Citrus Sinensis ID: 039039
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 398 | 2.2.26 [Sep-21-2011] | |||||||
| Q00IB6 | 440 | RNA polymerase II C-termi | yes | no | 0.879 | 0.795 | 0.430 | 2e-77 | |
| Q8LL04 | 1241 | RNA polymerase II C-termi | no | no | 0.761 | 0.244 | 0.347 | 3e-40 | |
| Q9P376 | 723 | RNA polymerase II subunit | yes | no | 0.522 | 0.287 | 0.295 | 8e-21 | |
| Q9Y5B0 | 961 | RNA polymerase II subunit | no | no | 0.492 | 0.203 | 0.284 | 1e-18 | |
| Q8SV03 | 411 | RNA polymerase II subunit | yes | no | 0.562 | 0.545 | 0.294 | 2e-18 | |
| Q7TSG2 | 960 | RNA polymerase II subunit | yes | no | 0.492 | 0.204 | 0.284 | 2e-18 | |
| Q03254 | 732 | RNA polymerase II subunit | yes | no | 0.520 | 0.282 | 0.286 | 4e-15 | |
| Q08BB5 | 469 | CTD small phosphatase-lik | no | no | 0.356 | 0.302 | 0.286 | 3e-06 | |
| Q801R4 | 466 | CTD small phosphatase-lik | N/A | no | 0.376 | 0.321 | 0.279 | 3e-06 | |
| Q3KQB6 | 466 | CTD small phosphatase-lik | N/A | no | 0.376 | 0.321 | 0.279 | 4e-06 |
| >sp|Q00IB6|CPL4_ARATH RNA polymerase II C-terminal domain phosphatase-like 4 OS=Arabidopsis thaliana GN=CPL4 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 289 bits (740), Expect = 2e-77, Method: Compositional matrix adjust.
Identities = 157/365 (43%), Positives = 224/365 (61%), Gaps = 15/365 (4%)
Query: 38 CQHATILNGMCVVCDKLMDDSYGVCFDYIEKGLRYSIDEISRLKKRNTKNLLRMRKLHLV 97
C+H MC VC + ++++ GV F YI K +R + DEISRL+ +++ L R RKL+LV
Sbjct: 68 CEHPGSFGNMCFVCGQKLEET-GVSFRYIHKEMRLNEDEISRLRDSDSRFLQRQRKLYLV 126
Query: 98 LDLDHTLLHSRWIGKLTSDEKYLEKAAAAAGEFSSDKISRGNDLFKIKIGDNVLLVKLRP 157
LDLDHTLL++ + L +E+YL+ + + + G LF ++ ++ KLRP
Sbjct: 127 LDLDHTLLNTTILRDLKPEEEYLKSHTHSLQDGCN---VSGGSLFLLEFMQ--MMTKLRP 181
Query: 158 FVRSFLEEASRLFEISVCTMGNREYATRAVKLLDPDCKYFNSRIITREDFKQKERKCLDL 217
FV SFL+EAS +F + + TMG+R YA + KLLDP +YF R+I+R+D + K LD+
Sbjct: 182 FVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLDPKGEYFGDRVISRDDGTVRHEKSLDV 241
Query: 218 VLGQESSIVIVDDTESVWGGRVENLITVGSYDFFKGKKK---NDCKSYSEQMSDESESDG 274
VLGQES+++I+DDTE+ W +NLI + Y FF + + KS SE SDESE DG
Sbjct: 242 VLGQESAVLILDDTENAWPKHKDNLIVIERYHFFSSSCRQFDHRYKSLSELKSDESEPDG 301
Query: 275 ALANILRALKAVHALYFDNPGNHAAGRDVRSCLAKIRSRILMGCTILFG-----DDDFEE 329
ALA +L+ LK HAL+F+N + RDVR L ++R IL GC I+F E+
Sbjct: 302 ALATVLKVLKQAHALFFENVDEGISNRDVRLMLKQVRKEILKGCKIVFSRVFPTKAKPED 361
Query: 330 LPLTWSRAEEMGAICTLVTDASITHVVSSNTQSETFEWAEQENKCLVHPQWINDAYFLWC 389
PL W AEE+GA C DAS+THVV+ + +E WA +E K +VH WI+ A +LW
Sbjct: 362 HPL-WKMAEELGATCATEVDASVTHVVAMDVGTEKARWAVREKKYVVHRGWIDAANYLWM 420
Query: 390 RQPND 394
+QP +
Sbjct: 421 KQPEE 425
|
Processively dephosphorylates 'Ser-2' and/or 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). This promotes the activity of RNA polymerase II (By similarity). Required for normal plant growth. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6 |
| >sp|Q8LL04|CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana GN=CPL3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9P376|FCP1_SCHPO RNA polymerase II subunit A C-terminal domain phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fcp1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y5B0|CTDP1_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens GN=CTDP1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q8SV03|FCP1_ENCCU RNA polymerase II subunit A C-terminal domain phosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=FCP1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7TSG2|CTDP1_MOUSE RNA polymerase II subunit A C-terminal domain phosphatase OS=Mus musculus GN=Ctdp1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q03254|FCP1_YEAST RNA polymerase II subunit A C-terminal domain phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCP1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q08BB5|CTL2A_DANRE CTD small phosphatase-like protein 2-A OS=Danio rerio GN=ctdspl2a PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q801R4|CTL2A_XENLA CTD small phosphatase-like protein 2-A OS=Xenopus laevis GN=ctdspl2-a PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q3KQB6|CTL2B_XENLA CTD small phosphatase-like protein 2-B OS=Xenopus laevis GN=ctdspl2-b PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 398 | ||||||
| 255570505 | 478 | RNA polymerase II ctd phosphatase, putat | 0.891 | 0.742 | 0.430 | 1e-81 | |
| 356564913 | 442 | PREDICTED: RNA polymerase II C-terminal | 0.899 | 0.809 | 0.437 | 3e-79 | |
| 356498756 | 428 | PREDICTED: RNA polymerase II C-terminal | 0.876 | 0.815 | 0.440 | 5e-79 | |
| 449447765 | 452 | PREDICTED: RNA polymerase II C-terminal | 0.891 | 0.785 | 0.424 | 3e-77 | |
| 9758369 | 1065 | unnamed protein product [Arabidopsis tha | 0.879 | 0.328 | 0.430 | 1e-75 | |
| 145334837 | 440 | RNA polymerase II C-terminal domain phos | 0.879 | 0.795 | 0.430 | 1e-75 | |
| 413945235 | 533 | CPL3 [Zea mays] | 0.937 | 0.699 | 0.413 | 2e-73 | |
| 226497696 | 531 | CPL3 [Zea mays] gi|195656359|gb|ACG47647 | 0.937 | 0.702 | 0.413 | 3e-73 | |
| 242093742 | 558 | hypothetical protein SORBIDRAFT_10g02558 | 0.924 | 0.659 | 0.413 | 5e-72 | |
| 242087817 | 547 | hypothetical protein SORBIDRAFT_09g01931 | 0.927 | 0.674 | 0.411 | 5e-72 |
| >gi|255570505|ref|XP_002526210.1| RNA polymerase II ctd phosphatase, putative [Ricinus communis] gi|223534449|gb|EEF36151.1| RNA polymerase II ctd phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 310 bits (793), Expect = 1e-81, Method: Compositional matrix adjust.
Identities = 162/376 (43%), Positives = 233/376 (61%), Gaps = 21/376 (5%)
Query: 29 LSVSEEHTICQHATILNGMCVVCDKLMDDSYGVCFDYIEKGLRYSIDEISRLKKRNTKNL 88
L S C H MC++C + + + GV F YI KGLR + DEI RL+ + KNL
Sbjct: 102 LVASSSKVACTHPGSFGDMCILCGERLIEETGVTFGYIHKGLRLANDEIVRLRNTDMKNL 161
Query: 89 LRMRKLHLVLDLDHTLLHSRWIGKLTSDEKYLEKAAAAAGEFSSDKISRGNDLFKIKIGD 148
LR RKL+LVLDLDHTLL+S + LT++E+YL+ S +S G+ LF +
Sbjct: 162 LRHRKLYLVLDLDHTLLNSTQLMHLTAEEEYLKSQID-----SMQDVSNGS-LFMVDFMH 215
Query: 149 NVLLVKLRPFVRSFLEEASRLFEISVCTMGNREYATRAVKLLDPDCKYFNSRIITREDFK 208
++ KLRPF+R+FL+EAS++FE+ + TMG+R YA K LDP +YFN+R+I+R+D
Sbjct: 216 --MMTKLRPFIRTFLKEASQMFEMYIYTMGDRAYALEMAKFLDPGREYFNARVISRDDGT 273
Query: 209 QKERKCLDLVLGQESSIVIVDDTESVWGGRVENLITVGSYDFFKGKKKN---DCKSYSEQ 265
Q+ +K LD+VLGQES+++I+DDTE+ W +NLI + Y FF + +CKS S+
Sbjct: 274 QRHQKGLDIVLGQESAVLILDDTENAWTKHKDNLILMERYHFFASSCRQFGFECKSLSQL 333
Query: 266 MSDESESDGALANILRALKAVHALYFDNPGNHAAGRDVRSCLAKIRSRILMGCTILFG-- 323
SDE+ESDGALA++L+ L+ +H ++FD + GRDVR L+ +R +L GC I+F
Sbjct: 334 KSDENESDGALASVLKVLRRIHHIFFDELEDAIDGRDVRQVLSTVRKDVLKGCKIVFSRV 393
Query: 324 -----DDDFEELPLTWSRAEEMGAICTLVTDASITHVVSSNTQSETFEWAEQENKCLVHP 378
D L W AE++GA C+ D S+THVVS+ +E WA + +K LVHP
Sbjct: 394 FPTQFQADNHHL---WKMAEQLGATCSREVDPSVTHVVSAEAGTEKSRWALKNDKFLVHP 450
Query: 379 QWINDAYFLWCRQPND 394
+WI ++W RQP +
Sbjct: 451 RWIEATNYMWQRQPEE 466
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356564913|ref|XP_003550691.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356498756|ref|XP_003518215.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449447765|ref|XP_004141638.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|9758369|dbj|BAB08870.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|145334837|ref|NP_001078764.1| RNA polymerase II C-terminal domain phosphatase-like 4 [Arabidopsis thaliana] gi|122154038|sp|Q00IB6.1|CPL4_ARATH RecName: Full=RNA polymerase II C-terminal domain phosphatase-like 4; Short=FCP-like 4; AltName: Full=Carboxyl-terminal phosphatase-like 4; Short=AtCPL4; Short=CTD phosphatase-like 4 gi|95115186|gb|ABF55959.1| carboxyl-terminal phosphatase-like 4 [Arabidopsis thaliana] gi|332009601|gb|AED96984.1| RNA polymerase II C-terminal domain phosphatase-like 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|413945235|gb|AFW77884.1| CPL3 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|226497696|ref|NP_001152445.1| CPL3 [Zea mays] gi|195656359|gb|ACG47647.1| CPL3 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|242093742|ref|XP_002437361.1| hypothetical protein SORBIDRAFT_10g025580 [Sorghum bicolor] gi|241915584|gb|EER88728.1| hypothetical protein SORBIDRAFT_10g025580 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|242087817|ref|XP_002439741.1| hypothetical protein SORBIDRAFT_09g019310 [Sorghum bicolor] gi|241945026|gb|EES18171.1| hypothetical protein SORBIDRAFT_09g019310 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 398 | ||||||
| TAIR|locus:4010714056 | 440 | CPL4 "C-terminal domain phosph | 0.879 | 0.795 | 0.405 | 9.4e-66 | |
| TAIR|locus:4515103095 | 307 | AT3G19595 [Arabidopsis thalian | 0.653 | 0.846 | 0.380 | 2.6e-40 | |
| TAIR|locus:2012943 | 342 | AT1G20320 [Arabidopsis thalian | 0.640 | 0.745 | 0.380 | 2.6e-38 | |
| TAIR|locus:2045044 | 277 | AT2G04930 [Arabidopsis thalian | 0.665 | 0.956 | 0.355 | 8.9e-38 | |
| TAIR|locus:2090467 | 296 | AT3G17550 [Arabidopsis thalian | 0.673 | 0.905 | 0.357 | 2.4e-37 | |
| TAIR|locus:2162565 | 306 | AT5G54210 [Arabidopsis thalian | 0.623 | 0.810 | 0.348 | 5.1e-35 | |
| TAIR|locus:2051164 | 1241 | CPL3 "C-terminal domain phosph | 0.587 | 0.188 | 0.374 | 1.8e-34 | |
| TAIR|locus:2154458 | 302 | AT5G23470 [Arabidopsis thalian | 0.655 | 0.864 | 0.340 | 3.9e-28 | |
| TAIR|locus:2056256 | 302 | AT2G02290 [Arabidopsis thalian | 0.650 | 0.857 | 0.313 | 2.8e-27 | |
| WB|WBGene00009479 | 659 | fcp-1 [Caenorhabditis elegans | 0.625 | 0.377 | 0.303 | 2.9e-27 |
| TAIR|locus:4010714056 CPL4 "C-terminal domain phosphatase-like 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 669 (240.6 bits), Expect = 9.4e-66, P = 9.4e-66
Identities = 148/365 (40%), Positives = 214/365 (58%)
Query: 38 CQHATILNGMCVVCDKLMDDSYGVCFDYIEKGLRYSIDEISRLKKRNTKNLLRMRKXXXX 97
C+H MC VC + ++++ GV F YI K +R + DEISRL+ +++ L R RK
Sbjct: 68 CEHPGSFGNMCFVCGQKLEET-GVSFRYIHKEMRLNEDEISRLRDSDSRFLQRQRKLYLV 126
Query: 98 XXXXXXXXXSRWIGKLTSDEKYLEKAAAAAGEFSSDKISRGNDLFKIKIGDNVLLVKLRP 157
+ + L +E+YL+ + + + +S G LF ++ ++ KLRP
Sbjct: 127 LDLDHTLLNTTILRDLKPEEEYLKSHTHSLQDGCN--VS-GGSLFLLEFMQ--MMTKLRP 181
Query: 158 FVRSFLEEASRLFEISVCTMGNREYATRAVKLLDPDCKYFNSRIITREDFKQKERKCLDL 217
FV SFL+EAS +F + + TMG+R YA + KLLDP +YF R+I+R+D + K LD+
Sbjct: 182 FVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLDPKGEYFGDRVISRDDGTVRHEKSLDV 241
Query: 218 VLGQESSIVIVDDTESVWGGRVENLITVGSYDFFKGK-KKND--CKSYSEQMSDESESDG 274
VLGQES+++I+DDTE+ W +NLI + Y FF ++ D KS SE SDESE DG
Sbjct: 242 VLGQESAVLILDDTENAWPKHKDNLIVIERYHFFSSSCRQFDHRYKSLSELKSDESEPDG 301
Query: 275 ALANILRALKAVHALYFDNPGNHAAGRDVRSCLAKIRSRILMGCTILFG-----DDDFEE 329
ALA +L+ LK HAL+F+N + RDVR L ++R IL GC I+F E+
Sbjct: 302 ALATVLKVLKQAHALFFENVDEGISNRDVRLMLKQVRKEILKGCKIVFSRVFPTKAKPED 361
Query: 330 LPLTWSRAEEMGAICTLVTDASITHVVSSNTQSETFEWAEQENKCLVHPQWINDAYFLWC 389
PL W AEE+GA C DAS+THVV+ + +E WA +E K +VH WI+ A +LW
Sbjct: 362 HPL-WKMAEELGATCATEVDASVTHVVAMDVGTEKARWAVREKKYVVHRGWIDAANYLWM 420
Query: 390 RQPND 394
+QP +
Sbjct: 421 KQPEE 425
|
|
| TAIR|locus:4515103095 AT3G19595 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012943 AT1G20320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045044 AT2G04930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090467 AT3G17550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162565 AT5G54210 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2051164 CPL3 "C-terminal domain phosphatase-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154458 AT5G23470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056256 AT2G02290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009479 fcp-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3 | 0.766 |
| 3rd Layer | 3.1.3.16 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | CPL4 | CPL4 (C-TERMINAL DOMAIN PHOSPHATASE-LIKE 4); phosphoprotein phosphatase; Encodes a polypeptide that contains FCPH and BRCT domains. RNAi suppression mutant lines were generated, which displayed a range of phenotypic abnormalities, including- incomplete to no cotyledon expansion, slow growth, epinastic leaves or small inflorescences. ; Processively dephosphorylates 'Ser-2' and/or 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). This promotes the activity of RNA polymerase II (By similarity). Required for normal plant growth (440 aa) | |||||||||
(Arabidopsis thaliana) | |||||||||||
 | RAP74 | • | • | • | 0.999 | ||||||
 | AT5G58000 | • | 0.919 | ||||||||
 | AT2G33540.1-P | • | • | • | 0.911 | ||||||
 | AT2G02290 | • | • | • | 0.907 | ||||||
 | AT5G23470 | • | • | • | 0.907 | ||||||
 | SPT42 | • | 0.899 | ||||||||
 | NRPB7 | • | 0.899 | ||||||||
 | RPB5C | • | 0.899 | ||||||||
 | AT5G54210 | • | • | 0.899 | |||||||
 | CBP20 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 398 | |||
| TIGR02250 | 156 | TIGR02250, FCP1_euk, FCP1-like phosphatase, phosph | 5e-55 | |
| smart00577 | 148 | smart00577, CPDc, catalytic domain of ctd-like pho | 2e-38 | |
| pfam03031 | 153 | pfam03031, NIF, NLI interacting factor-like phosph | 6e-25 | |
| TIGR02251 | 162 | TIGR02251, HIF-SF_euk, Dullard-like phosphatase do | 2e-12 | |
| COG5190 | 390 | COG5190, FCP1, TFIIF-interacting CTD phosphatases, | 2e-09 |
| >gnl|CDD|131304 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
Score = 178 bits (453), Expect = 5e-55
Identities = 74/165 (44%), Positives = 96/165 (58%), Gaps = 10/165 (6%)
Query: 88 LLRMRKLHLVLDLDHTLLHSRWIGKLTSDEKYLEKAAAAAGEFSSDKISRGNDLFKIKIG 147
LLR +KLHLVLDLD TL+H+ L+ EKY + E +S+ DL K +G
Sbjct: 1 LLREKKLHLVLDLDQTLIHTTKDPTLSEWEKYDIE------EPNSETRR---DLRKFNLG 51
Query: 148 DNVLLVKLRPFVRSFLEEASRLFEISVCTMGNREYATRAVKLLDPDCKYFNSRIITREDF 207
L KLRPF+ FL+EAS+L+E+ V TMG R YA KL+DPD KYF RII+R++
Sbjct: 52 TMWYLTKLRPFLHEFLKEASKLYEMHVYTMGTRAYAQAIAKLIDPDGKYFGDRIISRDES 111
Query: 208 KQKERKCL-DLVLGQESSIVIVDDTESVWGGRVENLITVGSYDFF 251
K L L ES +VI+DD E VW NLI + Y++F
Sbjct: 112 GSPHTKSLLRLFPADESMVVIIDDREDVWPWHKRNLIQIEPYNYF 156
|
This model represents the phosphatase domain of the humanRNA polymerase II subunit A C-terminal domain phosphatase (FCP1, ) and closely related phosphatases from eukaryotes including plants, fungi and slime mold. This domain is a member of the haloacid dehalogenase (HAD) superfamily by virtue of a conserved set of three catalytic motifs and a conserved fold as predicted by PSIPRED. The third motif in this family is distinctive (hhhhDDppphW). This domain is classified as a "Class III" HAD, since there is no large "cap" domain found between motifs 1 and 2 or motifs 2 and 3.This domain is related to domains found in the human NLI interacting factor-like phosphatases, and together both are detected by the pfam03031. Length = 156 |
| >gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 398 | |||
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 100.0 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 100.0 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 100.0 | |
| KOG1605 | 262 | consensus TFIIF-interacting CTD phosphatase, inclu | 100.0 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 99.98 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 99.96 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.91 | |
| KOG2832 | 393 | consensus TFIIF-interacting CTD phosphatase, inclu | 99.91 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 99.86 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 99.78 | |
| PF12738 | 63 | PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W | 99.56 | |
| PF00533 | 78 | BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP | 99.5 | |
| KOG3226 | 508 | consensus DNA repair protein [Replication, recombi | 99.39 | |
| smart00292 | 80 | BRCT breast cancer carboxy-terminal domain. | 99.32 | |
| cd00027 | 72 | BRCT Breast Cancer Suppressor Protein (BRCA1), car | 99.29 | |
| PLN03122 | 815 | Poly [ADP-ribose] polymerase; Provisional | 98.82 | |
| PLN03123 | 981 | poly [ADP-ribose] polymerase; Provisional | 98.73 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 98.32 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 98.27 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 98.27 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 98.25 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 98.24 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 98.22 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 98.18 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 98.15 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 98.14 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 98.13 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 98.1 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 98.09 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 98.08 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 98.08 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 98.06 | |
| PRK06063 | 313 | DNA polymerase III subunit epsilon; Provisional | 98.06 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 98.02 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 97.99 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 97.98 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 97.97 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 97.94 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 97.92 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 97.9 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 97.89 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 97.87 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 97.87 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 97.84 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 97.84 | |
| PLN02940 | 382 | riboflavin kinase | 97.84 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 97.83 | |
| PRK06195 | 309 | DNA polymerase III subunit epsilon; Validated | 97.83 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 97.81 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.81 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 97.78 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 97.76 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 97.76 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 97.73 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 97.69 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.69 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 97.68 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 97.65 | |
| KOG0966 | 881 | consensus ATP-dependent DNA ligase IV [Replication | 97.65 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 97.64 | |
| COG5275 | 276 | BRCT domain type II [General function prediction o | 97.62 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 97.59 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 97.56 | |
| PRK08238 | 479 | hypothetical protein; Validated | 97.56 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 97.55 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.52 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 97.5 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 97.42 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 97.41 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 97.37 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 97.32 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 97.3 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 97.29 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 97.28 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 97.27 | |
| KOG2043 | 896 | consensus Signaling protein SWIFT and related BRCT | 97.25 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 97.21 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 97.19 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 97.16 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 97.07 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 97.07 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 97.05 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 97.03 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 96.96 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 96.96 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 96.96 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 96.88 | |
| PRK06769 | 173 | hypothetical protein; Validated | 96.88 | |
| PLN02954 | 224 | phosphoserine phosphatase | 96.81 | |
| KOG2481 | 570 | consensus Protein required for normal rRNA process | 96.74 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 96.73 | |
| KOG3548 | 1176 | consensus DNA damage checkpoint protein RHP9/CRB2/ | 96.7 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 96.62 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 96.61 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 96.6 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 96.5 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 96.49 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 96.46 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 96.46 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 96.4 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 96.23 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 96.22 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 96.21 | |
| COG5163 | 591 | NOP7 Protein required for biogenesis of the 60S ri | 96.17 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 96.11 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 96.06 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 96.02 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 96.02 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 95.97 | |
| PLN02811 | 220 | hydrolase | 95.76 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 95.71 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 95.67 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 95.65 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 95.62 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 95.54 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 95.32 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 95.13 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 94.85 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 94.76 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 94.68 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 94.61 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 94.49 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 94.33 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 94.06 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 93.98 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 93.62 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 92.86 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 92.73 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 92.62 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 92.59 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 92.53 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 92.24 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 92.09 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 92.08 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 92.07 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 92.0 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 91.82 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 91.38 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 91.38 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 91.29 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 90.91 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 90.69 | |
| PLN02887 | 580 | hydrolase family protein | 90.66 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 90.61 | |
| KOG0966 | 881 | consensus ATP-dependent DNA ligase IV [Replication | 90.56 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 90.04 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 89.92 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 89.89 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 89.79 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 89.49 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 88.76 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 88.43 | |
| PRK05601 | 377 | DNA polymerase III subunit epsilon; Validated | 87.87 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 87.56 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 87.25 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 86.85 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 86.46 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 86.45 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 86.44 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 85.81 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 85.28 | |
| PLN02423 | 245 | phosphomannomutase | 85.12 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 84.66 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 84.16 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 84.06 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 83.89 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 83.8 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 83.27 | |
| PLN03017 | 366 | trehalose-phosphatase | 82.64 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 80.99 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 80.84 |
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-65 Score=530.15 Aligned_cols=355 Identities=35% Similarity=0.597 Sum_probs=310.1
Q ss_pred cCCCCcceeecccccccccccccCCCceeeeecCCcccCHHHHHHHhhhcch-hhhccCceEEEEeCCCceeeeeccCCC
Q 039039 35 HTICQHATILNGMCVVCDKLMDDSYGVCFDYIEKGLRYSIDEISRLKKRNTK-NLLRMRKLHLVLDLDHTLLHSRWIGKL 113 (398)
Q Consensus 35 ~~~C~H~~~~~~~C~~Cg~~~~~~~~~~~~~~~~~l~vs~~~a~~~~~~~~~-~ll~~~Kl~LVLDLD~TLihs~~~~~~ 113 (398)
.+.|.|+++++|||+.||++++...+..+.|+..++.++...+..++..... ..+++++|+||+|||+||+|++....+
T Consensus 87 ~~~C~H~~v~~GlC~~Cg~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~lv~Dld~tllh~~~~~~l 166 (635)
T KOG0323|consen 87 TSCCEHFTVFGGLCASCGKDLESLQGRSFDYLVKGLQLSNEMVAFTKTLTTQFSSLNRKKLHLVLDLDHTLLHTILKSDL 166 (635)
T ss_pred cCCccceeecccHHHHHHHHHHHhhccchhcccchhhhhhhhhhhhhHHHHHHHHHhhhcceeehhhhhHHHHhhccchh
Confidence 4799999999999999999999998888899999999999999998887554 456777789999999999999988777
Q ss_pred CchHHHHHHHHHhhcccccccCCCCCceeEEe--eccceEEEEeCccHHHHHHHhhccccEEEEcCCcHHHHHHHHHHhC
Q 039039 114 TSDEKYLEKAAAAAGEFSSDKISRGNDLFKIK--IGDNVLLVKLRPFVRSFLEEASRLFEISVCTMGNREYATRAVKLLD 191 (398)
Q Consensus 114 ~~~e~~~~~~~~~~~~F~~~~~p~~~~~f~~~--~~~~~~~vklRPgl~eFL~~~s~~yEi~I~T~g~~~YA~~il~~LD 191 (398)
...+.|+.++...+ +.+..+|.+. ....+||||+|||+++||++++++|||||||||+|.||..|+++||
T Consensus 167 ~e~~~~l~~~~~~~--------~sn~dl~~~~~~~~~~~~~vKlRP~~~efL~~~sklfemhVyTmg~R~YA~~i~~liD 238 (635)
T KOG0323|consen 167 SETEKYLKEEAESV--------ESNKDLFRFNPLGHDTEYLVKLRPFVHEFLKEANKLFEMHVYTMGTRDYALEIAKLID 238 (635)
T ss_pred hhhhhhcccccccc--------cccccceeecccCCCceEEEEeCccHHHHHHHHHhhceeEEEeccchHHHHHHHHHhC
Confidence 77777766544321 1234556554 3446899999999999999999999999999999999999999999
Q ss_pred CCCCccceeEEEccCCCCcccccccccc-CCCCcEEEEeCCcccccCCCCceEEeCccccccCCCCCCC-----------
Q 039039 192 PDCKYFNSRIITREDFKQKERKCLDLVL-GQESSIVIVDDTESVWGGRVENLITVGSYDFFKGKKKNDC----------- 259 (398)
Q Consensus 192 P~~~~F~~ri~srd~~~~~~~K~L~~l~-~~~~~vvIiDD~~~vw~~~~~N~I~I~~y~ff~~~~~~~~----------- 259 (398)
|+|.||++||+||++....-.+||.+++ ++++||||||||.+||.+++.|+|+|.||.||.++|+.+.
T Consensus 239 P~~~lF~dRIisrde~~~~kt~dL~~~~p~g~smvvIIDDr~dVW~~~~~nLI~i~~y~yF~~~gd~nap~~~~~~~~~~ 318 (635)
T KOG0323|consen 239 PEGKYFGDRIISRDESPFFKTLDLVLLFPCGDSMVVIIDDRSDVWPDHKRNLIQIAPYPYFSGQGDINAPPPLHVLRNVA 318 (635)
T ss_pred CCCccccceEEEecCCCcccccccccCCCCCCccEEEEeCccccccCCCcceEEeeeeecccCcccccCCcccccccchh
Confidence 9999999999999998776667776654 6899999999999999998779999999999999997443
Q ss_pred -----------------------------------------------------------------ccccccccCCCcchH
Q 039039 260 -----------------------------------------------------------------KSYSEQMSDESESDG 274 (398)
Q Consensus 260 -----------------------------------------------------------------~sl~~~~~d~~~~D~ 274 (398)
+++.+...|+.+.|+
T Consensus 319 ~~~~~~~~k~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~s~~~~~~de~~~D~ 398 (635)
T KOG0323|consen 319 CSVRGAFFKEFDPSLKSRISEVRYEDDDESNPTSYSVELSANPGPLKQDGMDEFVPEENAPEARSGSYREKKSDESDEDG 398 (635)
T ss_pred cccccccccccCcccccccccccccccccccCcccccccccccCcccccccccccccccchhhcccccccccccccccch
Confidence 233344567788899
Q ss_pred HHHHHHHHHHHHHhhhcCCC---CCCCCCCcchhhhhhhheecccceeEEecCCCCCCch----hhHHHHHHhCCEEeee
Q 039039 275 ALANILRALKAVHALYFDNP---GNHAAGRDVRSCLAKIRSRILMGCTILFGDDDFEELP----LTWSRAEEMGAICTLV 347 (398)
Q Consensus 275 ~L~~l~~~L~~ih~~ff~~~---~~~~~~~DVr~il~~~r~~vl~g~~i~fSg~~~~~~~----~l~~la~~lGa~~~~~ 347 (398)
+|.+++++|+.||..||... +.....+|||.+|+++|..+++||.++|||+.|...+ .+..++..+||..+.+
T Consensus 399 ~L~~~~kvl~~vH~~ff~~~~~~~e~~~~~Dvr~~i~~~~~~v~~~~~~vfSg~~P~~~~~~~s~~~~~~~~~g~vs~~~ 478 (635)
T KOG0323|consen 399 ELANLLKVLKPVHKGFFAKYDEVEETLESPDVRLLIPELRTKVLKGSQIVFSGLHPTGSTDESADILGVAQQLGAVSAPD 478 (635)
T ss_pred hHHHHhhhhcccchhhhhccccccccccCCChhhhhhhhhhHHhhccceeecccccCcCCcchhhhhhhhhcccceeccc
Confidence 99999999999999999975 3456789999999999999999999999999998533 6667799999999999
Q ss_pred cCCCccEEEECCCCCHHHHHHHhCC-CeeeChhHHHHHHHhcCcCCCCCCC
Q 039039 348 TDASITHVVSSNTQSETFEWAEQEN-KCLVHPQWINDAYFLWCRQPNDVSF 397 (398)
Q Consensus 348 ~~~~vTHlVa~~~~t~K~~~A~~~g-i~IV~~~WL~~c~~~~~r~~E~~Y~ 397 (398)
++..+||+|+.+.+|.|+.+|...+ ++||++.||+.|+.+|.+++|..|-
T Consensus 479 ~~~~~th~i~~~~gt~k~~~a~~~~~~~Vv~~~wl~~~~e~w~~v~ek~~~ 529 (635)
T KOG0323|consen 479 VSDKTTHLIAANAGTKKVYKAVVSGSAKVVNAAWLWRSLEKWGKVEEKLEP 529 (635)
T ss_pred ccchhhhHHhhccCcceeeccccccceeEechhHHHHHHHHhcchhccccc
Confidence 9999999999999999999999865 9999999999999999999999884
|
|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A | Back alignment and domain information |
|---|
| >PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 | Back alignment and domain information |
|---|
| >KOG3226 consensus DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00292 BRCT breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >PLN03122 Poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >PLN03123 poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK06063 DNA polymerase III subunit epsilon; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06195 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >COG5275 BRCT domain type II [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >KOG2043 consensus Signaling protein SWIFT and related BRCT domain proteins [Transcription; Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >KOG2481 consensus Protein required for normal rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3548 consensus DNA damage checkpoint protein RHP9/CRB2/53BP1 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PRK05601 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 398 | ||||
| 3ef0_A | 372 | The Structure Of Fcp1, An Essential Rna Polymerase | 2e-18 | ||
| 3ef1_A | 442 | The Structure Of Fcp1, An Essential Rna Polymerase | 3e-13 | ||
| 3ef1_A | 442 | The Structure Of Fcp1, An Essential Rna Polymerase | 8e-04 |
| >pdb|3EF0|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 372 | Back alignment and structure |
|
| >pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 | Back alignment and structure |
| >pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 | Back alignment and structure |
|---|
Score = 208 bits (529), Expect = 8e-64
Identities = 81/371 (21%), Positives = 150/371 (40%), Gaps = 62/371 (16%)
Query: 77 ISRLKKRNTKNLLRMRKLHLVLDLDHTLLHSRWIGKLTSDEKYLEK-AAAAAGEFSSDKI 135
+SRL+ N K L + ++L L++DLD T++H+ + + S +
Sbjct: 2 LSRLESENVKRLRQEKRLSLIVDLDQTIIHATVDPTVGEWMSDPGNVNYDVLRDVRSFNL 61
Query: 136 SRGNDLFKIKIGDNVLLVKLRPFVRSFLEEASRLFEISVCTMGNREYATRAVKLLDPDCK 195
G + +K RP + FL++ S L+E+ + TMG + YA K++DP K
Sbjct: 62 QEGPSGYTSCY-----YIKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGK 116
Query: 196 YFNSRIITREDFKQKERKCLDLVLGQE-SSIVIVDDTESVWGGRVENLITVGSYDFFKG- 253
F R+++R+D +K L + + S +V++DD VW NLI V Y+FF G
Sbjct: 117 LFQDRVLSRDDSGSLAQKSLRRLFPCDTSMVVVIDDRGDVWDWN-PNLIKVVPYEFFVGI 175
Query: 254 --------------------------KKKNDCKSYSEQMSDE--------------SESD 273
+ + + ++Q + D
Sbjct: 176 GDINSNFLSGNREALEEQNKERVTALELQKSERPLAKQQNALLEDEGKPTPSHTLLHNRD 235
Query: 274 GALANILRALKAVHALYFDNPGNHAAGR------DVRSCLAKIRSRILMGCTILF----- 322
L + + LK +HA+Y++ + ++ +V + K++ ++L GC +LF
Sbjct: 236 HELERLEKVLKDIHAVYYEEENDISSRSGNHKHANVGLIIPKMKQKVLKGCRLLFSGVIP 295
Query: 323 GDDDFEELPLTWSRAEEMGAICTLVTDASITHVVSSNTQSETFEWAEQENKC-LVHPQWI 381
D + A GA L TH++++ ++E + A +V W+
Sbjct: 296 LGVDVLSSDI-AKWAMSFGAEVVLDFSVPPTHLIAAKIRTEKVKKAVSMGNIKVVKLNWL 354
Query: 382 NDAYFLWCRQP 392
++ W R P
Sbjct: 355 TESLSQWKRLP 365
|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Length = 107 | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104 | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 398 | |||
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 100.0 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 100.0 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 100.0 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 100.0 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 99.97 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 99.97 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.82 | |
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 99.81 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 99.79 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 99.77 | |
| 3pa6_A | 107 | Microcephalin; BRCT domain, cell cycle; HET: MSE; | 99.75 | |
| 4id3_A | 92 | DNA repair protein REV1; BRCT domain, protein bind | 99.74 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 99.7 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.66 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 99.63 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 99.59 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 99.58 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 99.55 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 99.54 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 99.53 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 99.48 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.44 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.42 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 99.38 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 99.35 | |
| 2jw5_A | 106 | DNA polymerase lambda; BRCT domain, family X polym | 99.26 | |
| 1l7b_A | 92 | DNA ligase; BRCT, autostructure, structural genomi | 99.23 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 99.22 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 99.22 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 99.22 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 99.19 | |
| 2k6g_A | 109 | Replication factor C subunit 1; protein, BRCT, DNA | 99.15 | |
| 2ebu_A | 112 | Replication factor C subunit 1; A/B/A 3 layers, pa | 99.09 | |
| 2ep8_A | 100 | Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r | 99.07 | |
| 2cok_A | 113 | Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r | 99.01 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 99.0 | |
| 3pc7_A | 88 | DNA ligase 3; DNA repair, BRCT domain, protein:pro | 98.92 | |
| 2coe_A | 120 | Deoxynucleotidyltransferase, terminal variant; BRC | 98.86 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.83 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 98.7 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 98.69 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 98.62 | |
| 2dun_A | 133 | POL MU, DNA polymerase MU; layers A/B/A, parallel | 98.5 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 98.42 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.37 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 98.36 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 98.34 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 98.28 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 98.18 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.14 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 98.07 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 98.05 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 98.03 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 97.97 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 97.96 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 97.94 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 97.93 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 97.92 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 97.91 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 97.91 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 97.89 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 97.89 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 97.89 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 97.87 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 97.86 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 97.85 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 97.79 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 97.76 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 97.76 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 97.67 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 97.67 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 97.66 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 97.66 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 97.65 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 97.63 | |
| 3t7k_A | 256 | RTT107, regulator of TY1 transposition protein 107 | 97.62 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 97.58 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 97.56 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 97.55 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 97.54 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 97.54 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 97.48 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 97.41 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 97.39 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 97.36 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 97.34 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 97.33 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 97.32 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 97.31 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 97.28 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 97.2 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 97.18 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 97.14 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 97.12 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 97.11 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 97.06 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 97.01 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 96.95 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 96.93 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 96.91 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 96.91 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 96.91 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 96.84 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 96.81 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 96.76 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 96.75 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 96.65 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 96.56 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 96.55 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 96.55 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 96.52 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 96.48 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 96.45 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 96.44 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 96.36 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 96.27 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 96.26 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 96.22 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 96.22 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 96.08 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 96.05 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 95.97 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 95.95 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 95.93 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 95.89 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 95.88 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 95.69 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 95.68 | |
| 3oq0_A | 151 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 95.66 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 95.64 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 95.54 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 95.54 | |
| 3qbz_A | 160 | DDK kinase regulatory subunit DBF4; FHA domain,RAD | 95.48 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 95.44 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 95.35 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 95.29 | |
| 2l42_A | 106 | DNA-binding protein RAP1; BRCT domain, protein bin | 95.22 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 95.22 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 95.16 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 95.14 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 95.09 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 95.02 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 95.01 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 94.84 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 94.78 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 94.74 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 94.47 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 94.44 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 94.18 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 94.17 | |
| 3oq4_A | 134 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 94.16 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 94.11 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 93.84 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 93.79 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 93.77 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 93.67 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 93.58 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 93.52 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 93.47 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 93.41 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 93.31 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 93.29 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 93.15 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 92.92 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 92.9 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 92.88 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 92.87 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 92.77 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 92.66 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 92.55 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 92.18 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 92.16 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 92.1 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 92.09 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 91.92 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 91.32 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 90.65 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 90.55 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 90.35 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 90.26 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 90.03 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 89.99 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 89.48 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 89.84 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 89.74 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 89.5 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 88.56 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 88.39 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 88.07 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 87.73 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 87.18 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 86.9 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 86.84 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 86.81 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 86.8 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 86.01 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 85.76 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 84.75 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 84.61 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 82.8 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 82.1 |
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-72 Score=566.78 Aligned_cols=319 Identities=26% Similarity=0.442 Sum_probs=270.2
Q ss_pred CCcccCHHHHHHHhhhcchhhhccCceEEEEeCCCceeeeeccCCCCchHHHHH--H-HHHhhcccccccCCCCCceeEE
Q 039039 68 KGLRYSIDEISRLKKRNTKNLLRMRKLHLVLDLDHTLLHSRWIGKLTSDEKYLE--K-AAAAAGEFSSDKISRGNDLFKI 144 (398)
Q Consensus 68 ~~l~vs~~~a~~~~~~~~~~ll~~~Kl~LVLDLD~TLihs~~~~~~~~~e~~~~--~-~~~~~~~F~~~~~p~~~~~f~~ 144 (398)
+||+||.+||++++++..+||+..|||+||||||+|||||+..+ ...++... + ..+++. +...|.+
T Consensus 1 ~~l~vs~~~a~~~~~~~~~rll~~~Kl~LVLDLDeTLiHs~~~~--~~~~~~~~~~~~~~~~~~---------dv~~F~l 69 (442)
T 3ef1_A 1 SDLTVSLEEASRLESENVKRLRQEKRLSLIVXLDQTIIHATVDP--TVGEWMSDPGNVNYDVLR---------DVRSFNL 69 (442)
T ss_dssp CTTHHHHHHHHHHHHHHHHHHHHTTCEEEEECCBTTTEEEECCT--HHHHHHTCTTSTTTGGGT---------TCEEEEE
T ss_pred CCceecHHHHHHHHHHHHHHHHhcCCeEEEEeeccceecccccc--ccchhccCCCCcchhhhc---------cccceee
Confidence 58999999999999999999999999999999999999999642 11111000 0 001111 1123444
Q ss_pred ee----ccceEEEEeCccHHHHHHHhhccccEEEEcCCcHHHHHHHHHHhCCCCCccceeEEEccCCCCccccccccc-c
Q 039039 145 KI----GDNVLLVKLRPFVRSFLEEASRLFEISVCTMGNREYATRAVKLLDPDCKYFNSRIITREDFKQKERKCLDLV-L 219 (398)
Q Consensus 145 ~~----~~~~~~vklRPgl~eFL~~~s~~yEi~I~T~g~~~YA~~il~~LDP~~~~F~~ri~srd~~~~~~~K~L~~l-~ 219 (398)
.. ..++|||++|||+++||++++++|||+|||||++.||++|++.|||.+.||++|+|||++|+..++|||+++ +
T Consensus 70 ~~~~~~~~~~~~V~~RPgl~eFL~~ls~~yEivIfTas~~~YA~~Vl~~LDp~~~~f~~Rl~sRd~cg~~~~KdL~~ll~ 149 (442)
T 3ef1_A 70 QEGPSGYTSCYYIKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKLFQDRVLSRDDSGSLAQKSLRRLFP 149 (442)
T ss_dssp EETTTTEEEEEEEEECTTHHHHHHHHTTTEEEEEECSSCHHHHHHHHHHHCTTSTTTTTCEECTTTSSCSSCCCGGGTCS
T ss_pred eeccCCceeEEEEEeCCCHHHHHHHHhCCcEEEEEcCCCHHHHHHHHHHhccCCccccceEEEecCCCCceeeehHHhcC
Confidence 32 246899999999999999999999999999999999999999999999999999999999998899999977 6
Q ss_pred CCCCcEEEEeCCcccccCCCCceEEeCccccccCCCCCCCc------------cc-c-----cc-------------c--
Q 039039 220 GQESSIVIVDDTESVWGGRVENLITVGSYDFFKGKKKNDCK------------SY-S-----EQ-------------M-- 266 (398)
Q Consensus 220 ~~~~~vvIiDD~~~vw~~~~~N~I~I~~y~ff~~~~~~~~~------------sl-~-----~~-------------~-- 266 (398)
+++++||||||++++|..|+ |+|+|.||+||.++||.|.. .+ . .. .
T Consensus 150 rdl~~vvIIDd~p~~~~~~p-N~I~I~~~~fF~~~gD~n~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 228 (442)
T 3ef1_A 150 CDTSMVVVIDDRGDVWDWNP-NLIKVVPYEFFVGIGDINSNFLAKSTPLPEQEQLIPLEIPKDEPDSVDEINEENEETPE 228 (442)
T ss_dssp SCCTTEEEEESCSGGGTTCT-TEEECCCCCCSTTCCCSCC----------------------------------------
T ss_pred CCcceEEEEECCHHHhCCCC-CEEEcCCccccCCCCcccccccccccccccccccccccccccccccccccccccccCcc
Confidence 79999999999999999985 99999999999999884321 11 0 00 0
Q ss_pred ------------------------------------------------------------cC----------CCcchHHH
Q 039039 267 ------------------------------------------------------------SD----------ESESDGAL 276 (398)
Q Consensus 267 ------------------------------------------------------------~d----------~~~~D~~L 276 (398)
.| ..++|++|
T Consensus 229 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~rpl~~~q~~l~~~~~~~~~~~~~l~d~D~~L 308 (442)
T 3ef1_A 229 YDSSNSSYAQDSSTIPEKTLLKDTFLQNREALEEQNKERVTALELQKSERPLAKQQNALLEDEGKPTPSHTLLHNRDHEL 308 (442)
T ss_dssp ------------------------------CHHHHHHHHHHHHHHHHHHCHHHHHHHHHHTSCCSCHHHHCSCCCCCCHH
T ss_pred cccccccccccccccchhhhhccccCccchhhHHHHHHhhhhhhhhhccCchhhHHHHhhhhhhccccccccccCCcHHH
Confidence 00 02468999
Q ss_pred HHHHHHHHHHHhhhcCCCCCC------CCCCcchhhhhhhheecccceeEEecCCCCCC----chhhHHHHHHhCCEEee
Q 039039 277 ANILRALKAVHALYFDNPGNH------AAGRDVRSCLAKIRSRILMGCTILFGDDDFEE----LPLTWSRAEEMGAICTL 346 (398)
Q Consensus 277 ~~l~~~L~~ih~~ff~~~~~~------~~~~DVr~il~~~r~~vl~g~~i~fSg~~~~~----~~~l~~la~~lGa~~~~ 346 (398)
..|.++|++||++||+.+++. ...+||+.||+++|+++|+||+|||||++|.. +..++.+++++||+|+.
T Consensus 309 ~~l~~~L~~iH~~fy~~~d~~~~~~~~~~~~Dv~~il~~~k~~~L~G~~IvfSG~~p~~~~~~r~~l~~~~~~lGa~~~~ 388 (442)
T 3ef1_A 309 ERLEKVLKDIHAVYYEEENDISSRSGNHKHANVGLIIPKMKQKVLKGCRLLFSGVIPLGVDVLSSDIAKWAMSFGAEVVL 388 (442)
T ss_dssp HHHHHHHHHHHHHHHHHHHTCCSCCSSSCCCCHHHHHHHHHHTTSTTCEEEEESSSCTTSCSTTSHHHHHHHTTTCEECS
T ss_pred HHHHHHHHHHHHHHHHHhhhcccccccCCCCcHHHHHHHHhhcccCCcEEEEecccCCCCCccHHHHHHHHHHcCCEEeC
Confidence 999999999999999986542 23589999999999999999999999999885 35999999999999999
Q ss_pred ecCCCccEEEECCCCCHHHHHHHhC-CCeeeChhHHHHHHHhcCcCCCCCCCC
Q 039039 347 VTDASITHVVSSNTQSETFEWAEQE-NKCLVHPQWINDAYFLWCRQPNDVSFF 398 (398)
Q Consensus 347 ~~~~~vTHlVa~~~~t~K~~~A~~~-gi~IV~~~WL~~c~~~~~r~~E~~Y~~ 398 (398)
+++++||||||.+.+|.|+++|+++ ||+||+++||++|+..|+++||++|+|
T Consensus 389 ~vs~~vTHLVa~~~~t~K~~~A~~~g~IkIVs~~WL~dcl~~~krldE~~YlL 441 (442)
T 3ef1_A 389 DFSVPPTHLIAAKIRTEKVKKAVSMGNIKVVKLNWLTESLSQWKRLPESDYLL 441 (442)
T ss_dssp SSSSCCSEEEECSCCCHHHHHHHHHSSSEEEEHHHHHHHHHHTSCCCGGGTBC
T ss_pred CCCCCceEEEeCCCCCHHHHHHHhcCCCEEEeHHHHHHHHHcCCcCChhcccc
Confidence 9999999999999999999999998 599999999999999999999999986
|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* | Back alignment and structure |
|---|
| >4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A | Back alignment and structure |
|---|
| >2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* | Back alignment and structure |
|---|
| >2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3t7k_A RTT107, regulator of TY1 transposition protein 107; BRCT, DNA repair, phospho-peptide, protein binding; HET: SEP; 2.03A {Saccharomyces cerevisiae} PDB: 3t7j_A* 3t7i_A | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3oq0_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >3qbz_A DDK kinase regulatory subunit DBF4; FHA domain,RAD53, replication checkpoint, cell cycle; 2.69A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oq4_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 398 | ||||
| d1ta0a_ | 181 | c.108.1.16 (A:) Carboxy-terminal domain RNA polyme | 2e-22 | |
| d1wf6a_ | 132 | c.15.1.5 (A:) DNA topoisomerase II binding protein | 3e-06 | |
| d1cdza_ | 96 | c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Hom | 0.003 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 91.6 bits (227), Expect = 2e-22
Identities = 42/225 (18%), Positives = 75/225 (33%), Gaps = 52/225 (23%)
Query: 86 KNLLRMRKLHLVLDLDHTLLHSRWIGKLTSDEKYLEKAAAAAGEFSSDKISRGNDLFKIK 145
K+ +V+DLD TL+HS + +D +I
Sbjct: 8 AKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIP---------------------VEID 46
Query: 146 IGDNVLLVKLRPFVRSFLEEASRLFEISVCTMGNREYATRAVKLLDPDCKYFNSRIITRE 205
+ + V RP V FL+ LFE + T +YA LLD +
Sbjct: 47 GVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESC 106
Query: 206 DFKQ-KERKCLDLVLGQESSIVIVDDTESVWGGRVENLITVGSYDFFKGKKKNDCKSYSE 264
F + K L + ++I+D++ + + +N + V S+
Sbjct: 107 VFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASW---------------- 150
Query: 265 QMSDESESDGALANILRALKAVHALYFDNPGNHAAGRDVRSCLAK 309
++ SD L ++L + + + DV S L +
Sbjct: 151 ---FDNMSDTELHDLLPFFEQLSRV-----------DDVYSVLRQ 181
|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 398 | |||
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 100.0 | |
| d1wf6a_ | 132 | DNA topoisomerase II binding protein 1, TopBP1 {Hu | 99.68 | |
| d1cdza_ | 96 | DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta | 99.66 | |
| d1t15a1 | 109 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.65 | |
| d1t15a2 | 102 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.6 | |
| d1l7ba_ | 92 | NAD+-dependent DNA ligase, domain 4 {Thermus therm | 99.32 | |
| d1in1a_ | 88 | DNA ligase III alpha {Human (Homo sapiens) [TaxId: | 99.21 | |
| d1kzyc1 | 153 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 99.07 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 98.63 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 98.41 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 98.37 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 98.31 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 98.23 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 98.23 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.21 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 98.09 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 97.93 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 97.87 | |
| d1l0ba2 | 97 | Breast cancer associated protein, BRCA1 {Rat (Ratt | 97.84 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 97.77 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 97.74 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 97.72 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 97.58 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 97.58 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 97.41 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 97.3 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 97.18 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 97.04 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 97.01 | |
| d1kzyc2 | 106 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 96.96 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 96.94 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 96.74 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 96.68 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 96.63 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 96.1 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 96.06 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 96.02 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 95.22 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 95.01 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 95.0 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 94.7 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 94.11 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 93.87 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 93.8 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 93.29 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 93.27 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 93.05 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 93.03 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 93.0 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 92.3 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 92.3 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 92.23 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 91.96 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 91.9 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 91.53 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 91.43 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 91.04 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 88.12 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 87.74 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.4e-39 Score=292.86 Aligned_cols=168 Identities=26% Similarity=0.308 Sum_probs=141.9
Q ss_pred hhhccCceEEEEeCCCceeeeeccCCCCchHHHHHHHHHhhcccccccCCCCCceeE--EeeccceEEEEeCccHHHHHH
Q 039039 87 NLLRMRKLHLVLDLDHTLLHSRWIGKLTSDEKYLEKAAAAAGEFSSDKISRGNDLFK--IKIGDNVLLVKLRPFVRSFLE 164 (398)
Q Consensus 87 ~ll~~~Kl~LVLDLD~TLihs~~~~~~~~~e~~~~~~~~~~~~F~~~~~p~~~~~f~--~~~~~~~~~vklRPgl~eFL~ 164 (398)
+...++|++||||||||||||+..+..+ ....+. .......+|+++|||+++||+
T Consensus 9 ~~~~~~k~~LVLDLDeTLihs~~~~~~~-----------------------~~~~~~~~~~~~~~~~~v~~RP~l~eFL~ 65 (181)
T d1ta0a_ 9 KAQDSDKICVVIDLDETLVHSSFKPVNN-----------------------ADFIIPVEIDGVVHQVYVLKRPHVDEFLQ 65 (181)
T ss_dssp CGGGTTSCEEEECCBTTTEEEESSCCTT-----------------------CSEEEEEEETTEEEEEEEEECTTHHHHHH
T ss_pred CcccCCCeEEEEeCCCCEEccccCCCCC-----------------------ccceeeecccceeeeeEEecCCCHHHHHH
Confidence 4556799999999999999998642111 111222 222345789999999999999
Q ss_pred HhhccccEEEEcCCcHHHHHHHHHHhCCCCCccceeEEEccCCCC---ccccccccccCCCCcEEEEeCCcccccCCCCc
Q 039039 165 EASRLFEISVCTMGNREYATRAVKLLDPDCKYFNSRIITREDFKQ---KERKCLDLVLGQESSIVIVDDTESVWGGRVEN 241 (398)
Q Consensus 165 ~~s~~yEi~I~T~g~~~YA~~il~~LDP~~~~F~~ri~srd~~~~---~~~K~L~~l~~~~~~vvIiDD~~~vw~~~~~N 241 (398)
+++++|||+|||||+++||++|++.|||++. |..++ +|++|.. .+.|+|+++++++++||||||++.+|..|++|
T Consensus 66 ~l~~~yei~I~Ta~~~~YA~~il~~ldp~~~-~~~~~-~r~~c~~~~~~~~KdL~~l~~~l~~vvivDd~~~~~~~~~~N 143 (181)
T d1ta0a_ 66 RMGELFECVLFTASLAKYADPVADLLDKWGA-FRARL-FRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDN 143 (181)
T ss_dssp HHHHHSEEEEECSSCHHHHHHHHHHHCSSCC-EEEEE-CGGGSEEETTEEECCGGGSCSCGGGEEEECSCGGGGTTCGGG
T ss_pred HHHhceEEEEEcCCcHHHHHHHHHHhccCCc-eeEEE-EeeeeeecCCcccccHhhcCCCHHHeEEEcCChhhhhcCccC
Confidence 9999999999999999999999999999984 54554 5999865 57899999999999999999999999999999
Q ss_pred eEEeCccccccCCCCCCCccccccccCCCcchHHHHHHHHHHHHHHhhhcCCCCCCCCCCcchhhhhh
Q 039039 242 LITVGSYDFFKGKKKNDCKSYSEQMSDESESDGALANILRALKAVHALYFDNPGNHAAGRDVRSCLAK 309 (398)
Q Consensus 242 ~I~I~~y~ff~~~~~~~~~sl~~~~~d~~~~D~~L~~l~~~L~~ih~~ff~~~~~~~~~~DVr~il~~ 309 (398)
+|+|+||. ++++|++|..++++|+++++ .+|||++|++
T Consensus 144 ~I~I~~f~-------------------~~~~D~eL~~l~~~L~~l~~-----------~~DVR~~l~~ 181 (181)
T d1ta0a_ 144 AVPVASWF-------------------DNMSDTELHDLLPFFEQLSR-----------VDDVYSVLRQ 181 (181)
T ss_dssp BCCCCCCS-------------------SCTTCCHHHHHHHHHHHHTT-----------CSCHHHHHCC
T ss_pred eeEecCcC-------------------CCCCcHHHHHHHHHHHHHcc-----------CCcHHHHhcC
Confidence 99999997 46789999999999999986 7899999864
|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|