Citrus Sinensis ID: 039109

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
MVSEYQTRFERLLARAGHLTDKQEAECFISGLKDGLRTDVQKYTFGHKCKKLFLIEAEEGDEPKEHEKEKDVTQETPAISLHALARVQSPQTMRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFYLLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVTLRGATTSELKAIEGDTIQKTLRKN
cHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccccccEEEEEHHcccccccccccccccccccEEcHHHHHccccccEEEEEEEEccEEEEEEcccccccccccHHHHHHHccccccccccEEEEcccccccccccEEEEEEEEccEEEEEEEEEEccccccEEEccHHHHHHccEEEEccccEEEEEEccEEEEEEEccccccccccHHHHHHHHHcc
ccccccccHHHHccHHHHHHHHHcccEEccccccccccccccccccccccccEEEEEEcccccccccccccccccccEEEEEHHcccccccEEEEEEEEccEEEEEEEEcccccccccHHHHHHcccccccccccEEEEccccEEEEccEccccEEEEEcEEccccEEEEEcccccEEEEHHHHHHcccEEEEcccEEEEEEEcccEEEEEEcccccccccHHHHHHHHHccc
MVSEYQTRFERLLARaghltdkqEAECFISGLKDGLRTDVQKYTFGHKCKKLFLIEaeegdepkehekekdvtqetpaISLHALArvqspqtmrlqssiSKASLTILIDsgsthnflhhkfakitglksepgcLLSVVVAngekltspgrckgvqlQLQGTQIEAYFYLLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVTLRGATTSELKAIEGDTIQKTLRKN
MVSEYQTRFERLLaraghltdkqeAECFISGLKDGLRTDVQKYTFGHKCKKLFLIEaeegdepkehekekdvtqetPAISLHALARVQSPQTMRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFYLLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVtlrgattselkaiegdtiqktlrkn
MVSEYQTRFERLLARAGHLTDKQEAECFISGLKDGLRTDVQKYTFGHKCKKLFLIeaeegdepkehekekDVTQETPAISLHALARVQSPQTMRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFYLLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVTLRGATTSELKAIEGDTIQKTLRKN
*********ERLLARAGHLTDKQEAECFISGLKDGLRTDVQKYTFGHKCKKLFLIE*********************************************ASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFYLLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVTL***********************
MVSEYQTRFERLL****************SGLKDGLRTDVQKYTFGHKCKKL***************************SLHALARVQSPQTMRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFYLLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVTL****************Q******
********FERLLARAGHLTDKQEAECFISGLKDGLRTDVQKYTFGHKCKKLFLIEAEE***************ETPAISLHALARV***********ISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFYLLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVTLRGATTSELKAIEGDTIQKTLRKN
*******R*ERLLARAGHLTDKQEAECFISGLKDGLRTDVQKYTFGHKCKKLFLIEAEEGD************QETPAISLHALARVQSPQTMRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFYLLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVTLRGATTSELKAI************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSEYQTRFERLLARAGHLTDKQEAECFISGLKDGLRTDVQKYTFGHKCKKLFLIEAEEGDEPKEHEKEKDVTQETPAISLHALARVQSPQTMRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFYLLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVTLRGATTSELKAIEGDTIQKTLRKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
147811718 1365 hypothetical protein VITISV_008352 [Viti 0.519 0.088 0.685 2e-34
147843077 1366 hypothetical protein VITISV_044100 [Viti 0.824 0.140 0.388 1e-33
147789424 2822 hypothetical protein VITISV_017554 [Viti 0.824 0.068 0.383 1e-33
147774273 1469 hypothetical protein VITISV_026680 [Viti 0.824 0.130 0.388 2e-33
218197921 402 hypothetical protein OsI_22431 [Oryza sa 0.905 0.524 0.352 5e-30
108864287 413 retrotransposon protein, putative, uncla 0.716 0.404 0.393 1e-28
62734405 575 retrotransposon protein, putative, uncla 0.699 0.283 0.412 2e-28
170660047 953 polyprotein [Ananas comosus] 0.626 0.153 0.431 2e-26
12322948 1447 gypsy/Ty3 element polyprotein, putative 0.785 0.126 0.394 2e-26
12322008 1499 gypsy/Ty-3 retroelement polyprotein; 699 0.806 0.125 0.369 3e-26
>gi|147811718|emb|CAN77256.1| hypothetical protein VITISV_008352 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 94/124 (75%), Gaps = 3/124 (2%)

