Citrus Sinensis ID: 039029


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEARRLLDQMKRRGIKPDHISFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITPDDNTYFSLIEGIASVDKAAESSNS
cccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccc
cccccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHccc
mksrgvqpdsytygsfvsgmckeGRLEEASRMLEQMKenglvptavTYNTLIDGYCNKGNLEMAFSFRDEMVkqgimptasTYNLLIHELLMERKMVEADDMLKEmgekgivpdsitYNILINGycrcgnakkaFSLHDEMihkgiqptmLTYTSLIFVLSKQNRMIEADQLFENFLakgmlpdiVMFNALIDGHCTNGNIERAFSLLKEmdrmkvhpdevtyntlmhgrcrqGKVEEARRLLDQMKrrgikpdhisfnptrLTYNALIQGLCKNQEGDLAEELLREMVSkgitpddntyFSLIEGIASVDKAAESSNS
mksrgvqpdsytygsfvsgmcKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDevtyntlmhgrcrqgkvEEARRLLDQMKrrgikpdhisfnptRLTYNALIQGLCKNQEGDLAEELLREMVSKgitpddntyFSLIEGIAsvdkaaessns
MKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEARRLLDQMKRRGIKPDHISFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITPDDNTYFSLIEGIASVDKAAESSNS
************YGSFVSG*******************NGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKV****RLL******GIKPDHISFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITPDDNTYFSLIEGIA***********
***RGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEARRLLDQMKRRGIKPDHISFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITPDDNTYFSLIEGIASVDKAAES***
*********SYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEARRLLDQMKRRGIKPDHISFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITPDDNTYFSLIEGIASV*********
****GVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEARRLLDQMKRRGIKPDHISFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITPDDNTYFSLIEGIASVDK*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEARRLLDQMKRRGIKPDHISFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITPDDNTYFSLIEGIASVDKAAESSNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query319 2.2.26 [Sep-21-2011]
Q9ZQF1627 Pentatricopeptide repeat- yes no 0.984 0.500 0.579 1e-111
Q0WVK7 741 Pentatricopeptide repeat- no no 0.934 0.402 0.373 6e-60
Q9FIX3 747 Pentatricopeptide repeat- no no 0.959 0.409 0.361 3e-58
O04504606 Pentatricopeptide repeat- no no 0.934 0.491 0.352 8e-55
Q9CAN5614 Pentatricopeptide repeat- no no 0.968 0.503 0.353 1e-54
Q3EDF8598 Pentatricopeptide repeat- no no 0.968 0.516 0.329 7e-54
Q6NQ83619 Pentatricopeptide repeat- no no 0.937 0.483 0.339 2e-53
Q9LFC5729 Pentatricopeptide repeat- no no 0.990 0.433 0.312 4e-53
Q9CAN0630 Pentatricopeptide repeat- no no 0.968 0.490 0.343 4e-53
O04491607 Putative pentatricopeptid no no 0.946 0.497 0.321 5e-53
>sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 Back     alignment and function desciption
 Score =  400 bits (1027), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/347 (57%), Positives = 254/347 (73%), Gaps = 33/347 (9%)

Query: 1   MKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGN 60
           MKS+G QPD  TY   +S MC EGR   AS +L +MKE GLVP +V+YN LI G  N G+
Sbjct: 286 MKSKGFQPDMQTYNPILSWMCNEGR---ASEVLREMKEIGLVPDSVSYNILIRGCSNNGD 342

Query: 61  LEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNI 120
           LEMAF++RDEMVKQG++PT  TYN LIH L ME K+  A+ +++E+ EKGIV DS+TYNI
Sbjct: 343 LEMAFAYRDEMVKQGMVPTFYTYNTLIHGLFMENKIEAAEILIREIREKGIVLDSVTYNI 402

Query: 121 LINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKG 180
           LINGYC+ G+AKKAF+LHDEM+  GIQPT  TYTSLI+VL ++N+  EAD+LFE  + KG
Sbjct: 403 LINGYCQHGDAKKAFALHDEMMTDGIQPTQFTYTSLIYVLCRKNKTREADELFEKVVGKG 462

Query: 181 MLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEAR 240
           M PD+VM N L+DGHC  GN++RAFSLLKEMD M ++PD+VTYN LM G C +GK EEAR
Sbjct: 463 MKPDLVMMNTLMDGHCAIGNMDRAFSLLKEMDMMSINPDDVTYNCLMRGLCGEGKFEEAR 522

Query: 241 RLLDQMKRRGIKPDHIS----------------------------FNPTRLTYNALIQGL 272
            L+ +MKRRGIKPDHIS                            FNPT LTYNAL++GL
Sbjct: 523 ELMGEMKRRGIKPDHISYNTLISGYSKKGDTKHAFMVRDEMLSLGFNPTLLTYNALLKGL 582

Query: 273 CKNQEGDLAEELLREMVSKGITPDDNTYFSLIEGIASVDKAAESSNS 319
            KNQEG+LAEELLREM S+GI P+D+++ S+IE ++++D  A+ S+S
Sbjct: 583 SKNQEGELAEELLREMKSEGIVPNDSSFCSVIEAMSNLD--AKKSDS 627





Arabidopsis thaliana (taxid: 3702)
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 Back     alignment and function description
>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 Back     alignment and function description
>sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query319
255556189 643 pentatricopeptide repeat-containing prot 1.0 0.496 0.703 1e-143
224123236 590 predicted protein [Populus trichocarpa] 0.974 0.527 0.699 1e-139
225447872 656 PREDICTED: pentatricopeptide repeat-cont 1.0 0.486 0.680 1e-138
296081530 634 unnamed protein product [Vitis vinifera] 1.0 0.503 0.680 1e-138
147834641 580 hypothetical protein VITISV_016343 [Viti 1.0 0.55 0.677 1e-137
449438705 628 PREDICTED: pentatricopeptide repeat-cont 1.0 0.507 0.645 1e-131
449523421 628 PREDICTED: pentatricopeptide repeat-cont 1.0 0.507 0.645 1e-131
356544498 623 PREDICTED: pentatricopeptide repeat-cont 0.974 0.499 0.651 1e-129
357473123 624 Pentatricopeptide repeat-containing prot 0.996 0.509 0.595 1e-115
15226583 627 pentatricopeptide repeat-containing prot 0.984 0.500 0.579 1e-109
>gi|255556189|ref|XP_002519129.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541792|gb|EEF43340.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 244/347 (70%), Positives = 284/347 (81%), Gaps = 28/347 (8%)

Query: 1   MKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGN 60
           MK+RGV+PDSYTYGS +SGMCK G+LEEAS +LE+MKE GL+PTAVTYNTLIDGYCNKG+
Sbjct: 297 MKNRGVEPDSYTYGSLISGMCKGGKLEEASGILEKMKEIGLLPTAVTYNTLIDGYCNKGD 356

Query: 61  LEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNI 120
           L  AF +RDEMV++ I+PT STYNLLIH L +E KM EAD M+K+MG+ GIVPDSITYNI
Sbjct: 357 LVKAFGYRDEMVRRAILPTVSTYNLLIHALFLEGKMDEADGMIKDMGDSGIVPDSITYNI 416

Query: 121 LINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKG 180
           LINGYCRCGNAKKAF+LHDEMI KGIQPT++TYTSLI+VLSK+NRM  AD LFE  + +G
Sbjct: 417 LINGYCRCGNAKKAFNLHDEMISKGIQPTLVTYTSLIYVLSKRNRMKAADDLFEKIIREG 476

Query: 181 MLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEAR 240
             PD++MFNALIDGHC NGN++RAF+LLKEMD+  + PDEVTYNTLM GRCR+GKVEEAR
Sbjct: 477 ASPDLIMFNALIDGHCANGNLDRAFALLKEMDKRNIVPDEVTYNTLMQGRCREGKVEEAR 536

Query: 241 RLLDQMKRRGIKPDHIS----------------------------FNPTRLTYNALIQGL 272
            LL +MKRRGI+PDHIS                            FNPT LTYNALIQGL
Sbjct: 537 ELLKEMKRRGIRPDHISYNTLISGYSKRGDINDAFTIRDEMLSIGFNPTLLTYNALIQGL 596

Query: 273 CKNQEGDLAEELLREMVSKGITPDDNTYFSLIEGIASVDKAAESSNS 319
           CKNQ+GDLAEELL+EMVSKGITPDD+TYFSLIEGI  VD ++E+S+S
Sbjct: 597 CKNQQGDLAEELLKEMVSKGITPDDSTYFSLIEGIGKVDDSSEASDS 643




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224123236|ref|XP_002330266.1| predicted protein [Populus trichocarpa] gi|222871301|gb|EEF08432.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225447872|ref|XP_002269015.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081530|emb|CBI20053.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147834641|emb|CAN60904.1| hypothetical protein VITISV_016343 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449438705|ref|XP_004137128.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449523421|ref|XP_004168722.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356544498|ref|XP_003540687.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357473123|ref|XP_003606846.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355507901|gb|AES89043.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|15226583|ref|NP_179165.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75216226|sp|Q9ZQF1.1|PP152_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g15630, mitochondrial; Flags: Precursor gi|4335729|gb|AAD17407.1| putative salt-inducible protein [Arabidopsis thaliana] gi|330251331|gb|AEC06425.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query319
TAIR|locus:2053552627 AT2G15630 "AT2G15630" [Arabido 0.934 0.475 0.581 1.1e-89
TAIR|locus:2164910 747 EMB2745 "EMBRYO DEFECTIVE 2745 0.952 0.406 0.363 2.3e-55
TAIR|locus:2015228614 AT1G63080 [Arabidopsis thalian 0.968 0.503 0.353 1.9e-51
TAIR|locus:2024301606 AT1G09820 "AT1G09820" [Arabido 0.971 0.511 0.352 2.4e-51
TAIR|locus:2024296598 AT1G09900 "AT1G09900" [Arabido 0.968 0.516 0.329 8.3e-51
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.931 0.479 0.342 2.8e-50
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.968 0.490 0.343 5.8e-50
TAIR|locus:2024367607 AT1G09680 "AT1G09680" [Arabido 0.918 0.482 0.326 8.5e-49
TAIR|locus:2083976 754 MEE40 "maternal effect embryo 0.959 0.405 0.341 2.1e-48
TAIR|locus:2203916634 AT1G62590 [Arabidopsis thalian 0.968 0.487 0.334 3.7e-48
TAIR|locus:2053552 AT2G15630 "AT2G15630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 895 (320.1 bits), Expect = 1.1e-89, P = 1.1e-89
 Identities = 179/308 (58%), Positives = 225/308 (73%)

Query:     1 MKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGN 60
             MKS+G QPD  TY   +S MC EGR   AS +L +MKE GLVP +V+YN LI G  N G+
Sbjct:   286 MKSKGFQPDMQTYNPILSWMCNEGR---ASEVLREMKEIGLVPDSVSYNILIRGCSNNGD 342

Query:    61 LEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNI 120
             LEMAF++RDEMVKQG++PT  TYN LIH L ME K+  A+ +++E+ EKGIV DS+TYNI
Sbjct:   343 LEMAFAYRDEMVKQGMVPTFYTYNTLIHGLFMENKIEAAEILIREIREKGIVLDSVTYNI 402

Query:   121 LINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKG 180
             LINGYC+ G+AKKAF+LHDEM+  GIQPT  TYTSLI+VL ++N+  EAD+LFE  + KG
Sbjct:   403 LINGYCQHGDAKKAFALHDEMMTDGIQPTQFTYTSLIYVLCRKNKTREADELFEKVVGKG 462

Query:   181 MLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEAR 240
             M PD+VM N L+DGHC  GN++RAFSLLKEMD M ++PD+VTYN LM G C +GK EEAR
Sbjct:   463 MKPDLVMMNTLMDGHCAIGNMDRAFSLLKEMDMMSINPDDVTYNCLMRGLCGEGKFEEAR 522

Query:   241 RLLDQMKRRGIKPDHISFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITPDDNTY 300
              L+ +MKRRGIKPDHIS       YN LI G  K  +   A  +  EM+S G  P   TY
Sbjct:   523 ELMGEMKRRGIKPDHIS-------YNTLISGYSKKGDTKHAFMVRDEMLSLGFNPTLLTY 575

Query:   301 FSLIEGIA 308
              +L++G++
Sbjct:   576 NALLKGLS 583


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024301 AT1G09820 "AT1G09820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024296 AT1G09900 "AT1G09900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024367 AT1G09680 "AT1G09680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203916 AT1G62590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.130.18.1
hypothetical protein (590 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-33
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-29
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-25
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-20
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-17
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-16
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-15
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-14
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-10
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-10
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-09
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-09
pfam0153531 pfam01535, PPR, PPR repeat 1e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-07
pfam0153531 pfam01535, PPR, PPR repeat 6e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-06
pfam0153531 pfam01535, PPR, PPR repeat 2e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 3e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 9e-06
pfam0153531 pfam01535, PPR, PPR repeat 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 4e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-05
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  130 bits (328), Expect = 1e-33
 Identities = 84/305 (27%), Positives = 141/305 (46%), Gaps = 15/305 (4%)

Query: 1   MKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGN 60
           ++  G++ D   Y + +S   K G+++    +  +M   G+     T+  LIDG    G 
Sbjct: 463 VQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQ 522

Query: 61  LEMAFSFRDEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMG--EKGIVPDSITY 118
           +  AF     M  + + P    +N LI        +  A D+L EM      I PD IT 
Sbjct: 523 VAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITV 582

Query: 119 NILINGYCRCGNAKKAFSLHDEMIHK-GIQPTMLTYTSLIFVLSKQNRMIEADQLFENFL 177
             L+      G   +A  ++ +MIH+  I+ T   YT  +   S++     A  ++++  
Sbjct: 583 GALMKACANAGQVDRAKEVY-QMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMK 641

Query: 178 AKGMLPDIVMFNALID--GHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGK 235
            KG+ PD V F+AL+D  GH   G++++AF +L++  +  +    V+Y++LM        
Sbjct: 642 KKGVKPDEVFFSALVDVAGHA--GDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKN 699

Query: 236 VEEARRLLDQMKRRGIKPDHISFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITP 295
            ++A  L + +K        I   PT  T NALI  LC+  +   A E+L EM   G+ P
Sbjct: 700 WKKALELYEDIKS-------IKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCP 752

Query: 296 DDNTY 300
           +  TY
Sbjct: 753 NTITY 757


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 319
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PRK11788389 tetratricopeptide repeat protein; Provisional 99.94
PRK11788389 tetratricopeptide repeat protein; Provisional 99.94
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.93
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.9
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.87
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.84
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.82
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.82
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.81
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.81
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.79
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.79
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.79
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.78
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.78
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.77
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.76
KOG1126638 consensus DNA-binding cell division cycle control 99.76
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.74
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.73
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.73
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.73
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.71
PRK14574 822 hmsH outer membrane protein; Provisional 99.7
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.7
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.7
PRK14574 822 hmsH outer membrane protein; Provisional 99.69
KOG1126638 consensus DNA-binding cell division cycle control 99.67
KOG2076 895 consensus RNA polymerase III transcription factor 99.64
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.64
PRK12370553 invasion protein regulator; Provisional 99.64
KOG2003 840 consensus TPR repeat-containing protein [General f 99.63
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.62
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.62
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.61
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.61
PRK12370553 invasion protein regulator; Provisional 99.61
KOG1129478 consensus TPR repeat-containing protein [General f 99.59
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.59
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.58
KOG1129478 consensus TPR repeat-containing protein [General f 99.57
KOG2076 895 consensus RNA polymerase III transcription factor 99.56
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.56
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.56
KOG0547606 consensus Translocase of outer mitochondrial membr 99.51
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.49
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.49
PF1304150 PPR_2: PPR repeat family 99.49
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.49
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.48
PRK11189296 lipoprotein NlpI; Provisional 99.47
PF1304150 PPR_2: PPR repeat family 99.46
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.42
KOG0547606 consensus Translocase of outer mitochondrial membr 99.42
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.42
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.42
PRK11189296 lipoprotein NlpI; Provisional 99.42
KOG2003840 consensus TPR repeat-containing protein [General f 99.4
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.4
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.37
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.32
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.32
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.31
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.31
KOG1125579 consensus TPR repeat-containing protein [General f 99.29
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.28
KOG1125579 consensus TPR repeat-containing protein [General f 99.19
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.19
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.18
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.18
PLN02789320 farnesyltranstransferase 99.16
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.16
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.15
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.14
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.12
PF1285434 PPR_1: PPR repeat 99.11
PLN02789320 farnesyltranstransferase 99.1
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.1
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.1
KOG1128777 consensus Uncharacterized conserved protein, conta 99.08
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.06
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.05
PRK10370198 formate-dependent nitrite reductase complex subuni 99.02
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.01
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.01
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.0
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.99
PRK10370198 formate-dependent nitrite reductase complex subuni 98.99
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.98
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.96
PRK04841 903 transcriptional regulator MalT; Provisional 98.95
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.9
PRK15359144 type III secretion system chaperone protein SscB; 98.88
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.87
PRK04841 903 transcriptional regulator MalT; Provisional 98.87
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.86
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.86
PRK15359144 type III secretion system chaperone protein SscB; 98.84
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.82
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 98.81
PF1285434 PPR_1: PPR repeat 98.81
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.8
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.79
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.79
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.75
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.75
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.74
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.7
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.7
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.67
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.66
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.66
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.64
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.62
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.62
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.61
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.61
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.61
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.59
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.55
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.53
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.53
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.51
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.5
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.49
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.48
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.47
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.46
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.46
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.45
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.41
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.39
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.36
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.36
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.34
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.33
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.32
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.3
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.29
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.28
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.23
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.23
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.21
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.2
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.19
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.18
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.18
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.18
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.18
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.18
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.17
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.17
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.15
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.15
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.14
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.14
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.13
KOG0553304 consensus TPR repeat-containing protein [General f 98.12
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.11
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.09
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.08
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.05
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.01
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.98
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.98
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.95
KOG0553304 consensus TPR repeat-containing protein [General f 97.95
PF12688120 TPR_5: Tetratrico peptide repeat 97.95
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.94
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.91
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.88
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.85
PF12688120 TPR_5: Tetratrico peptide repeat 97.84
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.83
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.82
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.81
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.79
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.78
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.76
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.7
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.67
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.67
PRK10803263 tol-pal system protein YbgF; Provisional 97.63
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.62
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.59
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.59
PRK10803263 tol-pal system protein YbgF; Provisional 97.57
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.56
PF1337173 TPR_9: Tetratricopeptide repeat 97.5
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.47
COG4700251 Uncharacterized protein conserved in bacteria cont 97.43
COG4700251 Uncharacterized protein conserved in bacteria cont 97.41
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.41
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.4
PRK15331165 chaperone protein SicA; Provisional 97.4
PF1337173 TPR_9: Tetratricopeptide repeat 97.39
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.31
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.29
PRK15331165 chaperone protein SicA; Provisional 97.26
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.23
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.16
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.09
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.09
smart00299140 CLH Clathrin heavy chain repeat homology. 97.08
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.08
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.02
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.0
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 96.98
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.9
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.88
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.85
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.85
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.8
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.77
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.7
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.67
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.57
PF13512142 TPR_18: Tetratricopeptide repeat 96.55
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.52
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.44
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.43
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.41
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.41
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.4
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.37
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.37
KOG4555175 consensus TPR repeat-containing protein [Function 96.37
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.36
KOG1585308 consensus Protein required for fusion of vesicles 96.33
KOG1585308 consensus Protein required for fusion of vesicles 96.31
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.29
KOG3941406 consensus Intermediate in Toll signal transduction 96.27
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.27
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.21
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.21
PF1342844 TPR_14: Tetratricopeptide repeat 96.1
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.08
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.06
KOG3941 406 consensus Intermediate in Toll signal transduction 96.03
PF1342844 TPR_14: Tetratricopeptide repeat 96.0
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.91
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.85
COG3629280 DnrI DNA-binding transcriptional activator of the 95.74
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.73
COG3898 531 Uncharacterized membrane-bound protein [Function u 95.65
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.59
KOG4555175 consensus TPR repeat-containing protein [Function 95.59
smart00299140 CLH Clathrin heavy chain repeat homology. 95.55
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.53
KOG4570 418 consensus Uncharacterized conserved protein [Funct 95.45
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.41
PRK11906458 transcriptional regulator; Provisional 95.39
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 95.38
COG3629280 DnrI DNA-binding transcriptional activator of the 95.34
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.26
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.18
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.14
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.08
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.05
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.04
KOG4570418 consensus Uncharacterized conserved protein [Funct 95.0
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.87
PF13512142 TPR_18: Tetratricopeptide repeat 94.87
PF13929292 mRNA_stabil: mRNA stabilisation 94.82
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.57
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.44
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.34
PRK11906458 transcriptional regulator; Provisional 94.23
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.22
PF1343134 TPR_17: Tetratricopeptide repeat 94.19
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.13
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.07
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.06
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.0
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 93.81
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.71
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.58
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.49
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.4
PF1343134 TPR_17: Tetratricopeptide repeat 93.36
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.34
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.3
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 93.26
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 93.23
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.09
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.9
PRK09687280 putative lyase; Provisional 92.82
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 92.8
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 92.52
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.4
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 92.36
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 92.34
KOG2471 696 consensus TPR repeat-containing protein [General f 92.32
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.12
COG4455273 ImpE Protein of avirulence locus involved in tempe 91.84
COG2976207 Uncharacterized protein conserved in bacteria [Fun 91.59
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.47
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 91.47
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 91.38
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.33
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 91.29
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 91.26
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 91.05
KOG1586288 consensus Protein required for fusion of vesicles 90.93
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.89
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.72
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 90.51
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.46
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.88
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.82
KOG4648 536 consensus Uncharacterized conserved protein, conta 89.58
COG2976207 Uncharacterized protein conserved in bacteria [Fun 89.43
KOG4234271 consensus TPR repeat-containing protein [General f 89.24
PF13762145 MNE1: Mitochondrial splicing apparatus component 88.96
KOG4234271 consensus TPR repeat-containing protein [General f 88.89
COG4455273 ImpE Protein of avirulence locus involved in tempe 88.68
KOG1550552 consensus Extracellular protein SEL-1 and related 88.29
KOG4648 536 consensus Uncharacterized conserved protein, conta 88.17
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.03
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 87.81
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.65
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 87.5
KOG1550552 consensus Extracellular protein SEL-1 and related 87.0
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 86.64
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 86.53
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 85.88
KOG2908 380 consensus 26S proteasome regulatory complex, subun 85.56
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 85.51
PF06552186 TOM20_plant: Plant specific mitochondrial import r 85.43
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.34
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 85.3
COG1747 711 Uncharacterized N-terminal domain of the transcrip 85.3
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 84.41
PF13929292 mRNA_stabil: mRNA stabilisation 84.04
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 83.74
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 83.69
KOG2063 877 consensus Vacuolar assembly/sorting proteins VPS39 83.06
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 82.0
COG3947361 Response regulator containing CheY-like receiver a 81.79
KOG2659228 consensus LisH motif-containing protein [Cytoskele 81.73
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 81.44
cd00280200 TRFH Telomeric Repeat binding Factor or TTAGGG Rep 81.13
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 80.71
COG3947361 Response regulator containing CheY-like receiver a 80.5
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 80.19
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.2e-56  Score=387.60  Aligned_cols=310  Identities=26%  Similarity=0.389  Sum_probs=289.5

Q ss_pred             CCCCCCCCCcccHHHHHHHHhccCChHHHHHHHHHHHhCCCCCCHHhHHHHHHHHHhcCChHHHHHHHHHHHHcCCCcCh
Q 039029            1 MKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIMPTA   80 (319)
Q Consensus         1 M~~~g~~p~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~   80 (319)
                      |++.|+.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||.
T Consensus       463 M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~  542 (1060)
T PLN03218        463 VQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDR  542 (1060)
T ss_pred             HHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCH
Confidence            56789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHcCchhHHHHHHHHHhh--CCCCCChHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCccHHHHHHHHH
Q 039029           81 STYNLLIHELLMERKMVEADDMLKEMGE--KGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIF  158 (319)
Q Consensus        81 ~~~~~l~~~~~~~~~~~~a~~~~~~~~~--~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~  158 (319)
                      .+|+.++.+|++.|++++|.++|++|..  .++.||..+|+.++.+|++.|++++|.++|++|.+.|++|+..+|+.++.
T Consensus       543 vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e~gi~p~~~tynsLI~  622 (1060)
T PLN03218        543 VVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVN  622 (1060)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCChHHHHHHHH
Confidence            9999999999999999999999999976  57889999999999999999999999999999999999999999999999


Q ss_pred             HHhhhccHHHHHHHHHHHhhCCCCccHHHHHHHHHHHhcCCcHHHHHHHHHHHHhCCCCCChhhHHHHHHHHHcCCcHHH
Q 039029          159 VLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEE  238 (319)
Q Consensus       159 ~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  238 (319)
                      +|++.|++++|.++|++|.+.|+.||..+|+.++.+|++.|++++|.+++++|.+.|+.|+..+|+.++.+|++.|++++
T Consensus       623 ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~ee  702 (1060)
T PLN03218        623 SCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKK  702 (1060)
T ss_pred             HHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHcCCCCCCcccCcchhhHHHHHHHHHhcCchhHHHHHHHHHHhCCCCCChHHHHHHHHHhhhcchhhhhc
Q 039029          239 ARRLLDQMKRRGIKPDHISFNPTRLTYNALIQGLCKNQEGDLAEELLREMVSKGITPDDNTYFSLIEGIASVDKAAESS  317 (319)
Q Consensus       239 a~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~  317 (319)
                      |.++|++|.+.|+.|+.       .+|+.++.+|++.|++++|.++|++|...|+.||..||..++.+|.+.|+.++|.
T Consensus       703 A~~lf~eM~~~g~~Pdv-------vtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~k~G~le~A~  774 (1060)
T PLN03218        703 ALELYEDIKSIKLRPTV-------STMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGL  774 (1060)
T ss_pred             HHHHHHHHHHcCCCCCH-------HHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHH
Confidence            99999999988876654       8999999999999999999999999999999999999999999999999999885



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2659 consensus LisH motif-containing protein [Cytoskeleton] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>cd00280 TRFH Telomeric Repeat binding Factor or TTAGGG Repeat binding Factor, central (dimerization) domain Homology; TRFH Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
4g24_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 7e-06
4g24_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 1e-04
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Iteration: 1

Score = 48.1 bits (113), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 12/133 (9%) Query: 20 MC-KEGRLEEASRMLEQMKENGLVPTAVTYNTLI----------DGYCNKGNLEMAFSFR 68 MC K+G + EA R+ ++ + NG+ + YN L+ + N G L F Sbjct: 35 MCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPG-LSRGFDIF 93 Query: 69 DEMVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRC 128 +M+ ++P +T+ + + A DM+K+M GI P +Y + G+CR Sbjct: 94 KQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRK 153 Query: 129 GNAKKAFSLHDEM 141 G+A KA+ + M Sbjct: 154 GDADKAYEVDAHM 166
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 9e-20
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-18
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-13
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 3e-08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-06
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 4e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 89.1 bits (219), Expect = 9e-20
 Identities = 25/228 (10%), Positives = 74/228 (32%), Gaps = 5/228 (2%)

Query: 1   MKSRGVQPDSYTYGSFVSGMCKEGRLEEASRMLE---QMKENGLVPTAVTYNTLIDGYCN 57
                +        +F        +L  A  +L      ++   + T   YN ++ G+  
Sbjct: 118 HSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWAR 177

Query: 58  KGNLEMAFSFRDEMVKQGIMPTASTYNLLIHELL-MERKMVEADDMLKEMGEKGIVPDSI 116
           +G  +        +   G+ P   +Y   +  +   ++     +  L++M ++G+   ++
Sbjct: 178 QGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQAL 237

Query: 117 TYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENF 176
              +L++   R    K    +          P  +  + L+  +  ++  +   +L    
Sbjct: 238 FTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPL 297

Query: 177 LAKGMLPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYN 224
                L +  + +  +       ++E+     KE+   +     +   
Sbjct: 298 KTLQCLFEKQL-HMELASRVCVVSVEKPTLPSKEVKHARKTLKTLRDQ 344


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query319
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.94
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.91
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.91
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.91
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.9
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.9
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.9
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.88
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.88
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.83
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.83
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.83
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.82
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.82
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.8
3u4t_A272 TPR repeat-containing protein; structural genomics 99.79
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.79
3u4t_A272 TPR repeat-containing protein; structural genomics 99.78
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.78
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.78
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.78
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.78
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.78
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.78
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.77
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.77
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.77
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.77
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.76
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.76
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.76
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.76
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.75
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.73
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.72
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.71
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.7
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.69
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.69
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.68
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.67
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.67
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.67
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.67
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.66
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.66
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.63
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.62
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.62
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.61
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.61
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.59
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.57
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.57
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.57
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.57
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.56
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.56
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.56
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.53
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.51
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.5
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.5
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.5
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.5
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.46
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.4
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.38
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.38
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.38
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.37
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.36
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.36
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.35
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.35
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.34
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.33
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.33
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.32
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.31
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.31
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.29
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.29
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.28
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.27
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.26
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.26
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.26
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.24
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.24
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.24
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.24
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.17
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.16
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.13
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.12
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.1
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.09
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.07
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.06
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.04
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.04
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.04
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.03
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.03
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.01
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.0
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.99
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.99
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.98
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.98
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.97
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.97
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.96
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.96
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.95
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.95
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.95
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.94
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.94
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.94
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.94
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.94
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.93
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.89
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.88
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.86
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.83
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.81
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.81
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.81
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.8
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.8
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.8
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.8
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.79
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.78
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.78
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 98.77
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.77
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.77
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.77
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.76
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.76
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.75
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.73
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.73
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.72
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.71
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.69
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.69
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.67
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.67
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.66
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.59
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.59
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.58
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.57
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.56
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.56
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.56
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.54
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.52
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.5
3k9i_A117 BH0479 protein; putative protein binding protein, 98.49
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.47
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.46
3k9i_A117 BH0479 protein; putative protein binding protein, 98.46
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.42
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.38
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.38
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.37
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.36
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.33
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.33
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.32
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.3
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.28
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.19
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.1
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.05
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.04
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.02
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.0
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.99
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.87
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.74
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.71
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.64
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.61
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.5
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.49
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.47
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.36
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.33
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.27
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.24
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.23
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.08
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.08
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.04
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.99
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.91
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.74
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.69
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.67
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.67
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.46
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.44
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.33
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.28
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.23
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.17
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.91
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.69
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.87
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.66
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.62
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 94.21
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 93.67
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.66
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.54
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 93.23
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.06
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.66
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.65
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 92.43
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.76
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.2
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 90.52
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 90.37
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 90.15
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 89.87
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 89.81
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.67
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 87.43
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 86.22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 85.14
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 84.8
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 83.66
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 82.68
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=9.5e-35  Score=240.21  Aligned_cols=198  Identities=19%  Similarity=0.269  Sum_probs=177.2

Q ss_pred             CCCCCCCCCcc-cHHHHHHHHhccCChHHHHHHHHHHHhCCCCCCHHhHHHHHHHHHhcCC---------hHHHHHHHHH
Q 039029            1 MKSRGVQPDSY-TYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGN---------LEMAFSFRDE   70 (319)
Q Consensus         1 M~~~g~~p~~~-~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~---------~~~a~~~~~~   70 (319)
                      |+++++.+.+. .++.+|.+|++.|++++|+++|++|.+.|+.||..+|+.+|.+|++.+.         .+.|.++|++
T Consensus        16 ~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~   95 (501)
T 4g26_A           16 AKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQ   95 (501)
T ss_dssp             --------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHH
T ss_pred             HHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHHHHH
Confidence            35566665544 5888999999999999999999999999999999999999999987664         6889999999


Q ss_pred             HHHcCCCcChhhHHHHHHHHHHcCchhHHHHHHHHHhhCCCCCChHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCccH
Q 039029           71 MVKQGIMPTASTYNLLIHELLMERKMVEADDMLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTM  150 (319)
Q Consensus        71 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~  150 (319)
                      |...|+.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||.
T Consensus        96 M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~  175 (501)
T 4g26_A           96 MIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEE  175 (501)
T ss_dssp             HHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCH
T ss_pred             HHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhccHHHHHHHHHHHhhCCCCccHHHHHHHHHHHhcC
Q 039029          151 LTYTSLIFVLSKQNRMIEADQLFENFLAKGMLPDIVMFNALIDGHCTN  198 (319)
Q Consensus       151 ~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  198 (319)
                      .+|+.++.+|++.|++++|.+++++|.+.+..|+..||+.++..|+..
T Consensus       176 ~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~  223 (501)
T 4g26_A          176 PELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSE  223 (501)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSH
T ss_pred             HHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999999988753



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query319
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.8
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.8
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.59
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.58
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.53
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.51
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.49
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.45
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.45
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.43
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.41
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.21
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.01
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.98
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.97
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.97
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.91
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.88
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.84
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.83
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.83
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.82
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.75
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.7
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.66
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.63
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.63
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.55
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.53
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.44
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.43
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.42
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.42
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.35
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.34
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.33
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.32
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.2
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.18
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.17
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.16
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.08
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.04
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.03
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.76
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.69
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.67
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.55
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.24
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.19
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.27
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.57
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.45
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.95
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 93.98
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 91.91
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 87.01
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=3.6e-21  Score=153.79  Aligned_cols=289  Identities=14%  Similarity=0.052  Sum_probs=187.6

Q ss_pred             CcccHHHHHHHHhccCChHHHHHHHHHHHhCCCCCCHHhHHHHHHHHHhcCChHHHHHHHHHHHHcCCC-----------
Q 039029            9 DSYTYGSFVSGMCKEGRLEEASRMLEQMKENGLVPTAVTYNTLIDGYCNKGNLEMAFSFRDEMVKQGIM-----------   77 (319)
Q Consensus         9 ~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~-----------   77 (319)
                      ++..+..+...+.+.|++++|+..|+++.+..+. +..+|..+..++...|++++|+..+....+....           
T Consensus        32 ~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~-~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~  110 (388)
T d1w3ba_          32 NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAA  110 (388)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHhhhhcccccccccccccccccccccccccccccc
Confidence            3455666677777777777777777777665322 4566777777777777777777766665543211           


Q ss_pred             --------------------------------------------------------cChhhHHHHHHHHHHcCchhHHHH
Q 039029           78 --------------------------------------------------------PTASTYNLLIHELLMERKMVEADD  101 (319)
Q Consensus        78 --------------------------------------------------------~~~~~~~~l~~~~~~~~~~~~a~~  101 (319)
                                                                              .+...+..+...+...|++++|..
T Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~  190 (388)
T d1w3ba_         111 LVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIH  190 (388)
T ss_dssp             HHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHH
Confidence                                                                    011223333444555566666666


Q ss_pred             HHHHHhhCCCCCChHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCccHHHHHHHHHHHhhhccHHHHHHHHHHHhhCCC
Q 039029          102 MLKEMGEKGIVPDSITYNILINGYCRCGNAKKAFSLHDEMIHKGIQPTMLTYTSLIFVLSKQNRMIEADQLFENFLAKGM  181 (319)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~  181 (319)
                      .+++..+..+. +...+..+...+...|++++|...+++....+ +.+...+..+..++.+.|++++|...|+++.+..+
T Consensus       191 ~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p  268 (388)
T d1w3ba_         191 HFEKAVTLDPN-FLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQP  268 (388)
T ss_dssp             HHHHHHHHCTT-CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCS
T ss_pred             HHHHHHHhCcc-cHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCC
Confidence            66666654433 55666667777777777777777777776654 34556666677777777777777777777766543


Q ss_pred             CccHHHHHHHHHHHhcCCcHHHHHHHHHHHHhCCCCCChhhHHHHHHHHHcCCcHHHHHHHHHHHHHcCCCCCCcccCcc
Q 039029          182 LPDIVMFNALIDGHCTNGNIERAFSLLKEMDRMKVHPDEVTYNTLMHGRCRQGKVEEARRLLDQMKRRGIKPDHISFNPT  261 (319)
Q Consensus       182 ~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~  261 (319)
                      . +..++..+...+...|++++|...++...... +.+...+..+...+...|++++|...|+++++.  .|+.      
T Consensus       269 ~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~------  338 (388)
T d1w3ba_         269 H-FPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIKREQGNIEEAVRLYRKALEV--FPEF------  338 (388)
T ss_dssp             S-CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS--CTTC------
T ss_pred             C-CHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh--CCCC------
Confidence            2 45667777777777777777777777766543 445566677777777777777777777776653  3332      


Q ss_pred             hhhHHHHHHHHHhcCchhHHHHHHHHHHhCCCCC-ChHHHHHHHHHhhhcch
Q 039029          262 RLTYNALIQGLCKNQEGDLAEELLREMVSKGITP-DDNTYFSLIEGIASVDK  312 (319)
Q Consensus       262 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~  312 (319)
                      ..++..+..+|...|++++|.+.|++.++.  .| +...|..+...+.+.||
T Consensus       339 ~~~~~~la~~~~~~g~~~~A~~~~~~al~l--~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         339 AAAHSNLASVLQQQGKLQEALMHYKEAIRI--SPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--CTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCC
Confidence            256677777777777777777777777764  44 35567777777766654



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure