Citrus Sinensis ID: 038999


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MSYFPSHSLLASAPSSSSSLPYNSDYQKESSSGNKISPAILFIIVILAVVFFISGVLQLLIRFVIRRRSSSSVSESNRFPEMSGSDAFQRQLQQLFHLHDSGLDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLYIHGLGYENPVFEYEYPREDDGFPVSANGGIGASLGLKPAENDIRSEKRVFSVRLGKFRSSNDGSEGIERVEGETSCSNLEARRCYSMGSYQYVVADSELQVALCPRRGGSASVRFGKGRSAQNDNSSNDGDVEGKKINFRSKGESFSVSKIWQWSKKSKFPSSSETHMGSSSGTVGLPRANDTESS
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHccEEEEEEcccccccccccEEccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccc
cccccccccEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccccccHHHHHHccEEEEEccccccccccEEEEEccccccccEEEcccccccccHHHHHHHHHccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccEccccccccccccccEEEccccEEEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccc
msyfpshsllasapssssslpynsdyqkesssgnkispAILFIIVILAVVFFISGVLQLLIRFVIRrrssssvsesnrfpemsgsdAFQRQLQQLFHLHDSGLDQAFIDALPVFLYREimglkepfdcavclcefseqdklrllpmcshafhIDCIdtwllsnstcplcrgnlyihglgyenpvfeyeypreddgfpvsanggigaslglkpaendirseKRVFSVRlgkfrssndgsegiervegetscsnlearrcysMGSYQYVVADSElqvalcprrggsasvrfgkgrsaqndnssndgdvegkkinfrskgesfsvskiwqwskkskfpsssethmgsssgtvglprandtess
msyfpshsllasapssssslpYNSDYQKESSSGNKISPAILFIIVILAVVFFISGVLQLLIRFVIRrrssssvsesnrfpEMSGSDAFQRQLQQLFHLHDSGLDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLYIHGLGYENPVFEYEYPREDDGFPVSANGGIGASlglkpaendirsekrvfsvrlgkfrssndgsegiervegetscsnlEARRCYSMGSYQYVVADSELQVALCPRRGGSasvrfgkgrsaqndnssndgdvegkkinfrskgesfsvskiwqwskkskfpsssethmgsssgtvglprandtess
MSYFpshsllasapssssslpYNSDYQKESSSGNKISPailfiivilavvffiSGVLQLLirfvirrrssssvsesnrfPEMSGSDAfqrqlqqlfhlhDSGLDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLYIHGLGYENPVFEYEYPREDDGFPVSANGGIGASLGLKPAENDIRSEKRVFSVRLGKFRSSNDGSEGIERVEGETSCSNLEARRCYSMGSYQYVVADSELQVALCPRRGGSASVRFGKGRSAQNDNSSNDGDVEGKKINFRSKGESFSVSKIWQWSKKSKFPsssethmgsssgtVGLPRANDTESS
************************************SPAILFIIVILAVVFFISGVLQLLIRFVIR*************************LQQLFHLHDSGLDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLYIHGLGYENPVFEYEYPREDDGFPVSANGGI***********************************************NLEARRCYSMGSYQYVVADSELQVALCP*********************************************IWQ*********************************
***********************************ISPAILFIIVILAVVFFISGVLQLLIRFVIRR***********************************LDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLY**************************************************************************************MGSYQYVVAD***********************************************************************************A******
*********************************NKISPAILFIIVILAVVFFISGVLQLLIRFVIRR******************DAFQRQLQQLFHLHDSGLDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLYIHGLGYENPVFEYEYPREDDGFPVSANGGIGASLGLKPAENDIRSEKRVFSVRLGKFRSSNDGSEGIERVEGETSCSNLEARRCYSMGSYQYVVADSELQVALCPRRGGSASVRFGK************GDVEGKKINFRSKGESFSVSKIWQWS*******************VGLPRANDTESS
********L************************NKISPAILFIIVILAVVFFISGVLQLLIRFVIRRR*********************RQLQQLFHLHDSGLDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLY**********************************************KRVFSVRLGKF*********************LEARRCYSMGSYQYVVADSELQVALCP**************************************ESFSVSKIWQWSK******************************
ooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYFPSHSLLASAPSSSSSLPYNSDYQKESSSGNKISPAILFIIVILAVVFFISGVLQLLIRFVIRRRSSSSVSESNRFPEMSGSDAFQRQLQQLFHLHDSGLDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLYIHGLGYENPVFEYEYPREDDGFPVSANGGIGASLGLKPAENDIRSEKRVFSVRLGKFRSSNDGSEGIERVEGETSCSNLEARRCYSMGSYQYVVADSELQVALCPRRGGSASVRFGKGRSAQNDNSSNDGDVEGKKINFRSKGESFSVSKIWQWSKKSKFPSSSETHMGSSSGTVGLPRANDTESS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query360 2.2.26 [Sep-21-2011]
Q8GW38369 RING-H2 finger protein AT yes no 0.797 0.777 0.616 6e-95
Q9FL07376 RING-H2 finger protein AT no no 0.858 0.821 0.568 1e-94
Q7X843349 RING-H2 finger protein AT no no 0.691 0.713 0.438 9e-50
Q9ZV53423 Putative RING-H2 finger p no no 0.819 0.697 0.418 2e-48
Q940Q4472 RING-H2 finger protein AT no no 0.677 0.516 0.423 7e-47
Q9FHG8210 Putative RING-H2 finger p no no 0.358 0.614 0.482 1e-34
Q8W571323 RING-H2 finger protein AT no no 0.505 0.563 0.325 3e-24
O64763378 E3 ubiquitin-protein liga no no 0.380 0.362 0.378 3e-23
Q9SRQ8356 RING-H2 finger protein AT no no 0.372 0.376 0.379 4e-23
Q5EAE9407 RING-H2 finger protein AT no no 0.511 0.452 0.325 5e-22
>sp|Q8GW38|ATL47_ARATH RING-H2 finger protein ATL47 OS=Arabidopsis thaliana GN=ATL47 PE=2 SV=1 Back     alignment and function desciption
 Score =  347 bits (891), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 196/318 (61%), Positives = 232/318 (72%), Gaps = 31/318 (9%)

Query: 33  GNKISPAILFIIVILAVVFFISGVLQLLIRFVIRRRSS---SSVSESNRFPEMSGSDAFQ 89
            N+ISP ILFIIV+L+V+FFI  +L LL+R+ ++++ S   SS +ESN+ PE S SD +Q
Sbjct: 46  NNRISPIILFIIVLLSVIFFICSILHLLVRYYLKKKRSNLSSSPNESNQNPEFSDSDTYQ 105

Query: 90  RQLQQLFHLHDSGLDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSH 149
           RQLQQLFHLHDSGLDQA IDALPVFLY+EI G KEPFDCAVCLCEFSE DKLRLLP CSH
Sbjct: 106 RQLQQLFHLHDSGLDQALIDALPVFLYKEIKGTKEPFDCAVCLCEFSEDDKLRLLPNCSH 165

Query: 150 AFHIDCIDTWLLSNSTCPLCRGNLYIHGLGYENPVFEYEYPREDDGFPVSANGGIGASLG 209
           AFHIDCIDTWLLSNSTCPLCRG L+  G  +E P F + +            GG+  S  
Sbjct: 166 AFHIDCIDTWLLSNSTCPLCRGTLFSLGHQFEYPDFNFGFFAG-----DDGGGGVRVSPV 220

Query: 210 LKPAENDIRSEKRVFSVRLGKFRSSN--DGSEGIERVEGETSCSNLEARRCYSMGSYQYV 267
            KPAEN+I   KRVFSVRLGKFRSSN  +  E +    GETS S+L+ RRC+SMGSYQY+
Sbjct: 221 QKPAENEI--GKRVFSVRLGKFRSSNIVNNGEVVVGGGGETSSSSLDNRRCFSMGSYQYI 278

Query: 268 VADSELQVALCPRRGGSASVRFGKGRSAQNDNSSNDGDVEGKKINFRSKGESFSVSKIWQ 327
           VA+S+L VALCP                 N+   N+ DVEGKKIN RSKGESFSVSKIWQ
Sbjct: 279 VAESDLVVALCP----------------NNEGLKNNKDVEGKKINMRSKGESFSVSKIWQ 322

Query: 328 WS-KKSKFPSS--SETHM 342
           WS K+SKFP++  SET++
Sbjct: 323 WSNKRSKFPNNHPSETNL 340





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FL07|ATL46_ARATH RING-H2 finger protein ATL46 OS=Arabidopsis thaliana GN=ATL46 PE=2 SV=1 Back     alignment and function description
>sp|Q7X843|ATL48_ARATH RING-H2 finger protein ATL48 OS=Arabidopsis thaliana GN=ATL48 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZV53|ATL49_ARATH Putative RING-H2 finger protein ATL49 OS=Arabidopsis thaliana GN=ATL49 PE=3 SV=1 Back     alignment and function description
>sp|Q940Q4|ATL13_ARATH RING-H2 finger protein ATL13 OS=Arabidopsis thaliana GN=ATL13 PE=2 SV=2 Back     alignment and function description
>sp|Q9FHG8|ATL50_ARATH Putative RING-H2 finger protein ATL50 OS=Arabidopsis thaliana GN=ATL50 PE=3 SV=1 Back     alignment and function description
>sp|Q8W571|ATL32_ARATH RING-H2 finger protein ATL32 OS=Arabidopsis thaliana GN=ATL32 PE=2 SV=3 Back     alignment and function description
>sp|O64763|ATL9_ARATH E3 ubiquitin-protein ligase ATL9 OS=Arabidopsis thaliana GN=ATL9 PE=1 SV=1 Back     alignment and function description
>sp|Q9SRQ8|ATL51_ARATH RING-H2 finger protein ATL51 OS=Arabidopsis thaliana GN=ATL51 PE=2 SV=2 Back     alignment and function description
>sp|Q5EAE9|ATL43_ARATH RING-H2 finger protein ATL43 OS=Arabidopsis thaliana GN=ATL43 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
255560019374 ring finger protein, putative [Ricinus c 0.930 0.895 0.741 1e-136
359473435393 PREDICTED: RING-H2 finger protein ATL46- 0.927 0.849 0.662 1e-120
356526834384 PREDICTED: RING-H2 finger protein ATL46- 0.888 0.833 0.677 1e-113
356502008380 PREDICTED: RING-H2 finger protein ATL46- 0.891 0.844 0.650 1e-113
356565924384 PREDICTED: RING-H2 finger protein ATL46- 0.894 0.838 0.663 1e-111
357485971368 RING finger protein [Medicago truncatula 0.930 0.910 0.635 1e-108
255552646376 ring finger protein, putative [Ricinus c 0.922 0.882 0.606 1e-108
356497876376 PREDICTED: RING-H2 finger protein ATL47- 0.916 0.877 0.626 1e-107
147860397 1090 hypothetical protein VITISV_043284 [Viti 0.902 0.298 0.614 1e-105
359488718397 PREDICTED: RING-H2 finger protein ATL46- 0.902 0.818 0.617 1e-105
>gi|255560019|ref|XP_002521028.1| ring finger protein, putative [Ricinus communis] gi|223539865|gb|EEF41445.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  492 bits (1266), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 255/344 (74%), Positives = 290/344 (84%), Gaps = 9/344 (2%)

Query: 22  YNSDYQKESSSGNKISPAILFIIVILAVVFFISGVLQLLIRFVIRRRSSSSVSES--NRF 79
           YNSDYQK+SSSGNKISPAILFIIVILAV+FFISG+L LL+RF+I+ RSSSS S S  NR+
Sbjct: 35  YNSDYQKQSSSGNKISPAILFIIVILAVIFFISGLLHLLVRFLIKHRSSSSSSVSESNRY 94

Query: 80  PEMSGSDAFQRQLQQLFHLHDSGLDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQD 139
           PEMSGSDAFQRQLQQLFHLHDSGLDQAFIDALPVFLY+EIMGLKEPFDCAVCLCE+SE+D
Sbjct: 95  PEMSGSDAFQRQLQQLFHLHDSGLDQAFIDALPVFLYKEIMGLKEPFDCAVCLCEYSEKD 154

Query: 140 KLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLYIHGLGYENPVFEYEYPREDDGFPVS 199
           KLRLLP CSHAFHIDCIDTWLLSNSTCPLCRG LY  GL +ENPVF++E  RE++G  +S
Sbjct: 155 KLRLLPACSHAFHIDCIDTWLLSNSTCPLCRGTLYTPGLSFENPVFDFEESREEEG--LS 212