Query: 41  QKYTFGHKCKKLFLIEAEEGDEPKEHEKEKDVTQETPAISLHALARVQSPQTMRLQSSIS 100
           +KYT GHKCKKLF IE EE     E   E++  +ETP ISLHALA VQSPQTM++ S I 
Sbjct: 546 EKYTMGHKCKKLFFIELEEE---NEESIEEEYVEETPTISLHALAGVQSPQTMQIHSQIG 602

Query: 101 KASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQG 160
           K  LTILIDSGSTHNFLHHKFAKI GLKSE  CL SVVVANGE+L+S GRC GV+L LQ 
Sbjct: 603 KTPLTILIDSGSTHNFLHHKFAKIIGLKSERSCLFSVVVANGERLSSLGRCNGVKLFLQD 662

Query: 161 TQIE 164
             IE
Sbjct: 663 IPIE 666

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147843077|emb|CAN83300.1| hypothetical protein VITISV_044100 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789424|emb|CAN66607.1| hypothetical protein VITISV_017554 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147774273|emb|CAN76793.1| hypothetical protein VITISV_026680 [Vitis vinifera] Back     alignment and taxonomy information
>gi|218197921|gb|EEC80348.1| hypothetical protein OsI_22431 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|108864287|gb|ABA92869.2| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|62734405|gb|AAX96514.1| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|170660047|gb|ACB28472.1| polyprotein [Ananas comosus] Back     alignment and taxonomy information
>gi|12322948|gb|AAG51464.1|AC069160_10 gypsy/Ty3 element polyprotein, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12322008|gb|AAG51046.1|AC069473_8 gypsy/Ty-3 retroelement polyprotein; 69905-74404 [Arabidopsis thaliana] gi|10998138|dbj|BAB03109.1| retroelement pol polyprotein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
TAIR|locus:2091793 421 AT3G29750 [Arabidopsis thalian 0.549 0.304 0.290 9.1e-07
TAIR|locus:2091793 AT3G29750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 135 (52.6 bits), Expect = 9.1e-07, P = 9.1e-07
 Identities = 38/131 (29%), Positives = 63/131 (48%)

Query:    93 MRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCK 152
             MR    I    + + IDSG+T NF+  + A    L +      SV++   + + S G C 
Sbjct:   124 MRFYGFILDHKVVVAIDSGATDNFILVELAFSLKLPTSITNQASVLLGQRQCIQSVGTCL 183

Query:   153 GVQLQLQGTQIEAYFYLLSLE--GCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVTL 210
             G++L +Q  +I   F LL L     D +LG +WL  LG  + ++   +  F+ +   +TL
Sbjct:   184 GIRLWVQEVEITENFLLLDLAKTDVDVILGYEWLSKLGETMVNWQNQDFSFSHNQQWITL 243

Query:   211 RGATTSELKAI 221
               A   EL+ +
Sbjct:   244 C-AEHEELEQV 253


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.134   0.390    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      233       218   0.00091  112 3  11 22  0.36    33
                                                     32  0.39    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  604 (64 KB)
  Total size of DFA:  170 KB (2100 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  15.57u 0.12s 15.69t   Elapsed:  00:00:01
  Total cpu time:  15.57u 0.12s 15.69t   Elapsed:  00:00:01
  Start:  Fri May 10 09:21:37 2013   End:  Fri May 10 09:21:38 2013
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004812 "aminoacyl-tRNA ligase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006418 "tRNA aminoacylation for protein translation" evidence=IEA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00008595001
SubName- Full=Chromosome chr6 scaffold_202, whole genome shotgun sequence; (150 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
cd0030392 cd00303, retropepsin_like, Retropepsins; pepsin-li 1e-20
pfam08284135 pfam08284, RVP_2, Retroviral aspartyl protease 1e-09
pfam1365089 pfam13650, Asp_protease_2, Aspartyl protease 1e-05
pfam1397572 pfam13975, gag-asp_proteas, gag-polyprotein putati 3e-04
>gnl|CDD|133136 cd00303, retropepsin_like, Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information 
 Score = 82.4 bits (204), Expect = 1e-20
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 1/88 (1%)

Query: 98  SISKASLTILIDSGSTHNFLHHKFAKITGLKSEP-GCLLSVVVANGEKLTSPGRCKGVQL 156
            I+   +  L+DSG++ NF+    AK  GL        L V  ANG  + + G    V +
Sbjct: 4   KINGVPVRALVDSGASVNFISESLAKKLGLPPRLLPTPLKVKGANGSSVKTLGVILPVTI 63

Query: 157 QLQGTQIEAYFYLLSLEGCDAVLGAQWL 184
            + G      FY+L L   D +LG  WL
Sbjct: 64  GIGGKTFTVDFYVLDLLSYDVILGRPWL 91

The family includes pepsin-like aspartate proteases from retroviruses, retrotransposons and retroelements, as well as eukaryotic dna-damage-inducible proteins (DDIs), and bacterial aspartate peptidases. While fungal and mammalian pepsins are bilobal proteins with structurally related N and C-terminals, retropepsins are half as long as their fungal and mammalian counterparts. The monomers are structurally related to one lobe of the pepsin molecule and retropepsins function as homodimers. The active site aspartate occurs within a motif (Asp-Thr/Ser-Gly), as it does in pepsin. Retroviral aspartyl protease is synthesized as part of the POL polyprotein that contains an aspartyl protease, a reverse transcriptase, RNase H, and an integrase. The POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. In aspartate peptidases, Asp residues are ligands of an activated water molecule in all examples where catalytic residues have been identified. This group of aspartate peptidases is classified by MEROPS as the peptidase family A2 (retropepsin family, clan AA), subfamily A2A. Length = 92
>gnl|CDD|116868 pfam08284, RVP_2, Retroviral aspartyl protease Back     alignment and domain information
>gnl|CDD|222288 pfam13650, Asp_protease_2, Aspartyl protease Back     alignment and domain information
>gnl|CDD|206145 pfam13975, gag-asp_proteas, gag-polyprotein putative aspartyl protease Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 233
PF08284135 RVP_2: Retroviral aspartyl protease; InterPro: IPR 99.97
cd05479124 RP_DDI RP_DDI; retropepsin-like domain of DNA dama 99.93
cd0548491 retropepsin_like_LTR_2 Retropepsins_like_LTR, peps 99.81
PF09668124 Asp_protease: Aspartyl protease; InterPro: IPR0191 99.71
TIGR02281121 clan_AA_DTGA clan AA aspartic protease, TIGR02281 99.64
PF1365090 Asp_protease_2: Aspartyl protease 99.6
cd05480103 NRIP_C NRIP_C; putative nuclear receptor interacti 99.56
cd0548396 retropepsin_like_bacteria Bacterial aspartate prot 99.55
PF02160201 Peptidase_A3: Cauliflower mosaic virus peptidase ( 99.51
PF00077100 RVP: Retroviral aspartyl protease The Prosite entr 99.5
cd0030392 retropepsin_like Retropepsins; pepsin-like asparta 99.46
PF1397572 gag-asp_proteas: gag-polyprotein putative aspartyl 99.46
TIGR03698107 clan_AA_DTGF clan AA aspartic protease, AF_0612 fa 99.44
PF12384177 Peptidase_A2B: Ty3 transposon peptidase; InterPro: 99.42
cd0609586 RP_RTVL_H_like Retropepsin of the RTVL_H family of 99.42
KOG0012380 consensus DNA damage inducible protein [Replicatio 99.39
COG3577215 Predicted aspartyl protease [General function pred 99.08
cd0548193 retropepsin_like_LTR_1 Retropepsins_like_LTR; peps 98.94
cd0609489 RP_Saci_like RP_Saci_like, retropepsin family. Ret 98.88
COG5550125 Predicted aspartyl protease [Posttranslational mod 98.35
PF05585164 DUF1758: Putative peptidase (DUF1758); InterPro: I 98.01
cd0548287 HIV_retropepsin_like Retropepsins, pepsin-like asp 97.82
PF0373296 Retrotrans_gag: Retrotransposon gag protein ; Inte 97.68
PF12382137 Peptidase_A2E: Retrotransposon peptidase; InterPro 96.51
PF00026317 Asp: Eukaryotic aspartyl protease The Prosite entr 95.68
cd05476265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 95.56
cd06096326 Plasmepsin_5 Plasmepsins are a class of aspartic p 95.14
cd06097278 Aspergillopepsin_like Aspergillopepsin_like, aspar 95.12
cd06098317 phytepsin Phytepsin, a plant homolog of mammalian 95.03
cd05477318 gastricsin Gastricsins, asparate proteases produce 94.93
cd05478317 pepsin_A Pepsin A, aspartic protease produced in g 94.87
cd05474295 SAP_like SAPs, pepsin-like proteinases secreted fr 94.81
cd05485329 Cathepsin_D_like Cathepsin_D_like, pepsin family o 94.6
cd05486316 Cathespin_E Cathepsin E, non-lysosomal aspartic pr 94.15
COG4067162 Uncharacterized protein conserved in archaea [Post 93.78
cd05488320 Proteinase_A_fungi Fungal Proteinase A , aspartic 93.56
cd05471283 pepsin_like Pepsin-like aspartic proteases, biloba 93.23
PTZ00147453 plasmepsin-1; Provisional 92.54
cd05490325 Cathepsin_D2 Cathepsin_D2, pepsin family of protei 92.06
PTZ00013450 plasmepsin 4 (PM4); Provisional 91.31
cd05472299 cnd41_like Chloroplast Nucleoids DNA-binding Prote 90.93
cd05470109 pepsin_retropepsin_like Cellular and retroviral pe 90.84
PF05618138 Zn_protease: Putative ATP-dependant zinc protease; 90.64
cd05487326 renin_like Renin stimulates production of angioten 90.51
cd05474 295 SAP_like SAPs, pepsin-like proteinases secreted fr 90.3
PTZ00147 453 plasmepsin-1; Provisional 90.03
PF00026 317 Asp: Eukaryotic aspartyl protease The Prosite entr 89.41
PTZ00013 450 plasmepsin 4 (PM4); Provisional 88.96
PTZ00165482 aspartyl protease; Provisional 88.67
PF14223119 UBN2: gag-polypeptide of LTR copia-type 88.64
cd05476 265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 85.26
cd06097 278 Aspergillopepsin_like Aspergillopepsin_like, aspar 85.24
PLN03146431 aspartyl protease family protein; Provisional 84.11
cd05473364 beta_secretase_like Beta-secretase, aspartic-acid 83.9
>PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) Back     alignment and domain information 
Probab=99.97  E-value=6.1e-30  Score=197.92  Aligned_cols=115  Identities=32%  Similarity=0.552  Sum_probs=105.4

Q ss_pred             ccCCeEEEEEeeCCeeEEEEEcCCCccccccHHHHHHhCCccCC-CceeEEEEcCCceeccCCceeceeEeecceeEEEE
Q 039109           88 QSPQTMRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEP-GCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAY  166 (233)
Q Consensus        88 ~~~~t~~v~~~i~~~~~~~LiDSGAt~nfIs~~~a~~l~l~~~~-~~~~~v~~a~G~~~~~~~~~~~~~~~i~g~~~~~~  166 (233)
                      .++.+|.....|+++++.+||||||||||||+++|++++++..+ ..++.|. ++|+.+.+.+.|+.++|.++|+.|..+
T Consensus        17 ~~~~vi~g~~~I~~~~~~vLiDSGAThsFIs~~~a~~~~l~~~~l~~~~~V~-~~g~~~~~~~~~~~~~~~i~g~~~~~d   95 (135)
T PF08284_consen   17 ESPDVITGTFLINSIPASVLIDSGATHSFISSSFAKKLGLPLEPLPRPIVVS-APGGSINCEGVCPDVPLSIQGHEFVVD   95 (135)
T ss_pred             CCCCeEEEEEEeccEEEEEEEecCCCcEEccHHHHHhcCCEEEEccCeeEEe-cccccccccceeeeEEEEECCeEEEee
Confidence            45678999999999999999999999999999999999999985 5677776 457778888999999999999999999


Q ss_pred             EEEeecCCCccccchhHHhhhCCeEEEccccEEEEEeC
Q 039109          167 FYLLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKD  204 (233)
Q Consensus       167 ~~Vl~l~~~d~ILG~dwL~~~~~i~id~~~~~~~f~~~  204 (233)
                      |.|++++++|+|||||||.+|+| .|||.+++++|...
T Consensus        96 l~vl~l~~~DvILGm~WL~~~~~-~IDw~~k~v~f~~p  132 (135)
T PF08284_consen   96 LLVLDLGGYDVILGMDWLKKHNP-VIDWATKTVTFNSP  132 (135)
T ss_pred             eEEecccceeeEeccchHHhCCC-EEEccCCEEEEeCC
Confidence            99999999999999999999999 69999999999863

These proteases are generally part of a larger polyprotein; usually pol, more rarely gag. Retroviral proteases appear to be homologous to a single domain of the two-domain eukaryotic aspartyl proteases.
>cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein Back     alignment and domain information
>cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases Back     alignment and domain information
>PF09668 Asp_protease: Aspartyl protease; InterPro: IPR019103 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family Back     alignment and domain information
>PF13650 Asp_protease_2: Aspartyl protease Back     alignment and domain information
>cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein Back     alignment and domain information
>cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>PF02160 Peptidase_A3: Cauliflower mosaic virus peptidase (A3); InterPro: IPR000588 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00303 retropepsin_like Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information
>PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease Back     alignment and domain information
>TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family Back     alignment and domain information
>PF12384 Peptidase_A2B: Ty3 transposon peptidase; InterPro: IPR024650 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements Back     alignment and domain information
>KOG0012 consensus DNA damage inducible protein [Replication, recombination and repair] Back     alignment and domain information
>COG3577 Predicted aspartyl protease [General function prediction only] Back     alignment and domain information
>cd05481 retropepsin_like_LTR_1 Retropepsins_like_LTR; pepsin-like aspartate protease from retrotransposons with long terminal repeats Back     alignment and domain information
>cd06094 RP_Saci_like RP_Saci_like, retropepsin family Back     alignment and domain information
>COG5550 Predicted aspartyl protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05585 DUF1758: Putative peptidase (DUF1758); InterPro: IPR008737 This is a family of nematode proteins of unknown function [] Back     alignment and domain information
>cd05482 HIV_retropepsin_like Retropepsins, pepsin-like aspartate proteases Back     alignment and domain information
>PF03732 Retrotrans_gag: Retrotransposon gag protein ; InterPro: IPR005162 Transposable elements (TEs) promote various chromosomal rearrangements more efficiently, and often more specifically, than other cellular processes Back     alignment and domain information
>PF12382 Peptidase_A2E: Retrotransposon peptidase; InterPro: IPR024648 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease Back     alignment and domain information
>COG4067 Uncharacterized protein conserved in archaea [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information
>PTZ00013 plasmepsin 4 (PM4); Provisional Back     alignment and domain information
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases Back     alignment and domain information
>PF05618 Zn_protease: Putative ATP-dependant zinc protease; InterPro: IPR008503 This family consists of several hypothetical proteins from different archaeal and bacterial species Back     alignment and domain information
>cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>PTZ00013 plasmepsin 4 (PM4); Provisional Back     alignment and domain information
>PTZ00165 aspartyl protease; Provisional Back     alignment and domain information
>PF14223 UBN2: gag-polypeptide of LTR copia-type Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>PLN03146 aspartyl protease family protein; Provisional Back     alignment and domain information
>cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 7e-13
>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Length = 148 Back     alignment and structure
 Score = 63.2 bits (153), Expect = 7e-13
 Identities = 23/133 (17%), Positives = 44/133 (33%), Gaps = 7/133 (5%)

Query: 82  HALARVQSPQT------MRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLL 135
           H  +    P+       + +   ++   L   +DSG+    +    A+   +        
Sbjct: 8   HHHSSGLVPRGSGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRW 67

Query: 136 SVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFYLLSLEGCDAVLGAQWLCTLGSILWDFD 195
           + V          GR    Q+Q++G  ++  F +L  +  D +LG   L        D  
Sbjct: 68  AGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCS-IDLK 126

Query: 196 KMEMQFTKDGHQV 208
           K  +     G Q 
Sbjct: 127 KNVLVIGTTGTQT 139

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 99.9
2i1a_A148 DNA damage-inducible protein DDI1; acid protease f 99.83
3slz_A132 GAG-Pro-POL polyprotein; beta sheet and dimer, pro 99.07
1fmb_A104 EIAV protease; hydrolase (acid proteinase), RNA-di 99.03
3ec0_A99 Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 98.68
2hs1_A99 HIV-1 protease; ultra-high resolution active site 98.62
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 98.2
2hah_A116 Protease, retropepsin; retroviral, aspartyl, hydro 98.19
3sqf_A114 Protease; folded monomer, retropepsin, D-type retr 97.67
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 97.64
2rsp_A124 RSV protease; hydrolase(aspartyl proteinase); 2.00 97.02
2pma_A146 Uncharacterized protein; APC86035.2, protein LPG00 96.75
3liy_A116 Protease; hydrolase, hydrolase-hydrolase inhibitor 95.65
2apr_A325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 95.44
3qvc_A451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 94.99
1izd_A323 Aspartic proteinase; sugar binding, acid protease, 94.72
1yg9_A330 Aspartic protease BLA G 2; allegren, hydrolase, al 94.54
1am5_A324 Pepsin, acid proteinase; aspartyl protease, hydrol 94.49
4aa9_A320 Chymosin; hydrolase, aspartic peptidase, rennet; H 94.44
3cms_A323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 94.31
1bxo_A323 Protein (penicillopepsin); hydrolase, phosphonate 94.2
1ibq_A325 Aspergillopepsin; aspartic proteinase, hydrolase; 94.04
1lya_B241 Cathepsin D; lysosomal aspartic protease; HET: NAG 94.02
1dpj_A329 Proteinase A; proteinase A, hydrolase-hydrolase in 93.97
3c9x_A329 Trichoderma reesei aspartic protease; aspartic pro 93.86
1miq_A375 Plasmepsin; aspartic proteinase zymogen, domain op 93.71
3fv3_A339 SAPP1P-secreted aspartic protease 1; secreted aspa 93.68
3k1w_A341 Renin; protease, alternative splicing, aspartyl pr 93.52
1oew_A329 Endothiapepsin; hydrolase, aspartic proteinase mec 93.45
1tzs_A351 Cathepsin E; hydrolase, aspartic protease, activat 93.44
2bju_A453 Plasmepsin II; aspartic proteinase, drug design, m 93.37
2x0b_A383 Renin; hydrolase-hormone complex, hydrolase hormon 92.99
1wkr_A340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 92.63
1mpp_A361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 92.39
1j71_A334 Candidapepsin, aspartic proteinase; candida tropic 92.2
3aup_A403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 92.13
1htr_B329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 91.94
2jys_A107 Protease/reverse transcriptase; retroviral proteas 91.64
3pvk_A342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 91.54
3psg_A370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 91.21
2qzx_A342 Candidapepsin-5; aspartic proteinase, aspartyl pro 90.88
1bxo_A 323 Protein (penicillopepsin); hydrolase, phosphonate 87.31
1ibq_A 325 Aspergillopepsin; aspartic proteinase, hydrolase; 87.25
3lpj_A455 Beta-secretase 1; alzheimer'S, aspartyl protease, 87.02
3qvc_A 451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 86.65
2bju_A 453 Plasmepsin II; aspartic proteinase, drug design, m 86.37
1izd_A 323 Aspartic proteinase; sugar binding, acid protease, 85.71
1t6e_X381 Xylanase inhibitor; two beta-barrel domain structu 84.98
2ewy_A383 Beta-secretase 2; BACE2, aspartic protease, hydrol 84.97
1wkr_A 340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 84.95
2x0b_A 383 Renin; hydrolase-hormone complex, hydrolase hormon 84.76
1yg9_A 330 Aspartic protease BLA G 2; allegren, hydrolase, al 83.79
3vf3_A402 Beta-secretase 1; structure-based drug design, hyd 82.87
3c9x_A 329 Trichoderma reesei aspartic protease; aspartic pro 82.36
1tzs_A 351 Cathepsin E; hydrolase, aspartic protease, activat 82.05
3cms_A 323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 81.63
1miq_A 375 Plasmepsin; aspartic proteinase zymogen, domain op 80.59
>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=6.9e-24  Score=165.49  Aligned_cols=125  Identities=17%  Similarity=0.191  Sum_probs=102.9

Q ss_pred             cCCeEEEEEeeCCeeEEEEEcCCCccccccHHHHHHhCCccCCCceeEEEEcCCceeccCCceeceeEeecceeEEEEEE
Q 039109           89 SPQTMRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFY  168 (233)
Q Consensus        89 ~~~t~~v~~~i~~~~~~~LiDSGAt~nfIs~~~a~~l~l~~~~~~~~~v~~a~G~~~~~~~~~~~~~~~i~g~~~~~~~~  168 (233)
                      ..+.+++.+.|||+++.+||||||++||||.++|+++|++......+.......+...+.+.+..+++++++..+.++|.
T Consensus        21 ~~~~l~v~~~Ing~~v~~LVDTGAs~s~Is~~~A~rlGL~~~~~~~~~~~a~g~G~~~~~g~v~~~~I~Ig~~~~~~~~~  100 (148)
T 3s8i_A           21 QVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFS  100 (148)
T ss_dssp             -CCCCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHTTCGGGEEGGGCEECCC---CEEEEEEEEEEEEETTEEEEEEEE
T ss_pred             ccCEEEEEEEECCEEEEEEEeCCCCcEeeCHHHHHHcCCccccCcceeEEEEcCCccEEEEEEEEEEEEECCEEEEEEEE
Confidence            35689999999999999999999999999999999999986422223333222223445677888899999999999999


Q ss_pred             EeecCCCccccchhHHhhhCCeEEEccccEEEEEeCCeEEEEEecC
Q 039109          169 LLSLEGCDAVLGAQWLCTLGSILWDFDKMEMQFTKDGHQVTLRGAT  214 (233)
Q Consensus       169 Vl~l~~~d~ILG~dwL~~~~~i~id~~~~~~~f~~~g~~v~l~g~~  214 (233)
                      |++...+|+|||||||.+++. .|||++++|+|...++.+.+.+..
T Consensus       101 Vle~~~~d~LLGmD~L~~~~~-~ID~~~~~L~l~~~~~~~pfl~~~  145 (148)
T 3s8i_A          101 ILEDQPMDMLLGLDMLRRHQC-SIDLKKNVLVIGTTGTQTYFLPEG  145 (148)
T ss_dssp             EETTCSSSEEECHHHHHHTTC-EEETTTTEEECTTTCCEEECCCGG
T ss_pred             EeCCCCcCeeccHHHHHhCCE-EEEcCCCEEEEccCCeEEeecCcc
Confidence            999999999999999999998 599999999998877888776654
>2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3slz_A GAG-Pro-POL polyprotein; beta sheet and dimer, protease, peptide inhibitor, TL-3 PEPS virus, hydrolase-hydrolase inhibitor complex; HET: 3TL; 1.40A {Dg-75 murine leukemia virus} PDB: 3nr6_A* 3sm1_A* 3sm2_A* 4exh_A* Back     alignment and structure
>1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* Back     alignment and structure
>3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... Back     alignment and structure
>2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>2hah_A Protease, retropepsin; retroviral, aspartyl, hydrolase-hydrolase complex; HET: 3TL; 1.70A {Feline immunodeficiency virus} PDB: 3ogp_A* 3ogq_A* 2fiv_A* 6fiv_A* 3fiv_A* 5fiv_A* 4fiv_A* 1fiv_A* 1b11_A* Back     alignment and structure
>3sqf_A Protease; folded monomer, retropepsin, D-type retrovirus; 1.63A {Mason-pfizer monkey virus} SCOP: b.50.1.1 PDB: 1nso_A Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>2rsp_A RSV protease; hydrolase(aspartyl proteinase); 2.00A {Rous sarcoma virus} SCOP: b.50.1.1 PDB: 1mvp_A 1bai_A* Back     alignment and structure
>2pma_A Uncharacterized protein; APC86035.2, protein LPG0085, DUF785, legionella pneumophila pneumophila STR. philadelphia 1; 1.89A {Legionella pneumophila subsp} SCOP: b.50.1.3 Back     alignment and structure
>3liy_A Protease; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.86A {Human t-lymphotropic virus 1} PDB: 2b7f_A* 3liq_A* 3lit_A* 3liv_A* 3lix_A* 3lin_A* Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Back     alignment and structure
>4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Back     alignment and structure
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Back     alignment and structure
>2jys_A Protease/reverse transcriptase; retroviral protease, hydrolase; NMR {Simian foamy virus type 1} Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Back     alignment and structure
>2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
d2fmba_104 EIAV protease {Equine infectious anemia virus [Tax 98.83
d4fiva_113 Feline immunodeficiency virus (FIV) protease {Feli 98.15
d1nsoa_107 Mason-Pfizer monkey virus protease {Simian retrovi 97.92
d2nmza199 Human immunodeficiency virus type 1 protease {Huma 97.79
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 97.72
d3ecga199 Human immunodeficiency virus type 2 (HIV-2) protea 97.61
d2rspa_124 Rous sarcoma virus protease {Rous sarcoma virus, s 96.88
d1izea_323 Acid protease {Fungus (Aspergillus oryzae) [TaxId: 96.45
d1bxoa_323 Acid protease {Fungus (Penicillium janthinellum), 96.27
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 95.74
d1oewa_330 Endothiapepsin {Chestnut blight fungus (Endothia p 95.64
d2pmaa1141 Uncharacterized protein LPG0085 {Legionella pneumo 95.57
d2bjua1329 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 95.34
d1wkra_340 Acid protease {Irpex lacteus (Polyporus tulipifera 94.91
d3cmsa_323 Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId 94.77
d1miqa_373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 94.7
d2apra_325 Acid protease {Bread mold (Rhizopus chinensis) [Ta 94.34
d1am5a_324 Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 94.15
d1eaga_342 Acid protease {Yeast (Candida albicans) [TaxId: 54 94.03
d1hrna_337 Chymosin (synonym: renin) {Human (Homo sapiens) [T 94.01
d1dpja_329 Acid protease {Baker's yeast (Saccharomyces cerevi 93.91
d1j71a_334 Acid protease {Yeast (Candida tropicalis) [TaxId: 93.78
d3psga_370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 93.5
d1smra_335 Chymosin (synonym: renin) {Mouse (Mus musculus) [T 93.28
g1htr.1372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 92.79
d1t6ex_381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 92.11
d1qdma2337 Plant acid proteinase, phytepsin {Barley (Hordeum 91.11
d1mppa_357 Pepsin {Mucor pusillus [TaxId: 4840]} 88.83
d2qp8a1387 beta-secretase (memapsin) {Human (Homo sapiens) [T 87.15
g1lya.1338 Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} 86.75
g1b5f.1326 Plant acid proteinase, phytepsin {Cynara carduncul 86.36
>d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} Back     information, alignment and structure
class: All beta proteins
fold: Acid proteases
superfamily: Acid proteases
family: Retroviral protease (retropepsin)
domain: EIAV protease
species: Equine infectious anemia virus [TaxId: 11665]

Probab=98.83  E-value=1.4e-08  Score=72.13  Aligned_cols=93  Identities=16%  Similarity=0.237  Sum_probs=67.9

Q ss_pred             eEEEEEeeCCeeEEEEEcCCCccccccHHHHHHhCCccCCCceeEEEEcCCceeccCCceeceeEeecceeEEEEEEEee
Q 039109           92 TMRLQSSISKASLTILIDSGSTHNFLHHKFAKITGLKSEPGCLLSVVVANGEKLTSPGRCKGVQLQLQGTQIEAYFYLLS  171 (233)
Q Consensus        92 t~~v~~~i~~~~~~~LiDSGAt~nfIs~~~a~~l~l~~~~~~~~~v~~a~G~~~~~~~~~~~~~~~i~g~~~~~~~~Vl~  171 (233)
                      .-.+..+|+|+++.+|+||||.++.|+..-............+..+ .+.|.....  ....+.+.+.|+.....+.|.|
T Consensus         8 RP~~~i~I~Gq~v~~LLDTGAD~TVI~~~~~p~~~~~~~~~~~~~i-gg~g~~~~~--~~~~v~i~~~g~~~~~~~lV~p   84 (104)
T d2fmba_           8 RPTTIVLINDTPLNVLLDTGADTSVLTTAHYNRLKYRGRKYQGTGI-GGVGGNVET--FSTPVTIKKKGRHIKTRMLVAD   84 (104)
T ss_dssp             CCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHCSSCCCCEECCCE-EETTEEECC--EEEEEEEEETTEEEEEEEEEES
T ss_pred             CeEEEEEECCEEEEEEEeCCCCeEEEcccccCccCCCCCCcceeEE-EEecceEEE--EEEEEEEEECCeEEEEEEEECC
Confidence            4456788999999999999999999999888765433323333333 344444433  2346888999999988888888


Q ss_pred             cCCCccccchhHHhhhCC
Q 039109          172 LEGCDAVLGAQWLCTLGS  189 (233)
Q Consensus       172 l~~~d~ILG~dwL~~~~~  189 (233)
                      . ..+ |||.|.|++.|.
T Consensus        85 ~-Pvn-LlGRdlL~qlG~  100 (104)
T d2fmba_          85 I-PVT-ILGRDILQDLGA  100 (104)
T ss_dssp             C-SSC-EECHHHHHHHTC
T ss_pred             C-Ccc-eecHHHHHHhCC
Confidence            3 233 999999999986
>d4fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]} Back     information, alignment and structure
>d1nsoa_ b.50.1.1 (A:) Mason-Pfizer monkey virus protease {Simian retrovirus 1, SRV-1 [TaxId: 11942]} Back     information, alignment and structure
>d2nmza1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d3ecga1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d2rspa_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C [TaxId: 11886]} Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Back     information, alignment and structure
>d2pmaa1 b.50.1.3 (A:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Back     information, alignment and structure
>d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Back     information, alignment and structure
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Back     information, alignment and structure
>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure