Citrus Sinensis ID: 039253
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 199 | ||||||
| 449440119 | 804 | PREDICTED: cell division cycle protein 4 | 0.969 | 0.240 | 0.645 | 1e-67 | |
| 255556938 | 805 | Transitional endoplasmic reticulum ATPas | 0.979 | 0.242 | 0.644 | 2e-67 | |
| 356505246 | 808 | PREDICTED: cell division cycle protein 4 | 0.984 | 0.242 | 0.633 | 9e-67 | |
| 255540583 | 804 | Transitional endoplasmic reticulum ATPas | 0.979 | 0.242 | 0.637 | 1e-66 | |
| 356572464 | 808 | PREDICTED: cell division cycle protein 4 | 0.969 | 0.238 | 0.64 | 3e-66 | |
| 242039557 | 810 | hypothetical protein SORBIDRAFT_01g02091 | 0.864 | 0.212 | 0.686 | 7e-66 | |
| 356518956 | 814 | PREDICTED: cell division cycle protein 4 | 0.959 | 0.234 | 0.65 | 8e-66 | |
| 224127332 | 776 | predicted protein [Populus trichocarpa] | 0.964 | 0.247 | 0.632 | 8e-66 | |
| 224133614 | 813 | predicted protein [Populus trichocarpa] | 0.964 | 0.236 | 0.651 | 9e-66 | |
| 226504612 | 359 | uncharacterized protein LOC100274218 [Ze | 0.864 | 0.479 | 0.686 | 1e-65 |
| >gi|449440119|ref|XP_004137832.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus] gi|449525650|ref|XP_004169829.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 261 bits (666), Expect = 1e-67, Method: Compositional matrix adjust.
Identities = 144/223 (64%), Positives = 167/223 (74%), Gaps = 30/223 (13%)
Query: 4 SIVIQRGSG---AGGAADRIPNQLLTEMDGLSAKKTIFVIGVTNRPDIIDPALLRPGRLD 60
SI QRGS AGGAADR+ NQLLTEMDG+SAKKT+F+IG TNRPDIIDPALLRPGRLD
Sbjct: 585 SIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGATNRPDIIDPALLRPGRLD 644
Query: 61 QLIYIPLPVEKSRLQIFKACLRKSPVSKDVDLEKLAQFTQGFSGADITEICQRACKDATR 120
QLIYIPLP E+SRLQIFKACLRKSP+SKDV+L LA++TQGFSGADITEICQRACK A R
Sbjct: 645 QLIYIPLPDEESRLQIFKACLRKSPISKDVELRALAKYTQGFSGADITEICQRACKYAIR 704
Query: 121 EEIENDI--RRRKGKQPEAIE----DEVAEIKAEHFEESMKYACKS-------------- 160
E IE DI RRK + PEA+E DEVAEI+A HFEESMKYA +S
Sbjct: 705 ENIEKDIEKERRKSENPEAMEEDADDEVAEIRAAHFEESMKYARRSVSDADIRKYQAFAQ 764
Query: 161 ---QSRGFGDEFGFCE-TAVAANNLIPVSSITDGNGEDDNVYD 199
QSRGFG EF F + +A AA++ S+ G G++D++Y+
Sbjct: 765 TLQQSRGFGAEFRFEQSSAPAASDPFATSA---GGGDEDDLYN 804
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255556938|ref|XP_002519502.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] gi|223541365|gb|EEF42916.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356505246|ref|XP_003521403.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255540583|ref|XP_002511356.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] gi|223550471|gb|EEF51958.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356572464|ref|XP_003554388.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|242039557|ref|XP_002467173.1| hypothetical protein SORBIDRAFT_01g020910 [Sorghum bicolor] gi|241921027|gb|EER94171.1| hypothetical protein SORBIDRAFT_01g020910 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|356518956|ref|XP_003528141.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224127332|ref|XP_002329251.1| predicted protein [Populus trichocarpa] gi|222870705|gb|EEF07836.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224133614|ref|XP_002321618.1| predicted protein [Populus trichocarpa] gi|222868614|gb|EEF05745.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|226504612|ref|NP_001142062.1| uncharacterized protein LOC100274218 [Zea mays] gi|194706964|gb|ACF87566.1| unknown [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 199 | ||||||
| TAIR|locus:2831844 | 810 | AtCDC48C "cell division cycle | 0.798 | 0.196 | 0.721 | 1.1e-60 | |
| TAIR|locus:2101933 | 815 | AtCDC48B "AT3G53230" [Arabidop | 0.798 | 0.195 | 0.724 | 6.6e-58 | |
| TAIR|locus:2085064 | 809 | CDC48 "cell division cycle 48" | 0.798 | 0.196 | 0.710 | 4.2e-56 | |
| FB|FBgn0261014 | 801 | TER94 "TER94" [Drosophila mela | 0.798 | 0.198 | 0.627 | 7.7e-52 | |
| ZFIN|ZDB-GENE-030131-5408 | 806 | vcp "valosin containing protei | 0.763 | 0.188 | 0.679 | 2.8e-51 | |
| UNIPROTKB|Q6GL04 | 805 | vcp "Transitional endoplasmic | 0.763 | 0.188 | 0.679 | 6e-51 | |
| UNIPROTKB|H9KYT1 | 538 | LOC430766 "Uncharacterized pro | 0.763 | 0.282 | 0.672 | 1.1e-50 | |
| UNIPROTKB|P23787 | 805 | vcp "Transitional endoplasmic | 0.763 | 0.188 | 0.672 | 1.3e-50 | |
| UNIPROTKB|G3X757 | 806 | VCP "Transitional endoplasmic | 0.763 | 0.188 | 0.679 | 1.3e-50 | |
| UNIPROTKB|Q3ZBT1 | 806 | VCP "Transitional endoplasmic | 0.763 | 0.188 | 0.679 | 1.3e-50 |
| TAIR|locus:2831844 AtCDC48C "cell division cycle 48C" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 586 (211.3 bits), Expect = 1.1e-60, Sum P(2) = 1.1e-60
Identities = 122/169 (72%), Positives = 138/169 (81%)
Query: 4 SIVIQRGSGAG---GAADRIPNQLLTEMDGLSAKKTIFVIGVTNRPDIIDPALLRPGRLD 60
SI QRG+ AG GAADR+ NQLLTEMDG++AKKT+F+IG TNRPDIID ALLRPGRLD
Sbjct: 584 SIATQRGNSAGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDSALLRPGRLD 643
Query: 61 QLIYIPLPVEKSRLQIFKACLRKSPVSKDVDLEKLAQFTQGFSGADITEICQRACKDATR 120
QLIYIPLP E SRL IFKACLRKSPV+KDVD+ LA++TQGFSGADITEICQRACK A R
Sbjct: 644 QLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIR 703
Query: 121 EEIENDIR--RRKGKQPEAIE-----DEVAEIKAEHFEESMKYACKSQS 162
E IE DI RR+ + PEA+E DEV+EI+A HFEESMKYA +S S
Sbjct: 704 ENIEKDIENERRRSQNPEAMEEDMVDDEVSEIRAAHFEESMKYARRSVS 752
|
|
| TAIR|locus:2101933 AtCDC48B "AT3G53230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085064 CDC48 "cell division cycle 48" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0261014 TER94 "TER94" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5408 vcp "valosin containing protein" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6GL04 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9KYT1 LOC430766 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P23787 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X757 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBT1 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 199 | |||
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 2e-41 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 4e-40 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 3e-36 | |
| COG1222 | 406 | COG1222, RPT1, ATP-dependent 26S proteasome regula | 7e-35 | |
| TIGR01242 | 364 | TIGR01242, 26Sp45, 26S proteasome subunit P45 fami | 4e-33 | |
| TIGR01241 | 495 | TIGR01241, FtsH_fam, ATP-dependent metalloprotease | 1e-32 | |
| COG0465 | 596 | COG0465, HflB, ATP-dependent Zn proteases [Posttra | 1e-31 | |
| CHL00176 | 638 | CHL00176, ftsH, cell division protein; Validated | 4e-29 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 1e-27 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 5e-27 | |
| PTZ00454 | 398 | PTZ00454, PTZ00454, 26S protease regulatory subuni | 1e-25 | |
| PTZ00361 | 438 | PTZ00361, PTZ00361, 26 proteosome regulatory subun | 1e-19 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 5e-19 | |
| COG1223 | 368 | COG1223, COG1223, Predicted ATPase (AAA+ superfami | 7e-16 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 1e-15 | |
| TIGR03689 | 512 | TIGR03689, pup_AAA, proteasome ATPase | 2e-12 | |
| CHL00195 | 489 | CHL00195, ycf46, Ycf46; Provisional | 8e-12 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 8e-04 |
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
Score = 148 bits (374), Expect = 2e-41
Identities = 70/161 (43%), Positives = 102/161 (63%), Gaps = 2/161 (1%)
Query: 4 SIVIQRGSGAGGA-ADRIPNQLLTEMDGLSAKKTIFVIGVTNRPDIIDPALLRPGRLDQL 62
+I RG+ + DRI NQLLTEMDG+ + VI TNRPDI+DPALLRPGR D+L
Sbjct: 557 AIAPARGARFDTSVTDRIVNQLLTEMDGIQELSNVVVIAATNRPDILDPALLRPGRFDRL 616
Query: 63 IYIPLPVEKSRLQIFKACLRKSPVSKDVDLEKLAQFTQGFSGADITEICQRACKDATREE 122
I +P P E++R +IFK R P+++DVDLE+LA+ T+G++GADI +C+ A A RE
Sbjct: 617 ILVPPPDEEARKEIFKIHTRSMPLAEDVDLEELAEMTEGYTGADIEAVCREAAMAALRES 676
Query: 123 IENDIRRRKGKQPEAIEDEVAEIKAEHFEESMKYACKSQSR 163
I + + + E ++ +++ HF E++K S S+
Sbjct: 677 IGSPAKEKLEVGEEEFLKDL-KVEMRHFLEALKKVKPSVSK 716
|
This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733 |
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 199 | |||
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 99.97 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 99.97 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 99.97 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 99.96 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 99.95 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 99.95 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.93 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 99.93 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 99.92 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 99.92 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.92 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 99.92 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.92 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 99.91 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 99.91 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.91 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 99.91 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.91 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.9 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 99.9 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.9 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 99.9 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.89 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.88 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 99.88 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.87 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 99.86 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.86 | |
| KOG0740 | 428 | consensus AAA+-type ATPase [Posttranslational modi | 99.86 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.85 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 99.84 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.84 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.83 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.83 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 99.72 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.7 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.4 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 99.34 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 99.34 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 99.24 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 99.18 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 99.05 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 98.46 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.42 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 98.21 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.06 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 98.0 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.94 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 97.91 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.71 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.71 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.6 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 97.6 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.57 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.47 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.34 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.3 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.28 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 97.27 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.27 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.08 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.05 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.03 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.94 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.92 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 96.9 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 96.87 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.86 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 96.83 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.81 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 96.74 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 96.73 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.7 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.67 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.63 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 96.57 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 96.52 | |
| PRK06620 | 214 | hypothetical protein; Validated | 96.51 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 96.46 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.43 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 96.41 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 96.41 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.4 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 96.38 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 96.38 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.35 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.34 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 96.34 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.31 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 96.22 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 96.2 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.19 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 96.14 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 96.12 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 96.09 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 96.0 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 95.99 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 95.93 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 95.93 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 95.93 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 95.87 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 95.84 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 95.84 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 95.64 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 95.64 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 95.63 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 95.62 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 95.56 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 95.53 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 95.52 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 95.44 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 95.43 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 95.35 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 95.32 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 95.26 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 95.09 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 95.02 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 95.0 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 94.97 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 94.96 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 94.88 | |
| PF09336 | 62 | Vps4_C: Vps4 C terminal oligomerisation domain; In | 94.81 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 94.6 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 94.29 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 94.23 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 94.2 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 94.11 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 93.82 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 93.74 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 93.68 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 93.59 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 93.31 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 93.28 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 93.27 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 93.26 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 93.18 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 93.17 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 92.92 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 92.86 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 92.82 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 92.53 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 92.5 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 92.44 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 92.38 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 91.97 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 91.89 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 91.72 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 89.98 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 89.33 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 89.3 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 89.24 | |
| PRK06581 | 263 | DNA polymerase III subunit delta'; Validated | 88.94 | |
| PRK08485 | 206 | DNA polymerase III subunit delta'; Validated | 88.81 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 88.73 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 87.34 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 87.2 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 86.68 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 86.44 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 86.27 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 85.45 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 84.82 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 84.43 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 84.32 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 83.99 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 83.35 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 82.6 | |
| COG1067 | 647 | LonB Predicted ATP-dependent protease [Posttransla | 81.81 |
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.5e-33 Score=252.48 Aligned_cols=145 Identities=54% Similarity=0.847 Sum_probs=138.4
Q ss_pred cceeeccCCCCCchhhHHHHHHHHHHhCCCCCCCEEEEEeeCCCCCCCccccCCCccceEEEecCCCHHHHHHHHHHhhc
Q 039253 3 WSIVIQRGSGAGGAADRIPNQLLTEMDGLSAKKTIFVIGVTNRPDIIDPALLRPGRLDQLIYIPLPVEKSRLQIFKACLR 82 (199)
Q Consensus 3 ~sl~~~R~~~~~~~~~r~~~~lL~~ld~~~~~~~VvvI~aTN~~~~lD~al~R~gRfd~~i~~~~P~~~~R~~il~~~l~ 82 (199)
+|+++.|++..++.++|++++||++|||+....+|+||||||||+.||+|++||||||+.|+||+||.+.|.+||+.+++
T Consensus 537 Dsi~~~R~g~~~~v~~RVlsqLLtEmDG~e~~k~V~ViAATNRpd~ID~ALlRPGRlD~iiyVplPD~~aR~~Ilk~~~k 616 (693)
T KOG0730|consen 537 DALAGSRGGSSSGVTDRVLSQLLTEMDGLEALKNVLVIAATNRPDMIDPALLRPGRLDRIIYVPLPDLEARLEILKQCAK 616 (693)
T ss_pred HhHhhccCCCccchHHHHHHHHHHHcccccccCcEEEEeccCChhhcCHHHcCCcccceeEeecCccHHHHHHHHHHHHh
Confidence 57899999888899999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCcccHHHHHhhCCCCCHHHHHHHHHHHHHHHHHHHHHHhHHhhcCCCCcchhhccccccHHHHHHHHHhcccccc
Q 039253 83 KSPVSKDVDLEKLAQFTQGFSGADITEICQRACKDATREEIENDIRRRKGKQPEAIEDEVAEIKAEHFEESMKYACKSQS 162 (199)
Q Consensus 83 ~~~~~~~~~l~~la~~t~G~sgaDI~~lv~~A~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~it~~df~~Al~~~~Ps~~ 162 (199)
++++.+++|+..||+.|+|||||||..+|++|++.|+++.+.. ..|+.+||++|++.++||..
T Consensus 617 kmp~~~~vdl~~La~~T~g~SGAel~~lCq~A~~~a~~e~i~a-----------------~~i~~~hf~~al~~~r~s~~ 679 (693)
T KOG0730|consen 617 KMPFSEDVDLEELAQATEGYSGAEIVAVCQEAALLALRESIEA-----------------TEITWQHFEEALKAVRPSLT 679 (693)
T ss_pred cCCCCccccHHHHHHHhccCChHHHHHHHHHHHHHHHHHhccc-----------------ccccHHHHHHHHHhhcccCC
Confidence 9999999999999999999999999999999999999999753 56899999999999999987
Q ss_pred cc
Q 039253 163 RG 164 (199)
Q Consensus 163 r~ 164 (199)
..
T Consensus 680 ~~ 681 (693)
T KOG0730|consen 680 SE 681 (693)
T ss_pred HH
Confidence 53
|
|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF09336 Vps4_C: Vps4 C terminal oligomerisation domain; InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06581 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08485 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 199 | ||||
| 1r7r_A | 816 | The Crystal Structure Of Murine P97VCP AT 3.6A Leng | 1e-48 | ||
| 3cf1_A | 806 | Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len | 1e-48 | ||
| 3cf0_A | 301 | Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH | 6e-48 | ||
| 3h4m_A | 285 | Aaa Atpase Domain Of The Proteasome- Activating Nuc | 1e-24 | ||
| 2x8a_A | 274 | Human Nuclear Valosin Containing Protein Like (Nvl) | 4e-24 | ||
| 1lv7_A | 257 | Crystal Structure Of The Aaa Domain Of Ftsh Length | 4e-24 | ||
| 2ce7_A | 476 | Edta Treated Length = 476 | 6e-23 | ||
| 3kds_E | 465 | Apo-ftsh Crystal Structure Length = 465 | 7e-23 | ||
| 2dhr_A | 499 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 6e-22 | ||
| 4eiw_A | 508 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 7e-22 | ||
| 1iy2_A | 278 | Crystal Structure Of The Ftsh Atpase Domain From Th | 1e-21 | ||
| 1ixz_A | 254 | Crystal Structure Of The Ftsh Atpase Domain From Th | 1e-21 | ||
| 2qz4_A | 262 | Human Paraplegin, Aaa Domain In Complex With Adp Le | 3e-20 | ||
| 2r62_A | 268 | Crystal Structure Of Helicobacter Pylori Atp Depend | 2e-18 | ||
| 3hu3_A | 489 | Structure Of P97 N-D1 R155h Mutant In Complex With | 3e-18 | ||
| 3hu2_A | 489 | Structure Of P97 N-D1 R86a Mutant In Complex With A | 3e-18 | ||
| 3hu1_A | 489 | Structure Of P97 N-D1 R95g Mutant In Complex With A | 3e-18 | ||
| 1e32_A | 458 | Structure Of The N-Terminal Domain And The D1 Aaa D | 3e-18 | ||
| 4b4t_J | 405 | Near-Atomic Resolution Structural Model Of The Yeas | 6e-18 | ||
| 4b4t_L | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 6e-18 | ||
| 4b4t_M | 434 | Near-Atomic Resolution Structural Model Of The Yeas | 6e-16 | ||
| 4b4t_K | 428 | Near-Atomic Resolution Structural Model Of The Yeas | 3e-13 | ||
| 4b4t_H | 467 | Near-Atomic Resolution Structural Model Of The Yeas | 4e-13 | ||
| 3d8b_A | 357 | Crystal Structure Of Human Fidgetin-Like Protein 1 | 4e-13 | ||
| 3vfd_A | 389 | Human Spastin Aaa Domain Length = 389 | 2e-12 | ||
| 4b4t_I | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 1e-11 | ||
| 2zam_A | 444 | Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt | 6e-11 | ||
| 2qp9_X | 355 | Crystal Structure Of S.Cerevisiae Vps4 Length = 355 | 9e-11 | ||
| 1xwi_A | 322 | Crystal Structure Of Vps4b Length = 322 | 1e-10 | ||
| 3eih_A | 340 | Crystal Structure Of S.Cerevisiae Vps4 In The Prese | 1e-10 | ||
| 2rko_A | 331 | Crystal Structure Of The Vps4p-Dimer Length = 331 | 1e-10 | ||
| 3eie_A | 322 | Crystal Structure Of S.Cerevisiae Vps4 In The So4-B | 1e-10 | ||
| 3b9p_A | 297 | Spastin Length = 297 | 3e-10 | ||
| 3kw6_A | 78 | Crystal Structure Of A Domain Of 26s Proteasome Reg | 1e-04 | ||
| 2krk_A | 86 | Solution Nmr Structure Of 26s Protease Regulatory S | 3e-04 |
| >pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 | Back alignment and structure |
|
| >pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 | Back alignment and structure |
| >pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 | Back alignment and structure |
| >pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 | Back alignment and structure |
| >pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 | Back alignment and structure |
| >pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 | Back alignment and structure |
| >pdb|2CE7|A Chain A, Edta Treated Length = 476 | Back alignment and structure |
| >pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 | Back alignment and structure |
| >pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 | Back alignment and structure |
| >pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 | Back alignment and structure |
| >pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 | Back alignment and structure |
| >pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 | Back alignment and structure |
| >pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 | Back alignment and structure |
| >pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 | Back alignment and structure |
| >pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 | Back alignment and structure |
| >pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 | Back alignment and structure |
| >pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 | Back alignment and structure |
| >pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 | Back alignment and structure |
| >pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 | Back alignment and structure |
| >pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 | Back alignment and structure |
| >pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 | Back alignment and structure |
| >pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 | Back alignment and structure |
| >pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 | Back alignment and structure |
| >pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 | Back alignment and structure |
| >pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 | Back alignment and structure |
| >pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 | Back alignment and structure |
| >pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 | Back alignment and structure |
| >pdb|3B9P|A Chain A, Spastin Length = 297 | Back alignment and structure |
| >pdb|3KW6|A Chain A, Crystal Structure Of A Domain Of 26s Proteasome Regulatory Subunit 8 From Homo Sapiens. Northeast Structural Genomics Consortium Target Id Hr3102a Length = 78 | Back alignment and structure |
| >pdb|2KRK|A Chain A, Solution Nmr Structure Of 26s Protease Regulatory Subunit 8 From H.Sapiens, Northeast Structural Genomics Consortium Target Target Hr3102a Length = 86 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 199 | |||
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 2e-71 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 5e-70 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 3e-65 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 1e-37 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 3e-52 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 2e-50 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 4e-50 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 3e-46 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 1e-44 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 4e-42 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 6e-42 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 9e-42 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 1e-40 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 1e-35 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 2e-35 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 2e-35 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 3e-35 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 1e-34 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 3e-34 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 5e-34 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 6e-33 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 2e-15 | |
| 2krk_A | 86 | 26S protease regulatory subunit 8; structural geno | 3e-15 | |
| 3aji_B | 83 | S6C, proteasome (prosome, macropain) 26S subunit, | 3e-13 | |
| 3kw6_A | 78 | 26S protease regulatory subunit 8; structural geno | 3e-13 | |
| 2dzn_B | 82 | 26S protease regulatory subunit 6B homolog; ankyri | 1e-12 | |
| 3vlf_B | 88 | 26S protease regulatory subunit 7 homolog; heat re | 1e-10 |
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 | Back alignment and structure |
|---|
Score = 217 bits (556), Expect = 2e-71
Identities = 107/168 (63%), Positives = 128/168 (76%), Gaps = 9/168 (5%)
Query: 4 SIVIQRGSGAG---GAADRIPNQLLTEMDGLSAKKTIFVIGVTNRPDIIDPALLRPGRLD 60
SI RG G GAADR+ NQ+LTEMDG+S KK +F+IG TNRPDIIDPA+LRPGRLD
Sbjct: 119 SIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLD 178
Query: 61 QLIYIPLPVEKSRLQIFKACLRKSPVSKDVDLEKLAQFTQGFSGADITEICQRACKDATR 120
QLIYIPLP EKSR+ I KA LRKSPV+KDVDLE LA+ T GFSGAD+TEICQRACK A R
Sbjct: 179 QLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIR 238
Query: 121 EEIENDIRRRKGKQP------EAIEDEVAEIKAEHFEESMKYACKSQS 162
E IE++IRR + +Q +D V EI+ +HFEE+M++A +S S
Sbjct: 239 ESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVS 286
|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 | Back alignment and structure |
|---|
| >2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 | Back alignment and structure |
|---|
| >3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 | Back alignment and structure |
|---|
| >3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 199 | |||
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.97 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.97 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.97 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.97 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.97 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.96 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.96 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.94 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.93 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.89 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.89 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.87 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.87 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.86 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.86 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.85 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.83 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.83 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.83 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.81 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.78 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.78 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.77 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.76 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.74 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.7 | |
| 2krk_A | 86 | 26S protease regulatory subunit 8; structural geno | 99.69 | |
| 3kw6_A | 78 | 26S protease regulatory subunit 8; structural geno | 99.68 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.68 | |
| 3aji_B | 83 | S6C, proteasome (prosome, macropain) 26S subunit, | 99.65 | |
| 3vlf_B | 88 | 26S protease regulatory subunit 7 homolog; heat re | 99.64 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.6 | |
| 2dzn_B | 82 | 26S protease regulatory subunit 6B homolog; ankyri | 99.51 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.35 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 98.76 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 98.7 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 98.58 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 98.57 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 98.5 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 98.33 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 98.31 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 98.31 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 98.31 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.19 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 98.19 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 98.17 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 98.13 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 98.13 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 98.09 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 98.07 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.87 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.86 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.78 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 97.77 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 97.71 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.71 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 97.7 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.68 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 97.66 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.62 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 97.6 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 97.52 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 97.52 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.45 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.42 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.38 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 97.38 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.28 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.28 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.22 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.19 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.1 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 96.75 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.73 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.6 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.49 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.42 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 96.37 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 96.13 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 96.1 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 95.89 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.86 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 95.65 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.39 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 95.27 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 94.66 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 93.69 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 92.98 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 91.81 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 91.15 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 85.82 |
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.97 E-value=1.1e-31 Score=236.75 Aligned_cols=143 Identities=36% Similarity=0.549 Sum_probs=130.3
Q ss_pred cceeeccCCCCCc---hhhHHHHHHHHHHhCCCCCCCEEEEEeeCCCCCCCccccCCCccceEEEecCCCHHHHHHHHHH
Q 039253 3 WSIVIQRGSGAGG---AADRIPNQLLTEMDGLSAKKTIFVIGVTNRPDIIDPALLRPGRLDQLIYIPLPVEKSRLQIFKA 79 (199)
Q Consensus 3 ~sl~~~R~~~~~~---~~~r~~~~lL~~ld~~~~~~~VvvI~aTN~~~~lD~al~R~gRfd~~i~~~~P~~~~R~~il~~ 79 (199)
++++++|+.+.++ ...+++++||++||++....+|+||+|||+|+.||||++||||||++|+|++|+.++|.+||+.
T Consensus 251 Dai~~~R~~~~~~~~~~~~~~l~~lL~~lDg~~~~~~V~vIaATNrpd~LDpAllRpGRfD~~I~i~lPd~~~R~~Il~~ 330 (405)
T 4b4t_J 251 DSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRI 330 (405)
T ss_dssp SCCTTSCSCSSSGGGGHHHHHHHHHHHHHHTTTCCCCEEEEEEESCSSSSCHHHHSTTSSCCEEECCCCCHHHHHHHHHH
T ss_pred hhhccCCCCCCCCCcHHHHHHHHHHHHhhhccCCCCCeEEEeccCChhhCCHhHcCCCcCceEEEcCCcCHHHHHHHHHH
Confidence 4788888765433 4568999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhcCCCCCCcccHHHHHhhCCCCCHHHHHHHHHHHHHHHHHHHHHHhHHhhcCCCCcchhhccccccHHHHHHHHHhccc
Q 039253 80 CLRKSPVSKDVDLEKLAQFTQGFSGADITEICQRACKDATREEIENDIRRRKGKQPEAIEDEVAEIKAEHFEESMKYACK 159 (199)
Q Consensus 80 ~l~~~~~~~~~~l~~la~~t~G~sgaDI~~lv~~A~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~it~~df~~Al~~~~P 159 (199)
+++++++..++++..||+.|+|||||||+++|++|++.|+++.. ..|+++||..|++++.|
T Consensus 331 ~~~~~~l~~dvdl~~lA~~t~G~SGADi~~l~~eA~~~Air~~~-------------------~~vt~~Df~~Al~~v~~ 391 (405)
T 4b4t_J 331 HSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERR-------------------IHVTQEDFELAVGKVMN 391 (405)
T ss_dssp HHTTSBCCSSCCHHHHHHHCCSCCHHHHHHHHHHHHHHHHHTTC-------------------SBCCHHHHHHHHHHHHH
T ss_pred HhcCCCCCccCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHcCC-------------------CCcCHHHHHHHHHHHhC
Confidence 99999998899999999999999999999999999999988642 56999999999999988
Q ss_pred ccccc
Q 039253 160 SQSRG 164 (199)
Q Consensus 160 s~~r~ 164 (199)
+..+.
T Consensus 392 ~~~~~ 396 (405)
T 4b4t_J 392 KNQET 396 (405)
T ss_dssp HHTCC
T ss_pred ccccc
Confidence 76653
|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* | Back alignment and structure |
|---|
| >3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* | Back alignment and structure |
|---|
| >2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 199 | ||||
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 3e-43 | |
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 3e-42 | |
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 5e-39 | |
| d1e32a2 | 258 | c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p | 6e-21 | |
| d1w44a_ | 321 | c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta | 1e-16 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 6e-13 | |
| d1d2na_ | 246 | c.37.1.20 (A:) Hexamerization domain of N-ethylmal | 1e-10 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 1e-10 |
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Thermus thermophilus [TaxId: 274]
Score = 143 bits (361), Expect = 3e-43
Identities = 57/124 (45%), Positives = 72/124 (58%), Gaps = 3/124 (2%)
Query: 4 SIVIQRGSGAGG---AADRIPNQLLTEMDGLSAKKTIFVIGVTNRPDIIDPALLRPGRLD 60
++ +RGSG GG ++ NQLL EMDG I V+ TNRPDI+DPALLRPGR D
Sbjct: 112 AVGRKRGSGVGGGNDEREQTLNQLLVEMDGFEKDTAIVVMAATNRPDILDPALLRPGRFD 171
Query: 61 QLIYIPLPVEKSRLQIFKACLRKSPVSKDVDLEKLAQFTQGFSGADITEICQRACKDATR 120
+ I I P K R QI + R P+++DVDL LA+ T GF GAD+ + A A R
Sbjct: 172 RQIAIDAPDVKGREQILRIHARGKPLAEDVDLALLAKRTPGFVGADLENLLNEAALLAAR 231
Query: 121 EEIE 124
E
Sbjct: 232 EGRR 235
|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 199 | |||
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.95 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.95 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.94 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.91 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.1 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.7 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.51 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 98.06 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.01 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.98 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.79 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.73 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.7 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.61 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.46 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.44 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.4 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.24 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.87 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.34 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 95.38 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 94.95 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 92.27 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 89.66 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 88.15 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 84.16 |
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: Membrane fusion ATPase VCP/p97 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.95 E-value=4.2e-28 Score=200.39 Aligned_cols=152 Identities=32% Similarity=0.480 Sum_probs=130.0
Q ss_pred cceeeccCCCCCchhhHHHHHHHHHHhCCCCCCCEEEEEeeCCCCCCCccccCCCccceEEEecCCCHHHHHHHHHHhhc
Q 039253 3 WSIVIQRGSGAGGAADRIPNQLLTEMDGLSAKKTIFVIGVTNRPDIIDPALLRPGRLDQLIYIPLPVEKSRLQIFKACLR 82 (199)
Q Consensus 3 ~sl~~~R~~~~~~~~~r~~~~lL~~ld~~~~~~~VvvI~aTN~~~~lD~al~R~gRfd~~i~~~~P~~~~R~~il~~~l~ 82 (199)
++++++|+++.++...++++.++..+++.....+|+||+|||+|+.||+|++||||||++|+|++|+.++|.+||+.+++
T Consensus 107 d~l~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~vlvi~tTn~~~~ld~al~r~gRfd~~i~~~~P~~~~R~~il~~~l~ 186 (258)
T d1e32a2 107 DAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTK 186 (258)
T ss_dssp GGTCCHHHHCCCTTHHHHHHHHHHHHHTCCCSSCEEEEEEESCGGGSCGGGTSTTSSCEEEECCCCCHHHHHHHHHHTTT
T ss_pred hhhccCCCCCCCchHHHHHHHhccccccccccCCccEEEeCCCccccchhhhhcccccceeECCCCCHHHHHHHhhhhcc
Confidence 35778888888888889999999999999998999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCcccHHHHHhhCCCCCHHHHHHHHHHHHHHHHHHHHHHhHHhhcCCCCcchhhccccccHHHHHHHHHh
Q 039253 83 KSPVSKDVDLEKLAQFTQGFSGADITEICQRACKDATREEIENDIRRRKGKQPEAIEDEVAEIKAEHFEESMKY 156 (199)
Q Consensus 83 ~~~~~~~~~l~~la~~t~G~sgaDI~~lv~~A~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~it~~df~~Al~~ 156 (199)
+.++..++++..||++|+||||+||+++|++|++.|+++....... ..+..........++|++||..||++
T Consensus 187 ~~~~~~~~~~~~la~~t~G~s~adl~~lv~~A~~~a~~~~~~~~~~--~~~~~~~~~~~~~~it~~Df~~AL~~ 258 (258)
T d1e32a2 187 NMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDL--EDETIDAEVMNSLAVTMDDFRWALSQ 258 (258)
T ss_dssp TSCBCTTCCHHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHHHHCC--CSSCCBHHHHHHCCBCHHHHHHHHTC
T ss_pred CcccccccchhhhhhcccCCCHHHHHHHHHHHHHHHHHhhccccch--hhhhhhhhhhccCccCHHHHHHHhCc
Confidence 9988888999999999999999999999999999999887533110 01111112233467999999999863
|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|