Query: 200 ANGGIGASLGLKPAENDIRSEKRVFSVRLGKFRSSNDGSEGIERVEGETSCSNLEARRCY 259
           +N G G S+G KPAEN+  + KRVFSVRLGKF+SSN   + +  VEGETS SNL+ARRC+
Sbjct: 213 SNVGNGISVGQKPAENERINSKRVFSVRLGKFKSSNVEVDRV--VEGETSSSNLDARRCF 270

Query: 260 SMGSYQYVVADSELQVALCPRRG-GSASVRFGKGRSAQNDN-SSND-GDVEGKKINFRSK 316
           SMGSYQYVVAD  LQVALCP R  G+ S +  K ++ QN N SSND GD EGKKIN RSK
Sbjct: 271 SMGSYQYVVADLNLQVALCPGRNVGTGSFKLVKSKNGQNGNTSSNDIGDAEGKKINIRSK 330

Query: 317 GESFSVSKIWQWSKKSKFPSSSETHMGSSSGTVGLPRANDTESS 360
           GESFSVSKIWQWS+K K PSSS+T+MGSS   VGLP ++ T  +
Sbjct: 331 GESFSVSKIWQWSRKGKLPSSSDTYMGSSPLAVGLPWSDRTHCT 374




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359473435|ref|XP_002265075.2| PREDICTED: RING-H2 finger protein ATL46-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356526834|ref|XP_003532021.1| PREDICTED: RING-H2 finger protein ATL46-like [Glycine max] Back     alignment and taxonomy information
>gi|356502008|ref|XP_003519814.1| PREDICTED: RING-H2 finger protein ATL46-like [Glycine max] Back     alignment and taxonomy information
>gi|356565924|ref|XP_003551186.1| PREDICTED: RING-H2 finger protein ATL46-like [Glycine max] Back     alignment and taxonomy information
>gi|357485971|ref|XP_003613273.1| RING finger protein [Medicago truncatula] gi|355514608|gb|AES96231.1| RING finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255552646|ref|XP_002517366.1| ring finger protein, putative [Ricinus communis] gi|223543377|gb|EEF44908.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356497876|ref|XP_003517782.1| PREDICTED: RING-H2 finger protein ATL47-like [Glycine max] Back     alignment and taxonomy information
>gi|147860397|emb|CAN80445.1| hypothetical protein VITISV_043284 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488718|ref|XP_003633804.1| PREDICTED: RING-H2 finger protein ATL46-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
TAIR|locus:2173772376 AT5G40250 [Arabidopsis thalian 0.811 0.776 0.490 9.4e-66
TAIR|locus:2199902369 AT1G23980 [Arabidopsis thalian 0.802 0.783 0.486 3e-62
TAIR|locus:2118666 472 AT4G30400 [Arabidopsis thalian 0.4 0.305 0.5 1.2e-43
TAIR|locus:2054049423 MEE16 "maternal effect embryo 0.341 0.290 0.515 9.5e-42
TAIR|locus:2097890349 AT3G48030 "AT3G48030" [Arabido 0.366 0.378 0.503 1.4e-30
TAIR|locus:2172550210 AT5G57750 [Arabidopsis thalian 0.219 0.376 0.637 1.4e-25
TAIR|locus:2081907334 ATL4 "TOXICOS EN LEVADURA 4" [ 0.186 0.200 0.528 2.1e-22
TAIR|locus:2044742302 AT2G34990 [Arabidopsis thalian 0.225 0.268 0.477 1.1e-20
TAIR|locus:2140069323 AT4G40070 [Arabidopsis thalian 0.377 0.421 0.370 1.7e-20
TAIR|locus:2096444356 AT3G03550 [Arabidopsis thalian 0.191 0.193 0.579 5.8e-20
TAIR|locus:2173772 AT5G40250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 669 (240.6 bits), Expect = 9.4e-66, P = 9.4e-66
 Identities = 156/318 (49%), Positives = 189/318 (59%)

Query:    31 SSGNKISPXXXXXXXXXXXXXXXSGVLQLLXXXXXXXXXXXXXXXXXXXPEMSGSDAXXX 90
             SSGN+ISP               SG+L LL                   PE+S SDA   
Sbjct:    36 SSGNRISPAVLFVIVILAVLFFISGLLHLLVRFLIKHPSATASSRSNRFPEISTSDALQR 95

Query:    91 XXXXXXXXXDSGLDQAFIDALPVFLYREIMG----------LKEPFDCAVCLCEFSEQDK 140
                      DSGLDQAFIDALPVF Y+EI+G           +EPFDCAVCLCEFSE+DK
Sbjct:    96 QLQQLFHLNDSGLDQAFIDALPVFHYKEIVGSAGGGGGNGAAQEPFDCAVCLCEFSEKDK 155

Query:   141 LRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLYIHGLGYENPVFEYEYPREDDGFPVSA 200
             LRLLPMCSHAFH++CIDTWL SNSTCPLCRG L+  G   ENP+F+++  RED+   V+ 
Sbjct:   156 LRLLPMCSHAFHLNCIDTWLQSNSTCPLCRGTLFSPGFSMENPMFDFDDIREDEE-GVTE 214

Query:   201 NGGIGASLGLKPAE-NDIRSEKRVFSVRLGKF-RSSNDGS-EGIERVEG-ETSCSNLEAR 256
             NG        K  E  +I  EK V  VRLGKF R  N G+ +G + V G ETS SNL+AR
Sbjct:   215 NGS------QKTMEIQEIVVEKGVLPVRLGKFKRLDNVGNGQGQDVVAGGETSSSNLDAR 268

Query:   257 RCYSMGSYQYVVADSELQVALCPRRGGSASVRFGKGRSAQNDNSSNDGDVEGKKINFRSK 316
             RC+SMGSYQY++ +SEL+V     R      R  K +  +++ + N    + KKIN  +K
Sbjct:   269 RCFSMGSYQYILGNSELKVPFANDR----LPRL-KPQDKESEQTGNSSSEDNKKINTVAK 323

Query:   317 GESFSVSKIWQWSKKSKF 334
             GESFSVSKIW W KK KF
Sbjct:   324 GESFSVSKIWLWPKKDKF 341




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2199902 AT1G23980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118666 AT4G30400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054049 MEE16 "maternal effect embryo arrest 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097890 AT3G48030 "AT3G48030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172550 AT5G57750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081907 ATL4 "TOXICOS EN LEVADURA 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044742 AT2G34990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140069 AT4G40070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096444 AT3G03550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GW38ATL47_ARATHNo assigned EC number0.61630.79720.7777yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_LG_I000838
hypothetical protein (318 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-17
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-12
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 3e-11
smart0018440 smart00184, RING, Ring finger 5e-09
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 9e-09
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-08
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 7e-08
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 4e-07
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-05
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 8e-05
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 3e-04
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 8e-04
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 73.6 bits (181), Expect = 5e-17
 Identities = 22/45 (48%), Positives = 32/45 (71%), Gaps = 1/45 (2%)

Query: 126 FDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCR 170
            +C +CL EF   +++ +LP C H FH +C+D WL S++TCPLCR
Sbjct: 1   DECPICLDEFEPGEEVVVLP-CGHVFHKECLDKWLRSSNTCPLCR 44


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 360
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.73
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.43
PHA02929238 N1R/p28-like protein; Provisional 99.38
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.26
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.19
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.11
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.84
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.83
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.81
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.8
PHA02926242 zinc finger-like protein; Provisional 98.79
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.75
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.74
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.74
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.73
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.65
PF1463444 zf-RING_5: zinc-RING finger domain 98.57
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.53
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.5
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.49
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.46
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.46
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.46
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.35
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.33
COG52191525 Uncharacterized conserved protein, contains RING Z 98.24
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.18
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.15
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.06
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.04
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.04
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.99
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.99
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.97
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.87
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.85
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.83
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.81
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.74
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.71
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.65
KOG4445368 consensus Uncharacterized conserved protein, conta 97.61
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.59
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.58
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.32
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.23
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.15
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.13
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.09
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.91
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.55
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.55
KOG1941518 consensus Acetylcholine receptor-associated protei 96.52
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.49
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.47
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.33
COG5152259 Uncharacterized conserved protein, contains RING a 96.29
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.08
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.74
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.65
COG5222427 Uncharacterized conserved protein, contains RING Z 95.65
KOG2660331 consensus Locus-specific chromosome binding protei 95.62
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.61
KOG1002791 consensus Nucleotide excision repair protein RAD16 95.56
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.44
PHA03096284 p28-like protein; Provisional 95.4
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.29
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.11
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.0
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.96
KOG4739233 consensus Uncharacterized protein involved in syna 94.81
PF04641260 Rtf2: Rtf2 RING-finger 94.79
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.68
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 94.6
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.57
PHA02825162 LAP/PHD finger-like protein; Provisional 94.5
PHA02862156 5L protein; Provisional 94.41
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 94.33
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 94.24
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 93.25
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 92.87
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 92.79
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 91.77
COG5236 493 Uncharacterized conserved protein, contains RING Z 91.28
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 90.89
KOG1001674 consensus Helicase-like transcription factor HLTF/ 90.59
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 90.12
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 90.03
PF10272358 Tmpp129: Putative transmembrane protein precursor; 88.94
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 88.9
KOG02981394 consensus DEAD box-containing helicase-like transc 88.29
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 88.2
KOG1940276 consensus Zn-finger protein [General function pred 88.18
KOG1829580 consensus Uncharacterized conserved protein, conta 88.08
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 87.74
KOG03091081 consensus Conserved WD40 repeat-containing protein 87.59
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 87.55
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 86.1
COG5175 480 MOT2 Transcriptional repressor [Transcription] 86.03
KOG1609323 consensus Protein involved in mRNA turnover and st 84.99
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 82.65
PF12273130 RCR: Chitin synthesis regulation, resistance to Co 82.39
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 81.77
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 81.67
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 81.32
KOG0825 1134 consensus PHD Zn-finger protein [General function 81.01
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.73  E-value=1.3e-17  Score=163.60  Aligned_cols=75  Identities=37%  Similarity=0.853  Sum_probs=65.4

Q ss_pred             CCCCHHHHhcCCcchhhhhcCCCCCCccccccCccccCccccccCCCCCccchhhhhhhhhcCCC-CCccccccccC
Q 038999          101 SGLDQAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNST-CPLCRGNLYIH  176 (360)
Q Consensus       101 ~gl~~~~i~~Lp~~~~~~~~~~~~~~~C~ICle~f~~~~~~~~lp~C~H~FH~~CI~~Wl~~~~t-CP~CR~~l~~~  176 (360)
                      ..+.+..+.++|+.+|......+....|+||||+|+.++++|+|| |+|.||..||++||.++.+ ||+|++++...
T Consensus       205 ~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLP-C~H~FH~~CIDpWL~~~r~~CPvCK~di~~~  280 (348)
T KOG4628|consen  205 NRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILP-CSHKFHVNCIDPWLTQTRTFCPVCKRDIRTD  280 (348)
T ss_pred             hhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEec-CCCchhhccchhhHhhcCccCCCCCCcCCCC
Confidence            445678899999999988766555579999999999999999999 9999999999999998855 99999977654



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 9e-12
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 8e-10
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 1e-07
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 7e-07
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 5e-05
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 2e-04
2ecl_A81 Solution Structure Of The Ring Domain Of The Human 4e-04
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure

Iteration: 1

Score = 67.8 bits (164), Expect = 9e-12, Method: Composition-based stats. Identities = 25/44 (56%), Positives = 32/44 (72%) Query: 127 DCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCR 170 +CAVCL E + ++ R LP C H FH +C+D WL S+STCPLCR Sbjct: 7 ECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCR 50
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|2ECL|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring-Box Protein 2 Length = 81 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 6e-35
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 3e-31
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 7e-30
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 7e-25
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-22
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 5e-22
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-19
2ecm_A55 Ring finger and CHY zinc finger domain- containing 5e-18
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-17
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 8e-16
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 3e-14
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 2e-13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 8e-13
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 4e-12
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 5e-12
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-11
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-09
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 7e-09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-05
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 4e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 8e-08
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 9e-08
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 4e-07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 5e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 8e-07
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 6e-06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 1e-05
3nw0_A238 Non-structural maintenance of chromosomes element 3e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 3e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 4e-05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-04
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 3e-04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 4e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 5e-04
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 5e-04
1z6u_A150 NP95-like ring finger protein isoform B; structura 6e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score =  122 bits (307), Expect = 6e-35
 Identities = 26/69 (37%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 105 QAFIDALPVFLYREIMGLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNS 164
                 LP + +       E   C VC+C+F  +  LR+LP C+H FH  C+D WL +N 
Sbjct: 3   SGSSGQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLKANR 61

Query: 165 TCPLCRGNL 173
           TCP+CR + 
Sbjct: 62  TCPICRADS 70


>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.62
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.59
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.5
2ect_A78 Ring finger protein 126; metal binding protein, st 99.46
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.44
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.43
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.41
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.37
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.34
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.31
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.3
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.29
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.28
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.27
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.27
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.22
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.21
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.2
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.2
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.18
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.16
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.15
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.15
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.15
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.13
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.11
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.11
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.11
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.08
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.03
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.02
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.01
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.01
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.99
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.97
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.97
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.95
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.95
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.95
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.89
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.89
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.86
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.86
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.85
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.83
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.82
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.82
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.82
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.81
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.8
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.76
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.75
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.71
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.66
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.65
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.64
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.6
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.57
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.55
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.51
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.46
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.43
2ea5_A68 Cell growth regulator with ring finger domain prot 98.43
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.42
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.34
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.26
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.24
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.11
3nw0_A238 Non-structural maintenance of chromosomes element 97.83
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.82
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.04
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.07
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 92.25
1we9_A64 PHD finger family protein; structural genomics, PH 89.35
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 89.01
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.59
1wil_A89 KIAA1045 protein; ring finger domain, structural g 88.33
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 87.82
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 86.84
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 86.68
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 85.13
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 85.01
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 84.01
2k16_A75 Transcription initiation factor TFIID subunit 3; p 82.9
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 82.72
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 82.47
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 81.73
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 81.62
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 81.31
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 81.07
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.62  E-value=2.4e-16  Score=126.01  Aligned_cols=76  Identities=34%  Similarity=0.706  Sum_probs=66.4

Q ss_pred             cCCCCCHHHHhcCCcchhhhhcC-CCCCCccccccCccccCccccccCCCCCccchhhhhhhhhcCCCCCcccccccc
Q 038999           99 HDSGLDQAFIDALPVFLYREIMG-LKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLYI  175 (360)
Q Consensus        99 ~~~gl~~~~i~~Lp~~~~~~~~~-~~~~~~C~ICle~f~~~~~~~~lp~C~H~FH~~CI~~Wl~~~~tCP~CR~~l~~  175 (360)
                      ...+++++.|+.||.+.+..... ..+...|+||++.|..++.++.++ |+|.||..||..|+..+.+||+||+.+..
T Consensus        13 ~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~-C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           13 ANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELP-CHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             CCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEET-TTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecC-CCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            35789999999999998876543 345678999999999999899999 99999999999999999999999998754



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 360
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 7e-21
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 8e-13
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-11
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 4e-11
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-10
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 6e-09
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 2e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-07
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 1e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 8e-06
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 1e-05
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 9e-04
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 82.6 bits (204), Expect = 7e-21
 Identities = 25/55 (45%), Positives = 36/55 (65%)

Query: 121 GLKEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLYI 175
            + +  +CAVCL E  + ++ R LP C H FH +C+D WL S+STCPLCR  + +
Sbjct: 1   AMDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVVV 55


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.64
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.37
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.37
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.34
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.32
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.26
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.16
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.05
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.01
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.0
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.98
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.91
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.79
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.75
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.69
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.36
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 93.28
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 91.61
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 90.94
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 87.21
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 87.19
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 84.92
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 84.0
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 81.53
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 80.46
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 80.09
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.64  E-value=4.4e-17  Score=117.79  Aligned_cols=52  Identities=48%  Similarity=1.117  Sum_probs=47.2

Q ss_pred             CCCCccccccCccccCccccccCCCCCccchhhhhhhhhcCCCCCccccccc
Q 038999          123 KEPFDCAVCLCEFSEQDKLRLLPMCSHAFHIDCIDTWLLSNSTCPLCRGNLY  174 (360)
Q Consensus       123 ~~~~~C~ICle~f~~~~~~~~lp~C~H~FH~~CI~~Wl~~~~tCP~CR~~l~  174 (360)
                      ++..+|+||+++|..++.+..++.|+|.||..||..||..+.+||+||++|.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            4556899999999999988887679999999999999999999999999874



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure