 539 | PRK07008, PRK07008, long-chain-fatty-acid--CoA lig | 2e-13 | |
| PLN02860 | 563 | PLN02860, PLN02860, o-succinylbenzoate-CoA ligase | 2e-13 | |
| PRK05852 | 534 | PRK05852, PRK05852, acyl-CoA synthetase; Validated | 4e-13 | |
| cd05927 | 539 | cd05927, LC-FACS_euk, Eukaryotic long-chain fatty | 5e-13 | |
| PRK13388 | 540 | PRK13388, PRK13388, acyl-CoA synthetase; Provision | 5e-13 | |
| cd05933 | 594 | cd05933, ACSBG_like, Bubblegum-like very long-chai | 5e-13 | |
| PRK04813 | 503 | PRK04813, PRK04813, D-alanine--poly(phosphoribitol | 2e-12 | |
| cd05906 | 560 | cd05906, A_NRPS_TubE_like, The adenylation domain | 3e-12 | |
| TIGR01733 | 409 | TIGR01733, AA-adenyl-dom, amino acid adenylation d | 2e-11 | |
| cd05908 | 499 | cd05908, A_NRPS_MycA_like, The adenylation domain | 3e-11 | |
| PRK09192 | 579 | PRK09192, PRK09192, acyl-CoA synthetase; Validated | 3e-11 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 4e-11 | |
| TIGR01734 | 502 | TIGR01734, D-ala-DACP-lig, D-alanine--poly(phospho | 4e-11 | |
| PTZ00237 | 647 | PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisi | 8e-11 | |
| PRK05620 | 576 | PRK05620, PRK05620, long-chain-fatty-acid--CoA lig | 8e-11 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 1e-10 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 2e-10 | |
| cd05909 | 489 | cd05909, AAS_C, C-terminal domain of the acyl-acyl | 2e-10 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 6e-10 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 7e-10 | |
| PRK07824 | 358 | PRK07824, PRK07824, O-succinylbenzoic acid--CoA li | 9e-10 | |
| PRK07768 | 545 | PRK07768, PRK07768, long-chain-fatty-acid--CoA lig | 1e-09 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 2e-09 | |
| PRK08633 | 1146 | PRK08633, PRK08633, 2-acyl-glycerophospho-ethanola | 4e-09 | |
| PRK10252 | 1296 | PRK10252, entF, enterobactin synthase subunit F; P | 4e-08 | |
| cd05940 | 444 | cd05940, FATP_FACS, Fatty acid transport proteins | 4e-08 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 5e-08 | |
| cd05910 | 455 | cd05910, FACL_like_1, Uncharacterized subfamily of | 8e-08 | |
| COG1020 | 642 | COG1020, EntF, Non-ribosomal peptide synthetase mo | 9e-08 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 7e-07 | |
| cd05914 | 448 | cd05914, FACL_like_3, Uncharacterized subfamily of | 7e-07 | |
| PRK09029 | 458 | PRK09029, PRK09029, O-succinylbenzoic acid--CoA li | 8e-07 | |
| PRK06060 | 705 | PRK06060, PRK06060, acyl-CoA synthetase; Validated | 1e-06 | |
| PRK05857 | 540 | PRK05857, PRK05857, acyl-CoA synthetase; Validated | 1e-06 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 5e-06 | |
| PTZ00216 | 700 | PTZ00216, PTZ00216, acyl-CoA synthetase; Provision | 9e-06 | |
| pfam13193 | 43 | pfam13193, DUF4009, Domain of unknown function (DU | 2e-05 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 3e-05 | |
| PLN02736 | 651 | PLN02736, PLN02736, long-chain acyl-CoA synthetase | 9e-05 | |
| PRK05851 | 525 | PRK05851, PRK05851, long-chain-fatty-acid--[acyl-c | 1e-04 | |
| cd05937 | 468 | cd05937, FATP_chFAT1_like, Uncharacterized subfami | 1e-04 | |
| PRK08279 | 600 | PRK08279, PRK08279, long-chain-acyl-CoA synthetase | 2e-04 | |
| cd05943 | 616 | cd05943, AACS, Acetoacetyl-CoA synthetase (acetoac | 4e-04 | |
| TIGR02372 | 386 | TIGR02372, 4_coum_CoA_lig, 4-coumarate--CoA ligase | 0.003 |
| >gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
Score = 294 bits (756), Expect = 2e-99
Identities = 111/140 (79%), Positives = 128/140 (91%)
Query: 1 YLNDPEATAATIDVEGLLHTGDIGYVDHDDEVFIVDRVKEIIKFKGFQVPPAEIEALLLS 60
YLNDPEATA TID +G LHTGDIGY+D DDE+FIVDR+KE+IK+KGFQV PAE+EALL+S
Sbjct: 397 YLNDPEATANTIDKDGWLHTGDIGYIDDDDELFIVDRLKELIKYKGFQVAPAELEALLIS 456
Query: 61 HPSIADATVVPQKDEVAGEVPVAFVVRSNGFELTEEAIKEYIAKQVVFYKRLHKVHFVHA 120
HPSIADA VVP KDEVAGEVPVAFVVRSNG E+TE+ IK+++AKQVVFYKR+HKV FV +
Sbjct: 457 HPSIADAAVVPMKDEVAGEVPVAFVVRSNGSEITEDEIKQFVAKQVVFYKRIHKVFFVDS 516
Query: 121 IPKSPSGKILRKDLIAKLAS 140
IPK+PSGKILRKDL AKLA+
Sbjct: 517 IPKAPSGKILRKDLRAKLAA 536
|
Length = 537 |
| >gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) | Back alignment and domain information |
|---|
| >gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) | Back alignment and domain information |
|---|
| >gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD | Back alignment and domain information |
|---|
| >gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I | Back alignment and domain information |
|---|
| >gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) | Back alignment and domain information |
|---|
| >gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis | Back alignment and domain information |
|---|
| >gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235923 PRK07059, PRK07059, Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles | Back alignment and domain information |
|---|
| >gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) | Back alignment and domain information |
|---|
| >gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) | Back alignment and domain information |
|---|
| >gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) | Back alignment and domain information |
|---|
| >gnl|CDD|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS) | Back alignment and domain information |
|---|
| >gnl|CDD|213321 cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|168170 PRK05677, PRK05677, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis | Back alignment and domain information |
|---|
| >gnl|CDD|171539 PRK12492, PRK12492, long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236096 PRK07787, PRK07787, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213312 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase) | Back alignment and domain information |
|---|
| >gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|213314 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) | Back alignment and domain information |
|---|
| >gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213294 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM) | Back alignment and domain information |
|---|
| >gnl|CDD|181546 PRK08751, PRK08751, putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213317 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like | Back alignment and domain information |
|---|
| >gnl|CDD|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|183506 PRK12406, PRK12406, long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180393 PRK06087, PRK06087, short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) | Back alignment and domain information |
|---|
| >gnl|CDD|139531 PRK13383, PRK13383, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213315 cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235722 PRK06164, PRK06164, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) | Back alignment and domain information |
|---|
| >gnl|CDD|233770 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213313 cd05966, ACS, Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme) | Back alignment and domain information |
|---|
| >gnl|CDD|236071 PRK07638, PRK07638, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236169 PRK08162, PRK08162, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213290 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) | Back alignment and domain information |
|---|
| >gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) | Back alignment and domain information |
|---|
| >gnl|CDD|172019 PRK13382, PRK13382, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213323 cd12115, A_NRPS_Sfm_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Saframycin A gene cluster from Streptomyces lavendulae | Back alignment and domain information |
|---|
| >gnl|CDD|171961 PRK13295, PRK13295, cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223952 COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132249 TIGR03205, pimA, dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >gnl|CDD|182517 PRK10524, prpE, propionyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236231 PRK08308, PRK08308, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234677 PRK00174, PRK00174, acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132252 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes | Back alignment and domain information |
|---|
| >gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|213311 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) | Back alignment and domain information |
|---|
| >gnl|CDD|235719 PRK06155, PRK06155, crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | Back alignment and domain information |
|---|
| >gnl|CDD|215576 PLN03102, PLN03102, acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235279 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213283 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles | Back alignment and domain information |
|---|
| >gnl|CDD|236100 PRK07798, PRK07798, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233807 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213291 cd05924, FACL_like_5, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|131369 TIGR02316, propion_prpE, propionate--CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|178097 PLN02479, PLN02479, acetate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|233803 TIGR02262, benz_CoA_lig, benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|139538 PRK13390, PRK13390, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215353 PLN02654, PLN02654, acetate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|236803 PRK10946, entE, enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211788 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-forming), exosortase A-associated | Back alignment and domain information |
|---|
| >gnl|CDD|236019 PRK07445, PRK07445, O-succinylbenzoic acid--CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236120 PRK07867, PRK07867, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235673 PRK06018, PRK06018, putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235908 PRK07008, PRK07008, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215464 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) | Back alignment and domain information |
|---|
| >gnl|CDD|237374 PRK13388, PRK13388, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) | Back alignment and domain information |
|---|
| >gnl|CDD|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents | Back alignment and domain information |
|---|
| >gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain | Back alignment and domain information |
|---|
| >gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) | Back alignment and domain information |
|---|
| >gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233551 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
| >gnl|CDD|240325 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180167 PRK05620, PRK05620, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236108 PRK07824, PRK07824, O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236091 PRK07768, PRK07768, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236315 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236668 PRK10252, entF, enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213278 cd05910, FACL_like_1, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213282 cd05914, FACL_like_3, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|236363 PRK09029, PRK09029, O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180374 PRK06060, PRK06060, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180293 PRK05857, PRK05857, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240316 PTZ00216, PTZ00216, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221971 pfam13193, DUF4009, Domain of unknown function (DUF4009) | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|180289 PRK05851, PRK05851, long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi | Back alignment and domain information |
|---|
| >gnl|CDD|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213308 cd05943, AACS, Acetoacetyl-CoA synthetase (acetoacetate-CoA ligase, AACS) | Back alignment and domain information |
|---|
| >gnl|CDD|131425 TIGR02372, 4_coum_CoA_lig, 4-coumarate--CoA ligase, photoactive yellow protein activation family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| KOG1176 | 537 | consensus Acyl-CoA synthetase [Lipid transport and | 100.0 | |
| COG0318 | 534 | CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l | 100.0 | |
| KOG1177 | 596 | consensus Long chain fatty acid acyl-CoA ligase [L | 100.0 | |
| COG0365 | 528 | Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l | 99.97 | |
| PTZ00237 | 647 | acetyl-CoA synthetase; Provisional | 99.97 | |
| PLN02654 | 666 | acetate-CoA ligase | 99.97 | |
| PLN02574 | 560 | 4-coumarate--CoA ligase-like | 99.97 | |
| TIGR01217 | 652 | ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym | 99.97 | |
| PRK05677 | 562 | long-chain-fatty-acid--CoA ligase; Validated | 99.97 | |
| PLN02860 | 563 | o-succinylbenzoate-CoA ligase | 99.97 | |
| TIGR02188 | 625 | Ac_CoA_lig_AcsA acetate--CoA ligase. This model de | 99.97 | |
| PRK07824 | 358 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.97 | |
| PLN03102 | 579 | acyl-activating enzyme; Provisional | 99.97 | |
| PRK00174 | 637 | acetyl-CoA synthetase; Provisional | 99.97 | |
| PRK05852 | 534 | acyl-CoA synthetase; Validated | 99.97 | |
| PRK09088 | 488 | acyl-CoA synthetase; Validated | 99.97 | |
| PRK03584 | 655 | acetoacetyl-CoA synthetase; Provisional | 99.97 | |
| TIGR02316 | 628 | propion_prpE propionate--CoA ligase. This family c | 99.97 | |
| PRK07445 | 452 | O-succinylbenzoic acid--CoA ligase; Reviewed | 99.97 | |
| PLN02246 | 537 | 4-coumarate--CoA ligase | 99.97 | |
| PRK07867 | 529 | acyl-CoA synthetase; Validated | 99.97 | |
| PRK06839 | 496 | acyl-CoA synthetase; Validated | 99.96 | |
| KOG1175 | 626 | consensus Acyl-CoA synthetase [Lipid transport and | 99.96 | |
| PRK07470 | 528 | acyl-CoA synthetase; Validated | 99.96 | |
| PRK04319 | 570 | acetyl-CoA synthetase; Provisional | 99.96 | |
| PRK13388 | 540 | acyl-CoA synthetase; Provisional | 99.96 | |
| PRK07529 | 632 | AMP-binding domain protein; Validated | 99.96 | |
| PRK06155 | 542 | crotonobetaine/carnitine-CoA ligase; Provisional | 99.96 | |
| PRK08008 | 517 | caiC putative crotonobetaine/carnitine-CoA ligase; | 99.96 | |
| PLN02330 | 546 | 4-coumarate--CoA ligase-like 1 | 99.96 | |
| PRK05605 | 573 | long-chain-fatty-acid--CoA ligase; Validated | 99.96 | |
| PRK06145 | 497 | acyl-CoA synthetase; Validated | 99.96 | |
| PRK09274 | 552 | peptide synthase; Provisional | 99.96 | |
| PRK07514 | 504 | malonyl-CoA synthase; Validated | 99.96 | |
| PRK07788 | 549 | acyl-CoA synthetase; Validated | 99.96 | |
| PRK06164 | 540 | acyl-CoA synthetase; Validated | 99.96 | |
| PRK08315 | 559 | AMP-binding domain protein; Validated | 99.96 | |
| PRK08316 | 523 | acyl-CoA synthetase; Validated | 99.96 | |
| PRK10524 | 629 | prpE propionyl-CoA synthetase; Provisional | 99.96 | |
| COG1021 | 542 | EntE Peptide arylation enzymes [Secondary metaboli | 99.96 | |
| PRK06060 | 705 | acyl-CoA synthetase; Validated | 99.96 | |
| PRK08314 | 546 | long-chain-fatty-acid--CoA ligase; Validated | 99.96 | |
| PRK12583 | 558 | acyl-CoA synthetase; Provisional | 99.96 | |
| PRK05620 | 576 | long-chain-fatty-acid--CoA ligase; Validated | 99.96 | |
| PRK10946 | 536 | entE enterobactin synthase subunit E; Provisional | 99.96 | |
| PLN03051 | 499 | acyl-activating enzyme; Provisional | 99.96 | |
| PRK06178 | 567 | acyl-CoA synthetase; Validated | 99.96 | |
| PRK07787 | 471 | acyl-CoA synthetase; Validated | 99.96 | |
| PRK07798 | 533 | acyl-CoA synthetase; Validated | 99.96 | |
| PRK06710 | 563 | long-chain-fatty-acid--CoA ligase; Validated | 99.96 | |
| PRK07638 | 487 | acyl-CoA synthetase; Validated | 99.96 | |
| TIGR02275 | 527 | DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot | 99.96 | |
| PRK08279 | 600 | long-chain-acyl-CoA synthetase; Validated | 99.96 | |
| PRK13295 | 547 | cyclohexanecarboxylate-CoA ligase; Reviewed | 99.96 | |
| PRK05857 | 540 | acyl-CoA synthetase; Validated | 99.96 | |
| PRK07769 | 631 | long-chain-fatty-acid--CoA ligase; Validated | 99.96 | |
| PRK13390 | 501 | acyl-CoA synthetase; Provisional | 99.96 | |
| PRK09029 | 458 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.96 | |
| PRK07656 | 513 | long-chain-fatty-acid--CoA ligase; Validated | 99.96 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 99.96 | |
| PLN02736 | 651 | long-chain acyl-CoA synthetase | 99.95 | |
| PRK12492 | 562 | long-chain-fatty-acid--CoA ligase; Provisional | 99.95 | |
| PRK08276 | 502 | long-chain-fatty-acid--CoA ligase; Validated | 99.95 | |
| PRK06188 | 524 | acyl-CoA synthetase; Validated | 99.95 | |
| PRK12406 | 509 | long-chain-fatty-acid--CoA ligase; Provisional | 99.95 | |
| PRK07008 | 539 | long-chain-fatty-acid--CoA ligase; Validated | 99.95 | |
| PRK08751 | 560 | putative long-chain fatty acyl CoA ligase; Provisi | 99.95 | |
| PRK07786 | 542 | long-chain-fatty-acid--CoA ligase; Validated | 99.95 | |
| TIGR01734 | 502 | D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig | 99.95 | |
| PRK06087 | 547 | short chain acyl-CoA synthetase; Reviewed | 99.95 | |
| PRK08043 | 718 | bifunctional acyl-[acyl carrier protein] synthetas | 99.95 | |
| PRK13391 | 511 | acyl-CoA synthetase; Provisional | 99.95 | |
| PRK03640 | 483 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.95 | |
| PRK08162 | 545 | acyl-CoA synthetase; Validated | 99.95 | |
| PRK06334 | 539 | long chain fatty acid--[acyl-carrier-protein] liga | 99.95 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 99.95 | |
| PRK07059 | 557 | Long-chain-fatty-acid--CoA ligase; Validated | 99.95 | |
| PRK05851 | 525 | long-chain-fatty-acid--[acyl-carrier-protein] liga | 99.95 | |
| PRK12476 | 612 | putative fatty-acid--CoA ligase; Provisional | 99.95 | |
| PLN02479 | 567 | acetate-CoA ligase | 99.95 | |
| PRK06187 | 521 | long-chain-fatty-acid--CoA ligase; Validated | 99.95 | |
| TIGR03208 | 538 | cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. | 99.95 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 99.95 | |
| PRK06018 | 542 | putative acyl-CoA synthetase; Provisional | 99.95 | |
| PRK13382 | 537 | acyl-CoA synthetase; Provisional | 99.95 | |
| TIGR03098 | 515 | ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor | 99.95 | |
| PLN03052 | 728 | acetate--CoA ligase; Provisional | 99.94 | |
| PRK04813 | 503 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.94 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.94 | |
| TIGR03205 | 541 | pimA dicarboxylate--CoA ligase PimA. PimA, a membe | 99.94 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 99.94 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 99.94 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.94 | |
| PRK08974 | 560 | long-chain-fatty-acid--CoA ligase; Validated | 99.94 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.94 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 99.94 | |
| TIGR01923 | 436 | menE O-succinylbenzoate-CoA ligase. This model rep | 99.94 | |
| PRK09192 | 579 | acyl-CoA synthetase; Validated | 99.93 | |
| TIGR02262 | 508 | benz_CoA_lig benzoate-CoA ligase family. Character | 99.93 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.93 | |
| PLN02861 | 660 | long-chain-fatty-acid-CoA ligase | 99.93 | |
| PRK13383 | 516 | acyl-CoA synthetase; Provisional | 99.93 | |
| PLN02614 | 666 | long-chain acyl-CoA synthetase | 99.93 | |
| PRK05850 | 578 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.93 | |
| PRK08308 | 414 | acyl-CoA synthetase; Validated | 99.93 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.93 | |
| PRK08180 | 614 | feruloyl-CoA synthase; Reviewed | 99.91 | |
| PLN02387 | 696 | long-chain-fatty-acid-CoA ligase family protein | 99.91 | |
| PLN02430 | 660 | long-chain-fatty-acid-CoA ligase | 99.91 | |
| PTZ00216 | 700 | acyl-CoA synthetase; Provisional | 99.9 | |
| PTZ00342 | 746 | acyl-CoA synthetase; Provisional | 99.9 | |
| PRK12582 | 624 | acyl-CoA synthetase; Provisional | 99.89 | |
| PRK07768 | 545 | long-chain-fatty-acid--CoA ligase; Validated | 99.89 | |
| TIGR02372 | 386 | 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv | 99.87 | |
| KOG1256 | 691 | consensus Long-chain acyl-CoA synthetases (AMP-for | 99.86 | |
| COG1022 | 613 | FAA1 Long-chain acyl-CoA synthetases (AMP-forming) | 99.85 | |
| KOG1180 | 678 | consensus Acyl-CoA synthetase [Lipid transport and | 99.84 | |
| KOG1179 | 649 | consensus Very long-chain acyl-CoA synthetase/fatt | 99.74 | |
| KOG1178 | 1032 | consensus Non-ribosomal peptide synthetase/alpha-a | 99.72 | |
| TIGR02155 | 422 | PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet | 99.69 | |
| TIGR01733 | 408 | AA-adenyl-dom amino acid adenylation domain. This | 99.56 | |
| PF13193 | 73 | AMP-binding_C: AMP-binding enzyme C-terminal domai | 99.48 | |
| PTZ00297 | 1452 | pantothenate kinase; Provisional | 99.42 | |
| COG1541 | 438 | PaaK Coenzyme F390 synthetase [Coenzyme metabolism | 99.1 | |
| TIGR03335 | 445 | F390_ftsA coenzyme F390 synthetase. This enzyme, c | 99.04 | |
| COG1020 | 642 | EntF Non-ribosomal peptide synthetase modules and | 98.93 | |
| PF14535 | 96 | AMP-binding_C_2: AMP-binding enzyme C-terminal dom | 98.62 | |
| KOG3628 | 1363 | consensus Predicted AMP-binding protein [General f | 98.6 | |
| TIGR02304 | 430 | aden_form_hyp probable adenylate-forming enzyme. M | 97.87 | |
| PF03321 | 528 | GH3: GH3 auxin-responsive promoter; InterPro: IPR0 | 96.76 | |
| KOG3628 | 1363 | consensus Predicted AMP-binding protein [General f | 96.45 | |
| PLN02249 | 597 | indole-3-acetic acid-amido synthetase | 94.25 | |
| PLN02247 | 606 | indole-3-acetic acid-amido synthetase | 88.62 | |
| PLN02620 | 612 | indole-3-acetic acid-amido synthetase | 88.43 |
| >KOG1176 consensus Acyl-CoA synthetase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.8e-38 Score=239.68 Aligned_cols=142 Identities=50% Similarity=0.778 Sum_probs=138.1
Q ss_pred CCCChhhhhcccCCCCeeecCceEEEcCCCeEEEEeecCCeEEeCcEEeChHHHHHHHhcCCCcceEEEEeecCCCCCce
Q 038977 1 YLNDPEATAATIDVEGLLHTGDIGYVDHDDEVFIVDRVKEIIKFKGFQVPPAEIEALLLSHPSIADATVVPQKDEVAGEV 80 (145)
Q Consensus 1 Y~~~~~~t~~~~~~~~~~~TGDl~~~~~~g~l~~~GR~d~~i~~~G~~v~~~~ie~~l~~~~~v~~~~~~~~~~~~~~~~ 80 (145)
||+||++|++.|+.+|||+|||+|++|+||+|++.+|.+|+||.+|.+|+|.+||+.|..||.|.+++|++.++..+|+.
T Consensus 393 Y~~NpeaT~~~~~~~GW~~TGDiGy~D~DG~l~IvdR~KdlIk~~G~qv~P~EiE~vL~~hP~V~eaaVvgipDe~~Ge~ 472 (537)
T KOG1176|consen 393 YLKNPEATKEAFDDDGWFHTGDLGYFDEDGYLYIVDRSKDLIKYGGEQVSPAEIEAVLLTHPDVLEAAVVGIPDEVWGET 472 (537)
T ss_pred hcCChHHHHhhcccCCccccCceEEEcCCCeEEEecchhhheeeCCEEeCHHHHHHHHHhCCCccEEEEEcccccccCCc
Confidence 99999999999987799999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eEEEEEeCCCCccCHHHHHHHHHhccccccCceEEEEeccCCCCCCCcccHHHHHHHHHccC
Q 038977 81 PVAFVVRSNGFELTEEAIKEYIAKQVVFYKRLHKVHFVHAIPKSPSGKILRKDLIAKLASSM 142 (145)
Q Consensus 81 ~~~~v~~~~~~~~~~~~l~~~l~~~l~~~~~p~~~~~v~~~p~t~~gK~~r~~l~~~~~~~~ 142 (145)
++++|+.+++...+++++.+.++++++.++.|..+.|+++||+|++||++|+.|++.+.+..
T Consensus 473 p~A~VV~k~g~~lte~di~~~v~k~l~~y~~~~~V~Fvd~lPKs~~GKi~R~~lr~~~~~~~ 534 (537)
T KOG1176|consen 473 PAAFVVLKKGSTLTEKDIIEYVRKKLPAYKLPGGVVFVDELPKTPNGKILRRKLRDIAKKLG 534 (537)
T ss_pred ceEEEEecCCCcCCHHHHHHHHHhhCChhhccCeEEEeccCCCCCcchHHHHHHHHHHHhcc
Confidence 99999999999999999999999999999999999999999999999999999999987643
|
|
| >COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG1177 consensus Long chain fatty acid acyl-CoA ligase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PTZ00237 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02654 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PLN02574 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK05677 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PLN02860 o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase | Back alignment and domain information |
|---|
| >PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PLN03102 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK00174 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05852 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK09088 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK03584 acetoacetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02316 propion_prpE propionate--CoA ligase | Back alignment and domain information |
|---|
| >PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PLN02246 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
| >PRK07867 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06839 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >KOG1175 consensus Acyl-CoA synthetase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07470 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK04319 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK13388 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07529 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >PLN02330 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >PRK05605 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06145 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK09274 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07514 malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >PRK07788 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06164 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08315 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK08316 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK10524 prpE propionyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK06060 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08314 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK12583 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05620 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK10946 entE enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >PLN03051 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK06178 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07787 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07798 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06710 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07638 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >PRK08279 long-chain-acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK05857 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07769 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK13390 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07656 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PLN02736 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >PRK12492 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08276 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06188 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12406 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07008 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08751 putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07786 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
| >PRK06087 short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13391 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08162 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07059 Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PRK12476 putative fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PLN02479 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK06187 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06018 putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK13382 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PLN03052 acetate--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03205 pimA dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08974 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >TIGR01923 menE O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PRK09192 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR02262 benz_CoA_lig benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02861 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PRK13383 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02614 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >PRK05850 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK08308 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK08180 feruloyl-CoA synthase; Reviewed | Back alignment and domain information |
|---|
| >PLN02387 long-chain-fatty-acid-CoA ligase family protein | Back alignment and domain information |
|---|
| >PLN02430 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PTZ00216 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00342 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12582 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07768 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family | Back alignment and domain information |
|---|
| >KOG1256 consensus Long-chain acyl-CoA synthetases (AMP-forming) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG1180 consensus Acyl-CoA synthetase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1179 consensus Very long-chain acyl-CoA synthetase/fatty acid transporter [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase | Back alignment and domain information |
|---|
| >TIGR01733 AA-adenyl-dom amino acid adenylation domain | Back alignment and domain information |
|---|
| >PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B | Back alignment and domain information |
|---|
| >PTZ00297 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03335 F390_ftsA coenzyme F390 synthetase | Back alignment and domain information |
|---|
| >COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF14535 AMP-binding_C_2: AMP-binding enzyme C-terminal domain; PDB: 2Y27_A 2Y4N_A 3QOV_B 3S89_D 3LAX_A 2Y4O_B | Back alignment and domain information |
|---|
| >KOG3628 consensus Predicted AMP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02304 aden_form_hyp probable adenylate-forming enzyme | Back alignment and domain information |
|---|
| >PF03321 GH3: GH3 auxin-responsive promoter; InterPro: IPR004993 Transcription of the gene family, GH3, has been shown to be specifically induced by the plant hormone auxin | Back alignment and domain information |
|---|
| >KOG3628 consensus Predicted AMP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02249 indole-3-acetic acid-amido synthetase | Back alignment and domain information |
|---|
| >PLN02247 indole-3-acetic acid-amido synthetase | Back alignment and domain information |
|---|
| >PLN02620 indole-3-acetic acid-amido synthetase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 145 | ||||
| 3a9u_A | 536 | Crystal Structures And Enzymatic Mechanisms Of A Po | 3e-46 | ||
| 3tsy_A | 979 | 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Pr | 6e-46 | ||
| 2d1t_A | 548 | Crystal Structure Of The Thermostable Japanese Fire | 1e-34 | ||
| 2d1q_A | 548 | Crystal Structure Of The Thermostable Japanese Fire | 2e-34 | ||
| 2d1s_A | 548 | Crystal Structure Of The Thermostable Japanese Fire | 2e-34 | ||
| 3qya_A | 582 | Crystal Structure Of A Red-Emitter Mutant Of Lampyr | 9e-33 | ||
| 1ba3_A | 550 | Firefly Luciferase In Complex With Bromoform Length | 1e-31 | ||
| 4g36_A | 555 | Photinus Pyralis Luciferase In The Adenylate-Formin | 1e-31 | ||
| 3iep_A | 551 | Firefly Luciferase Apo Structure (P41 Form) Length | 1e-31 | ||
| 4g37_A | 555 | Structure Of Cross-Linked Firefly Luciferase In Sec | 3e-31 | ||
| 3g7s_A | 549 | Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Li | 2e-23 | ||
| 3r44_A | 517 | Mycobacterium Tuberculosis Fatty Acyl Coa Synthetas | 5e-22 | ||
| 2wd9_A | 569 | Crystal Structure Of Human Acyl-coa Synthetase Medi | 2e-16 | ||
| 3b7w_A | 570 | Crystal Structure Of Human Acyl-Coa Synthetase Medi | 2e-16 | ||
| 3ivr_A | 509 | Crystal Structure Of Putative Long-Chain-Fatty-Acid | 8e-16 | ||
| 3nyq_A | 505 | Malonyl-Coa Ligase Ternary Product Complex With Met | 2e-15 | ||
| 3etc_A | 580 | 2.1 A Structure Of Acyl-Adenylate Synthetase From M | 5e-15 | ||
| 3ipl_A | 501 | Crystal Structure Of O-Succinylbenzoic Acid-Coa Lig | 3e-12 | ||
| 2p20_A | 652 | Acetyl-Coa Synthetase, R584a Mutation Length = 652 | 6e-12 | ||
| 4fuq_A | 503 | Crystal Structure Of Apo Matb From Rhodopseudomonas | 8e-12 | ||
| 1ult_A | 541 | Crystal Structure Of Tt0168 From Thermus Thermophil | 1e-11 | ||
| 1t5h_X | 504 | 4-Chlorobenzoyl-Coa LigaseSYNTHETASE UNLIGANDED, SE | 1e-11 | ||
| 1pg3_A | 652 | Acetyl Coa Synthetase, Acetylated On Lys609 Length | 2e-11 | ||
| 2p2q_A | 652 | Acetyl-Coa Synthetase, R584e Mutation Length = 652 | 2e-11 | ||
| 2p2b_A | 652 | Acetyl-coa Synthetase, V386a Mutation Length = 652 | 2e-11 | ||
| 2p2f_A | 652 | Acetyl-coa Synthetase, Wild-type With Acetate, Amp, | 2e-11 | ||
| 2p2m_A | 652 | Acetyl-Coa Synthetase, R194a Mutation Length = 652 | 3e-11 | ||
| 3rg2_A | 617 | Structure Of A Two-Domain Nrps Fusion Protein Conta | 5e-11 | ||
| 3cw8_X | 504 | 4-chlorobenzoyl-coa Ligase/synthetase, Bound To 4cb | 5e-11 | ||
| 2qvx_X | 504 | 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303G MUTATIO | 1e-10 | ||
| 1t5d_X | 504 | 4-Chlorobenzoyl-Coa LigaseSYNTHETASE BOUND TO 4-Chl | 1e-10 | ||
| 2qvz_X | 504 | 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303A MUTATIO | 1e-10 | ||
| 2p2j_A | 652 | Acetyl-Coa Synthetase, K609a Mutation Length = 652 | 1e-10 | ||
| 3dlp_X | 504 | 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, MUTANT D402P, | 1e-10 | ||
| 3o82_A | 544 | Structure Of Base N-Terminal Domain From Acinetobac | 1e-10 | ||
| 1ry2_A | 663 | Crystal Structure Of Yeast Acetyl-Coenzyme A Synthe | 2e-10 | ||
| 1mdb_A | 539 | Crystal Structure Of Dhbe In Complex With Dhb-adeny | 2e-10 | ||
| 1md9_A | 539 | Crystal Structure Of Dhbe In Complex With Dhb And A | 4e-10 | ||
| 4gr5_A | 570 | Crystal Structure Of Slgn1deltaasub In Complex With | 3e-09 | ||
| 3l8c_A | 521 | Structure Of Probable D-Alanine--Poly(Phosphoribito | 3e-09 | ||
| 4fut_A | 503 | Crystal Structure Of Atp Bound Matb From Rhodopseud | 5e-09 | ||
| 4gxr_A | 503 | Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Len | 8e-09 | ||
| 4gxq_A | 506 | Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimer | 1e-08 | ||
| 3fcc_A | 512 | Crystal Structure Of Dlta Protein In Complex With A | 9e-08 | ||
| 3dhv_A | 512 | Crystal Structure Of Dlta Protein In Complex With D | 9e-08 | ||
| 2vsq_A | 1304 | Structure Of Surfactin A Synthetase C (Srfa-C), A N | 3e-07 | ||
| 2v7b_A | 529 | Crystal Structures Of A Benzoate Coa Ligase From Bu | 2e-05 | ||
| 1amu_A | 563 | Phenylalanine Activating Domain Of Gramicidin Synth | 2e-04 | ||
| 3e7w_A | 511 | Crystal Structure Of Dlta: Implications For The Rea | 2e-04 |
| >pdb|3A9U|A Chain A, Crystal Structures And Enzymatic Mechanisms Of A Populus Tomentosa 4- Coumarate--Coa Ligase Length = 536 | Back alignment and structure |
|
| >pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein Length = 979 | Back alignment and structure |
| >pdb|2D1T|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Red-Color Emission S286n Mutant Complexed With High-Energy Intermediate Analogue Length = 548 | Back alignment and structure |
| >pdb|2D1Q|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With Mgatp Length = 548 | Back alignment and structure |
| >pdb|2D1S|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With High-Energy Intermediate Analogue Length = 548 | Back alignment and structure |
| >pdb|3QYA|A Chain A, Crystal Structure Of A Red-Emitter Mutant Of Lampyris Turkestanicus Luciferase Length = 582 | Back alignment and structure |
| >pdb|1BA3|A Chain A, Firefly Luciferase In Complex With Bromoform Length = 550 | Back alignment and structure |
| >pdb|4G36|A Chain A, Photinus Pyralis Luciferase In The Adenylate-Forming Conformation Bound To Dlsa Length = 555 | Back alignment and structure |
| >pdb|3IEP|A Chain A, Firefly Luciferase Apo Structure (P41 Form) Length = 551 | Back alignment and structure |
| >pdb|4G37|A Chain A, Structure Of Cross-Linked Firefly Luciferase In Second Catalytic Conformation Length = 555 | Back alignment and structure |
| >pdb|3G7S|A Chain A, Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Ligase (Fadd1) From Archaeoglobus Fulgidus Length = 549 | Back alignment and structure |
| >pdb|3R44|A Chain A, Mycobacterium Tuberculosis Fatty Acyl Coa Synthetase Length = 517 | Back alignment and structure |
| >pdb|2WD9|A Chain A, Crystal Structure Of Human Acyl-coa Synthetase Medium-chain Family Member 2a (l64p Mutation) In Complex With Ibuprofen Length = 569 | Back alignment and structure |
| >pdb|3B7W|A Chain A, Crystal Structure Of Human Acyl-Coa Synthetase Medium-Chain Family Member 2a, With L64p Mutation Length = 570 | Back alignment and structure |
| >pdb|3IVR|A Chain A, Crystal Structure Of Putative Long-Chain-Fatty-Acid Coa Ligase From Rhodopseudomonas Palustris Cga009 Length = 509 | Back alignment and structure |
| >pdb|3NYQ|A Chain A, Malonyl-Coa Ligase Ternary Product Complex With Methylmalonyl-Coa And Amp Bound Length = 505 | Back alignment and structure |
| >pdb|3ETC|A Chain A, 2.1 A Structure Of Acyl-Adenylate Synthetase From Methanosarcina Acetivorans Containing A Link Between Lys256 And Cys298 Length = 580 | Back alignment and structure |
| >pdb|3IPL|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid-Coa Ligase From Staphylococcus Aureus Subsp. Aureus Mu50 Length = 501 | Back alignment and structure |
| >pdb|2P20|A Chain A, Acetyl-Coa Synthetase, R584a Mutation Length = 652 | Back alignment and structure |
| >pdb|4FUQ|A Chain A, Crystal Structure Of Apo Matb From Rhodopseudomonas Palustris Length = 503 | Back alignment and structure |
| >pdb|1ULT|A Chain A, Crystal Structure Of Tt0168 From Thermus Thermophilus Hb8 Length = 541 | Back alignment and structure |
| >pdb|1T5H|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE UNLIGANDED, SELENOMETHIONINE Length = 504 | Back alignment and structure |
| >pdb|1PG3|A Chain A, Acetyl Coa Synthetase, Acetylated On Lys609 Length = 652 | Back alignment and structure |
| >pdb|2P2Q|A Chain A, Acetyl-Coa Synthetase, R584e Mutation Length = 652 | Back alignment and structure |
| >pdb|2P2B|A Chain A, Acetyl-coa Synthetase, V386a Mutation Length = 652 | Back alignment and structure |
| >pdb|2P2F|A Chain A, Acetyl-coa Synthetase, Wild-type With Acetate, Amp, And Coa Bound Length = 652 | Back alignment and structure |
| >pdb|2P2M|A Chain A, Acetyl-Coa Synthetase, R194a Mutation Length = 652 | Back alignment and structure |
| >pdb|3RG2|A Chain A, Structure Of A Two-Domain Nrps Fusion Protein Containing The Ente Adenylation Domain And Entb Aryl-Carrier Protein From Enterobactin Biosynthesis Length = 617 | Back alignment and structure |
| >pdb|3CW8|X Chain X, 4-chlorobenzoyl-coa Ligase/synthetase, Bound To 4cba-adenylate Length = 504 | Back alignment and structure |
| >pdb|2QVX|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303G MUTATION, BOUND TO 3- Chlorobenzoate Length = 504 | Back alignment and structure |
| >pdb|1T5D|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE BOUND TO 4-Chlorobenzoate Length = 504 | Back alignment and structure |
| >pdb|2QVZ|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303A MUTATION, BOUND TO 3- Chlorobenzoate Length = 504 | Back alignment and structure |
| >pdb|2P2J|A Chain A, Acetyl-Coa Synthetase, K609a Mutation Length = 652 | Back alignment and structure |
| >pdb|3DLP|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, MUTANT D402P, BOUND To 4cb Length = 504 | Back alignment and structure |
| >pdb|3O82|A Chain A, Structure Of Base N-Terminal Domain From Acinetobacter Baumannii Bound To 5'-O-[n-(2,3-Dihydroxybenzoyl)sulfamoyl] Adenosine Length = 544 | Back alignment and structure |
| >pdb|1RY2|A Chain A, Crystal Structure Of Yeast Acetyl-Coenzyme A Synthetase In Complex With Amp Length = 663 | Back alignment and structure |
| >pdb|1MDB|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb-adenylate Length = 539 | Back alignment and structure |
| >pdb|1MD9|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb And Amp Length = 539 | Back alignment and structure |
| >pdb|4GR5|A Chain A, Crystal Structure Of Slgn1deltaasub In Complex With Ampcpp Length = 570 | Back alignment and structure |
| >pdb|3L8C|A Chain A, Structure Of Probable D-Alanine--Poly(Phosphoribitol) Ligase Subunit-1 From Streptococcus Pyogenes Length = 521 | Back alignment and structure |
| >pdb|4FUT|A Chain A, Crystal Structure Of Atp Bound Matb From Rhodopseudomonas Palustris Length = 503 | Back alignment and structure |
| >pdb|4GXR|A Chain A, Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Length = 503 | Back alignment and structure |
| >pdb|4GXQ|A Chain A, Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimera B1 Length = 506 | Back alignment and structure |
| >pdb|3FCC|A Chain A, Crystal Structure Of Dlta Protein In Complex With Atp And Magnesium Length = 512 | Back alignment and structure |
| >pdb|3DHV|A Chain A, Crystal Structure Of Dlta Protein In Complex With D-Alanine Adenylate Length = 512 | Back alignment and structure |
| >pdb|2VSQ|A Chain A, Structure Of Surfactin A Synthetase C (Srfa-C), A Nonribosomal Peptide Synthetase Termination Module Length = 1304 | Back alignment and structure |
| >pdb|2V7B|A Chain A, Crystal Structures Of A Benzoate Coa Ligase From Burkholderia Xenovorans Lb400 Length = 529 | Back alignment and structure |
| >pdb|1AMU|A Chain A, Phenylalanine Activating Domain Of Gramicidin Synthetase 1 In A Complex With Amp And Phenylalanine Length = 563 | Back alignment and structure |
| >pdb|3E7W|A Chain A, Crystal Structure Of Dlta: Implications For The Reaction Mechanism Of Non-Ribosomal Peptide Synthetase (Nrps) Adenylation Domains Length = 511 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 100.0 | |
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 100.0 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 100.0 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 100.0 | |
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 100.0 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 100.0 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 100.0 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 100.0 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 100.0 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 100.0 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 100.0 | |
| 1pg4_A | 652 | Acetyl-COA synthetase; AMP-forming, adenylate-form | 100.0 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 100.0 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 100.0 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 100.0 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 100.0 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 100.0 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 100.0 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 99.98 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 99.98 | |
| 1ry2_A | 663 | Acetyl-coenzyme A synthetase 1, acyl-activating en | 99.97 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 99.97 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 99.97 | |
| 4gr5_A | 570 | Non-ribosomal peptide synthetase; MBTH-like domain | 99.97 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 99.97 | |
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 99.97 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 99.97 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 99.96 | |
| 4gs5_A | 358 | Acyl-COA synthetase (AMP-forming)/AMP-acid ligase | 99.96 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 99.96 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 99.95 | |
| 3qov_A | 436 | Phenylacetate-coenzyme A ligase; acetyl-COA synthe | 99.9 | |
| 2y4o_A | 443 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.9 | |
| 2y27_A | 437 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.89 | |
| 3gxs_A | 109 | Phenylacetate-coenzyme A ligase; APC62324.1, struc | 99.76 | |
| 3lax_A | 109 | Phenylacetate-coenzyme A ligase; structural genomi | 99.75 | |
| 4b2g_A | 609 | GH3-1 auxin conjugating enzyme; signaling protein, | 97.69 | |
| 4eql_A | 581 | 4-substituted benzoates-glutamate ligase GH3.12; f | 97.54 | |
| 4epl_A | 581 | Jasmonic acid-amido synthetase JAR1; ANL adenylati | 97.54 |
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-35 Score=224.85 Aligned_cols=141 Identities=29% Similarity=0.449 Sum_probs=135.0
Q ss_pred CCCChhhhhcccCCCCeeecCceEEEcCCCeEEEEeecCCeEEeCcEEeChHHHHHHHhcCCCcceEEEEeecCCCCCce
Q 038977 1 YLNDPEATAATIDVEGLLHTGDIGYVDHDDEVFIVDRVKEIIKFKGFQVPPAEIEALLLSHPSIADATVVPQKDEVAGEV 80 (145)
Q Consensus 1 Y~~~~~~t~~~~~~~~~~~TGDl~~~~~~g~l~~~GR~d~~i~~~G~~v~~~~ie~~l~~~~~v~~~~~~~~~~~~~~~~ 80 (145)
||++|+.|.+.|..+|||+|||++++|++|.++++||+||+||++|.+|+|.+||+.|.++|.|.++++++.++...++.
T Consensus 361 Y~~~~~~t~~~f~~~g~~~TGDl~~~~~dG~l~~~GR~dd~ik~~G~~v~p~eIE~~l~~~p~V~~a~vv~~~~~~~~~~ 440 (503)
T 4fuq_A 361 YWRMPEKTKSEFRDDGFFITGDLGKIDERGYVHILGRGKDLVITGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEG 440 (503)
T ss_dssp BTTCHHHHHHTBCTTSCEEEEEEEEECTTCEEEECCSSTTCEEETTEEECHHHHHHHHHTSTTEEEEEEEEEEETTTEEE
T ss_pred hcCChhhhHhhhCCCCCeEcceeEEEcCCCcEEEEecCCCEEEECCEEECHHHHHHHHHhCCCeeEEEEEEeEchhcCce
Confidence 99999999999988999999999999999999999999999999999999999999999999999999999998888889
Q ss_pred eEEEEEeCCCCccCHHHHHHHHHhccccccCceEEEEeccCCCCCCCcccHHHHHHHHHcc
Q 038977 81 PVAFVVRSNGFELTEEAIKEYIAKQVVFYKRLHKVHFVHAIPKSPSGKILRKDLIAKLASS 141 (145)
Q Consensus 81 ~~~~v~~~~~~~~~~~~l~~~l~~~l~~~~~p~~~~~v~~~p~t~~gK~~r~~l~~~~~~~ 141 (145)
++++++...+...+.+++.+.++++|+.+++|..++++++||+|++||++|++|++++.+-
T Consensus 441 ~~a~v~~~~~~~~~~~~l~~~l~~~L~~~~~P~~i~~v~~lP~t~~GKi~R~~L~~~~~~~ 501 (503)
T 4fuq_A 441 VTAVVVRDKGATIDEAQVLHGLDGQLAKFKMPKKVIFVDDLPRNTMGKVQKNVLRETYKDI 501 (503)
T ss_dssp EEEEEEECTTCCCCHHHHHHHHBTTBCGGGCCSEEEEESCCCBCTTSCBCHHHHHHHTTTT
T ss_pred eEEEEEeCCCCCCCHHHHHHHHHhhcccCCCCCEEEEECCCCCCcccceeHHHHHHHHHHh
Confidence 9999998888788889999999999999999999999999999999999999999998754
|
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* | Back alignment and structure |
|---|
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A | Back alignment and structure |
|---|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* | Back alignment and structure |
|---|
| >1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* | Back alignment and structure |
|---|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 | Back alignment and structure |
|---|
| >1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} | Back alignment and structure |
|---|
| >4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* | Back alignment and structure |
|---|
| >3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* | Back alignment and structure |
|---|
| >2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* | Back alignment and structure |
|---|
| >3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} | Back alignment and structure |
|---|
| >4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* | Back alignment and structure |
|---|
| >4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 145 | ||||
| d1lcia_ | 541 | e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali | 3e-45 | |
| d1v25a_ | 534 | e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 | 8e-43 | |
| d1pg4a_ | 643 | e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en | 1e-41 | |
| d3cw9a1 | 503 | e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc | 3e-39 | |
| d1ry2a_ | 640 | e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast | 8e-39 | |
| d1amua_ | 514 | e.23.1.1 (A:) Phenylalanine activating domain of g | 1e-38 | |
| d1mdba_ | 536 | e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B | 4e-33 |
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Luciferase species: Firefly (Photinus pyralis) [TaxId: 7054]
Score = 152 bits (385), Expect = 3e-45
Identities = 67/135 (49%), Positives = 93/135 (68%), Gaps = 1/135 (0%)
Query: 1 YLNDPEATAATIDVEGLLHTGDIGYVDHDDEVFIVDRVKEIIKFKGFQVPPAEIEALLLS 60
Y+N+PEAT A ID +G LH+GDI Y D D+ FIVDR+K +IK+KG+QV PAE+E++LL
Sbjct: 398 YVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQ 457
Query: 61 HPSIADATVVPQKDEVAGEVPVAFVVRSNGFELTEEAIKEYIAKQVVFYKRLHK-VHFVH 119
HP+I DA V D+ AGE+P A VV +G +TE+ I +Y+A QV K+L V FV
Sbjct: 458 HPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVD 517
Query: 120 AIPKSPSGKILRKDL 134
+PK +GK+ + +
Sbjct: 518 EVPKGLTGKLDARKI 532
|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| d1ry2a_ | 640 | Acetyl-CoA synthetase {Baker's yeast (Saccharomyce | 100.0 | |
| d3cw9a1 | 503 | 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId | 100.0 | |
| d1pg4a_ | 643 | Acetyl-CoA synthetase {Salmonella enterica [TaxId: | 100.0 | |
| d1lcia_ | 541 | Luciferase {Firefly (Photinus pyralis) [TaxId: 705 | 100.0 | |
| d1v25a_ | 534 | Long chain fatty acid-CoA ligase TT0168 {Thermus t | 100.0 | |
| d1mdba_ | 536 | Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil | 99.98 | |
| d1amua_ | 514 | Phenylalanine activating domain of gramicidin synt | 99.98 |
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Acetyl-CoA synthetase species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=2e-34 Score=222.64 Aligned_cols=141 Identities=28% Similarity=0.426 Sum_probs=125.1
Q ss_pred CCCChhhhhccc--CCCCeeecCceEEEcCCCeEEEEeecCCeEEeCcEEeChHHHHHHHhcCCCcceEEEEeecCCCCC
Q 038977 1 YLNDPEATAATI--DVEGLLHTGDIGYVDHDDEVFIVDRVKEIIKFKGFQVPPAEIEALLLSHPSIADATVVPQKDEVAG 78 (145)
Q Consensus 1 Y~~~~~~t~~~~--~~~~~~~TGDl~~~~~~g~l~~~GR~d~~i~~~G~~v~~~~ie~~l~~~~~v~~~~~~~~~~~~~~ 78 (145)
||++++.|.+.| +.+|||+|||+|++|++|+++++||+||+||++|++|+|.+||+.|.++|.|.++++++.++...+
T Consensus 463 y~~~~e~t~~~~~~~~~gw~~TGDlg~~d~dG~l~i~GR~dd~Ik~~G~~I~p~eIE~~l~~~p~V~~a~Vvg~~d~~~g 542 (640)
T d1ry2a_ 463 IWKNHDRYLDTYLNPYPGYYFTGDGAAKDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDPIVAECAVVGFNDDLTG 542 (640)
T ss_dssp ETTCHHHHHHHHTSSSTTSEEEEEEEEECTTCCEEECSCTTSCBCSSSCCBCHHHHHHHHHSSTTEEEEEEECCCCCTTS
T ss_pred cccCHHHHHhhhccCCCCeEEcCCceeECCCCCEEEEEcCCCEEEECCEEECHHHHHHHHHhCCCccEEEEEEEECCCCC
Confidence 899999998887 456999999999999999999999999999999999999999999999999999999999999889
Q ss_pred ceeEEEEEeCCCCccC----------HHHHHHHHHhccccccCceEEEEeccCCCCCCCcccHHHHHHHHHcc
Q 038977 79 EVPVAFVVRSNGFELT----------EEAIKEYIAKQVVFYKRLHKVHFVHAIPKSPSGKILRKDLIAKLASS 141 (145)
Q Consensus 79 ~~~~~~v~~~~~~~~~----------~~~l~~~l~~~l~~~~~p~~~~~v~~~p~t~~gK~~r~~l~~~~~~~ 141 (145)
+.++++|++.++.... .+++.+.++++|+.+++|+.++++++||+|++||++|++|++++..+
T Consensus 543 e~~~a~Vv~~~~~~~~~~~~~~~~~l~~~l~~~~~~~L~~~~~P~~i~~v~~lP~T~sGKi~R~~Lr~~~~~~ 615 (640)
T d1ry2a_ 543 QAVAAFVVLKNKSSWSTATDDELQDIKKHLVFTVRKDIGPFAAPKLIILVDDLPKTRSGKIMRRILRKILAGE 615 (640)
T ss_dssp CCCEEEEEEC------------CCSHHHHHHHHHHHHTCTTTSCSEEEECSCCCBCTTSCBCHHHHHHSCC--
T ss_pred eEEEEEEEEcCCCCccccchHHHHHHHHHHHHHHHhhCCCCCCceEEEEeCCCCCCCCcCccHHHHHHHHhCC
Confidence 9999999887764322 25688889999999999999999999999999999999999987543
|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} | Back information, alignment and structure |
|---|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} | Back information, alignment and structure |
|---|