Citrus Sinensis ID: 039269

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
GDKPTEDTAKSKTLPGGEAELLHEPEYLRLDGHVRRLSTESVGSDLSSIRASEKSNFGVSNLFGDGSVNHPEGGETSRSMDAHISSDALFPRNSLLALPSDQRLKLNRVLNNMQQRLTAAKADTEDLLARLNQEVAVRQFLTTKVKDLEVELETTSENCKENMQQAVLNEKERFTQMQWDMEELRKQLLETELKLKYEQDERARAESSKMSIIQENEMLLQELEVVREQLENLHKQHEESEVKSKTDVKLLVKEVKSLRSSQSEVKQELSRLMKEKLEVEGVLQKEKQRMEHADIANLKLLHECEILRNRLQECSVNFLSEEEDKLTVDTSSPSDAVDLLTTSDNRIGLLVAETQLLAQDIERSMTGLDKTCNANGSDRRSDDELRQMLTDIFIDNARLRMQVNTVIRCALNTYVKSDNDDGKEETPLRKTVLSRFLDR
ccccccccccccccccccccccccccccccccccccccHHccccccHHHHHHcccccccccccccccccccccccccHHHHccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcc
cccccccccHHHHccccccEccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccHHccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccEEEccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcc
gdkptedtaksktlpggeaellhepeylrldghvrrlstesvgsdlssiraseksnfgvsnlfgdgsvnhpeggetsrsmdahissdalfprnsllalpsdqrlKLNRVLNNMQQRLTAAKADTEDLLARLNQEVAVRQFLTTKVKDLEVELETTSENCKENMQQAVLNEKERFTQMQWDMEELRKQLLETELKLKYEQDERARAESSKMSIIQENEMLLQELEVVREQLENLHKQHeesevkskTDVKLLVKEVKSLRSSQSEVKQELSRLMKEKLEVEGVLQKEKQRMEHADIANLKLLHECEILRNRLQECSVNFLseeedkltvdtsspsdavdllttsDNRIGLLVAETQLLAQDIERSMTgldktcnangsdrrsdDELRQMLTDIFIDNARLRMQVNTVIRCALNTyvksdnddgkeetplRKTVLSRFLDR
gdkptedtaksktlpggeaellhEPEYLRLDGHVRRLSTESVGSDLSSIRASEKSNFGVSNLFGDGSVNHPEGGETSRSMDAHISSDALFPRNSLLALPSDQRLKLNRVLNNMQQRLTAAKADTEDLLARLNQEVAVRQFLTTKVKDLEVELEttsenckenmQQAVLNEKERFTQMQWDMEELRKQLLETELKLKYEQDeraraesskmsiIQENEMLLQELEVVREQLENLHkqheesevksktdvkLLVKEvkslrssqsevkqELSRLMKEKLEVEGVLQKEKQRMEHADIANLKLLHECEILRNRLQECSVNFLSEEedkltvdtsspsdavDLLTTSDNRIGLLVAETQLLAQDIERsmtgldktcnangsdrrsddeLRQMLTDIfidnarlrmQVNTVIRCALNtyvksdnddgkeetplrktvlsrfldr
GDKPTEDTAKSKTLPGGEAELLHEPEYLRLDGHVRRLSTESVGSDLSSIRASEKSNFGVSNLFGDGSVNHPEGGETSRSMDAHISSDALFPRNSLLALPSDQRLKLNRVLNNMQQRLTAAKADTEDLLARLNQEVAVRQFLTTKVKDLEVELETTSENCKENMQQAVLNEKERFTQMQWDMEELRKQLLETELKLKYEQDERARAESSKMSIIQENemllqelevvreqlenlHKQHEESEVKSKTDVKLLVKEVKSLRSSQSEVKQELSRLMKEKLEVEGVLQKEKQRMEHADIANLKLLHECEILRNRLQECSVNFLSEEEDKLTVDTSSPSDAVDLLTTSDNRIGLLVAETQLLAQDIERSMTGLDKTCNANGSDRRSDDELRQMLTDIFIDNARLRMQVNTVIRCALNTYVKSDNDDGKEETPLRKTVLSRFLDR
***********************************************************************************************************RVL************DTEDLLARLNQEVAVRQFLTTKVKDLEVEL********************************************************************************************************************************************ADIANLKLLHECEILRNRLQECSVNFL******************DLLTTSDNRIGLLVAETQLLAQDI*************************QMLTDIFIDNARLRMQVNTVIRCALNTYV************************
*******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************IFI**************************************LSRF***
*************LPGGEAELLHEPEYLRLDGHVRRLS************ASEKSNFGVSNLFGDGSVNHPEGGETSRSMDAHISSDALFPRNSLLALPSDQRLKLNRVLNNMQQRLTAAKADTEDLLARLNQEVAVRQFLTTKVKDLEVELETTSENCKENMQQAVLNEKERFTQMQWDMEELRKQLLETELKLKYEQDERARAESSKMSIIQENEMLLQELEVVREQLENL*************DVKLLVKEVKS************SRLMKEKLEVEGVLQKEKQRMEHADIANLKLLHECEILRNRLQECSVNFLSE************SDAVDLLTTSDNRIGLLVAETQLLAQDIERSMTGLDKTCN*********DELRQMLTDIFIDNARLRMQVNTVIRCALNTYVKS*********PLRKTVLSRFLDR
******************AELLH*PEYLR***************************************************DAHISSDALFPRNSLLALPSDQRLKLNRVLNNMQQRLTAAKADTEDLLARLNQEVAVRQFLTTKVKDLEVELETTSENCKENMQQAVLNEKERFTQMQWDMEELRKQLLETELKLKYEQDERARAESSKMSIIQENEMLLQELEVVREQLENLHKQHEESEVKSKTDVKLLVKEVKSLRSSQSEVKQELSRLMKEKLEVEGVLQKEKQRMEHADIANLKLLHECEILRNRLQECSVNFLSEEEDKLTVDTSSPSDAVDLLTTSDNRIGLLVAETQLLAQDIERSMTGLDKTCNANGSDRRSDDELRQMLTDIFIDNARLRMQVNTVIRCALNTYV*********ETPLRKTVLSRFLDR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GDKPTEDTAKSKTLPGGEAELLHEPEYLRLDGHVRRLSTESVGSDLSSIRASEKSNFGVSNLFGDGSVNHPEGGETSRSMDAHISSDALFPRNSLLALPSDQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVAVxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVLNEKERFTQMQWDxxxxxxxxxxxxxxxxxxxxxRARAESSKMSIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSKTDVKLLVKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMEHADIANLKLLHECEILRNRLQECSVNFLSEEEDKLTVDTSSPSDAVDLLTTSDNRIGLLVAETQLLAQDIERSMTGLDKTCNANGSDRRSDDELRQMLTDIFIDNARLRMQVNTVIRCALNTYVKSDNDDGKEETPLRKTVLSRFLDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query439
255553243 789 conserved hypothetical protein [Ricinus 0.997 0.555 0.724 1e-167
224128610 748 predicted protein [Populus trichocarpa] 0.963 0.565 0.673 1e-151
225442908 762 PREDICTED: uncharacterized protein LOC10 0.997 0.574 0.662 1e-147
297743483 690 unnamed protein product [Vitis vinifera] 0.929 0.591 0.691 1e-146
356547442 727 PREDICTED: uncharacterized protein LOC10 0.899 0.543 0.613 1e-119
357455287 704 hypothetical protein MTR_2g104070 [Medic 0.874 0.545 0.597 1e-117
359475826 717 PREDICTED: uncharacterized protein LOC10 0.943 0.577 0.550 1e-115
296082054 628 unnamed protein product [Vitis vinifera] 0.890 0.622 0.519 1e-104
51969890 755 hypothetical protein [Arabidopsis thalia 0.911 0.529 0.497 1e-102
15233233 755 Phox (PX) domain-containing protein [Ara 0.911 0.529 0.497 1e-102
>gi|255553243|ref|XP_002517664.1| conserved hypothetical protein [Ricinus communis] gi|223543296|gb|EEF44828.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  595 bits (1533), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 318/439 (72%), Positives = 369/439 (84%), Gaps = 1/439 (0%)

Query: 1   GDKPTEDTAKSKTLPGGEAELLHEPEYLRLDGHVRRLSTESVGSDLSSIRASEKSNFGVS 60
           GDK +E  +  K+  G   E L   EY RLDGH+RR+ST+S GSDLSSI+ASE SN GV 
Sbjct: 352 GDKLSESRSGGKSFLGDADEPLPRVEYQRLDGHIRRVSTDSTGSDLSSIKASEISNLGVG 411

Query: 61  NLFGDGSVNHPEGGETSRSMDAHISSDALFPRNSLLALPSDQRLKLNRVLNNMQQRLTAA 120
           NLFGD S++ PEG ETS+ +DA ++S+  FPR+ L+  PS++R KLNRVLN +QQRL  A
Sbjct: 412 NLFGDDSLDLPEGSETSKVIDALVNSNLQFPRDLLVVFPSEERHKLNRVLNTVQQRLVTA 471

Query: 121 KADTEDLLARLNQEVAVRQFLTTKVKDLEVELETTSENCKENMQQAVLNEKERFTQMQWD 180
           K D EDL+ARLNQEVAVRQFL TKVKDLEV+LETT  +CKENMQQAVL E+ERFTQMQWD
Sbjct: 472 KTDMEDLIARLNQEVAVRQFLATKVKDLEVDLETTRNSCKENMQQAVLLERERFTQMQWD 531

Query: 181 MEELRKQLLETELKLKYEQDERARAESSKMSIIQENEMLLQELEVVREQLENLHKQHEES 240
           +EELRKQ LE ELKLK EQDERA  ES+K SI QENEMLLQ+L+V RE LENLHK HEE 
Sbjct: 532 VEELRKQCLEMELKLKSEQDERAHVESAKASITQENEMLLQQLDVAREDLENLHKHHEEL 591

Query: 241 EVKSKTDVKLLVKEVKSLRSSQSEVKQELSRLMKEKLEVEGVLQKEKQRMEHADIANLKL 300
           E+KSK DVKLLVKEVKSLR+SQS++KQELSRLMKEKLEVE VLQKEKQR +    AN KL
Sbjct: 592 ELKSKADVKLLVKEVKSLRTSQSDLKQELSRLMKEKLEVERVLQKEKQRTQTVTTANTKL 651

Query: 301 LHECEILRNRLQECSVNFLSEEEDKLTVDTSSPSDAVDLLTTSDNRIGLLVAETQLLAQD 360
           LHECEILRNRLQECSVNFL EEED+L VDTSSPSDA+DLLTTSDNRIGLL+AE QLLAQD
Sbjct: 652 LHECEILRNRLQECSVNFLIEEEDRLIVDTSSPSDAIDLLTTSDNRIGLLLAEAQLLAQD 711

Query: 361 IERSMTGLDKTCNANGSDRRSDDELRQMLTDIFIDNARLRMQVNTVIRCALNTYVKSDND 420
           +E S+ GLD+T N  GSD +SDDELR++LT++F+DNARLRMQ+N+VIRCALNT+VKSD +
Sbjct: 712 VENSVAGLDETFNMIGSD-KSDDELRKLLTEVFVDNARLRMQINSVIRCALNTHVKSDKE 770

Query: 421 DGKEETPLRKTVLSRFLDR 439
           D +EETP RKTVLS+FL+R
Sbjct: 771 DEEEETPFRKTVLSKFLER 789

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224128610|ref|XP_002329046.1| predicted protein [Populus trichocarpa] gi|222839717|gb|EEE78040.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225442908|ref|XP_002264312.1| PREDICTED: uncharacterized protein LOC100250817 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743483|emb|CBI36350.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356547442|ref|XP_003542121.1| PREDICTED: uncharacterized protein LOC100805089 [Glycine max] Back     alignment and taxonomy information
>gi|357455287|ref|XP_003597924.1| hypothetical protein MTR_2g104070 [Medicago truncatula] gi|355486972|gb|AES68175.1| hypothetical protein MTR_2g104070 [Medicago truncatula] Back     alignment and taxonomy information
>gi|359475826|ref|XP_002285195.2| PREDICTED: uncharacterized protein LOC100267879 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082054|emb|CBI21059.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|51969890|dbj|BAD43637.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15233233|ref|NP_188213.1| Phox (PX) domain-containing protein [Arabidopsis thaliana] gi|9294595|dbj|BAB02876.1| unnamed protein product [Arabidopsis thaliana] gi|46518487|gb|AAS99725.1| At3g15920 [Arabidopsis thaliana] gi|51969228|dbj|BAD43306.1| hypothetical protein [Arabidopsis thaliana] gi|51970142|dbj|BAD43763.1| hypothetical protein [Arabidopsis thaliana] gi|332642226|gb|AEE75747.1| Phox (PX) domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query439
TAIR|locus:2093915755 AT3G15920 [Arabidopsis thalian 0.911 0.529 0.483 7.8e-94
TAIR|locus:2116687723 AT4G32160 [Arabidopsis thalian 0.763 0.463 0.422 6.9e-63
TAIR|locus:2040030643 AT2G25350 [Arabidopsis thalian 0.703 0.480 0.389 1.8e-48
SGD|S0000022161790 USO1 "Protein involved in the 0.890 0.218 0.217 1.3e-07
DICTYBASE|DDB_G0286985 1024 zipA "zipper-like domain-conta 0.719 0.308 0.208 6.5e-07
FB|FBgn0040233 1931 cana "CENP-ana" [Drosophila me 0.453 0.103 0.247 1.1e-06
ZFIN|ZDB-GENE-060125-2 1401 rock2b "rho-associated, coiled 0.571 0.179 0.248 1.2e-06
UNIPROTKB|P07951284 TPM2 "Tropomyosin beta chain" 0.555 0.859 0.251 2e-06
WB|WBGene00010306 1133 F59A2.6 [Caenorhabditis elegan 0.612 0.237 0.242 2.6e-06
DICTYBASE|DDB_G02880691082 DDB_G0288069 [Dictyostelium di 0.642 0.260 0.222 4e-06
TAIR|locus:2093915 AT3G15920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 934 (333.8 bits), Expect = 7.8e-94, P = 7.8e-94
 Identities = 203/420 (48%), Positives = 289/420 (68%)

Query:    29 RLDGHVRRLSTESVGSDLSSIRASEKSNFGVSNLFGDGSVNHPE---GGETSRSMDAHIS 85
             RLDG  R+    ++     SI+ +  S+F  S       VN       GE   +M   + 
Sbjct:   347 RLDGSDRKFQELTI----ESIKKTHVSDFEASTAVEPDLVNQGAMDIHGEAHGNMYGAVG 402

Query:    86 SDALFPRNSLLALPSDQRLKLNRVLNNMQQRLTAAKADTEDLLARLNQEVAVRQFLTTKV 145
              D    ++  +   S++R KL RV++ ++QRL  AKADTEDL++RLNQE+AVRQFL+TKV
Sbjct:   403 GDTETQKDLAIVFQSEERHKLKRVIDTLKQRLETAKADTEDLISRLNQELAVRQFLSTKV 462

Query:   146 KDLEVELETTSENCKENMQQAVLNEKERFTQMQWDMEELRKQLLETELKLKYEQDERARA 205
             +DLEVELETT E+CK+ M++ VL+EKERFTQ+QWDMEELRKQ +E E  L   +DE+   
Sbjct:   463 RDLEVELETTRESCKQGMEKTVLDEKERFTQIQWDMEELRKQCMEMESFLNSIKDEKTHI 522

Query:   206 ESSKMSIIQENXXXXXXXXXXXXXXXXXHKQHEESEVKSKTDVKLLVKEVKSLRSSQSEV 265
             E++  S++QEN                 HK+HEE EVK+K ++K+LVKEVKSLR++QS++
Sbjct:   523 ETANESLVQENQMLLQQINDIRENFENFHKEHEELEVKAKAELKVLVKEVKSLRTTQSDL 582

Query:   266 KQELSRLMKEKLEVEGVLQKEKQRMEHADIANLKLLHECEILRNRLQECSVNFLSEEEDK 325
             +QELS +MKEKLE+E ++Q+EK R E A  A+ KLLHEC++L+NRLQEC+V F  EEE K
Sbjct:   583 RQELSGIMKEKLEMERIVQREKDREETAKNADKKLLHECDVLQNRLQECNVKFDIEEEGK 642

Query:   326 LTVDTSSPSDAVDLLTTSDNRIGLLVAETQLLAQDIERSMTGLDKTCNANGSDRRSDDEL 385
             L +D+SS S+A++LL TSDNRIGLL+AETQLL++++E+    L  T   +G  R +DD +
Sbjct:   643 LIMDSSSLSEAIELLATSDNRIGLLIAETQLLSEEVEK----LKLT---SGGHRGTDDLV 695

Query:   386 RQMLTDIFIDNARLRMQVNTVIRCALNTY---VK---SDNDDGKEETPLRKTVLSRFLDR 439
             R+MLT++ IDNARLR QVN+V+RC+L+ +   V+   ++ DD +    L +TV+S+ L++
Sbjct:   696 RKMLTEVLIDNARLRKQVNSVLRCSLSGHGISVREAGTEVDDEEGSIDLARTVMSKILEK 755
GO:0005634 "nucleus" evidence=ISM
GO:0007154 "cell communication" evidence=IEA
GO:0035091 "phosphatidylinositol binding" evidence=IEA;ISS
GO:0035556 "intracellular signal transduction" evidence=ISS
GO:0007165 "signal transduction" evidence=ISS
TAIR|locus:2116687 AT4G32160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040030 AT2G25350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000002216 USO1 "Protein involved in the ER to Golgi transport step of secretion" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286985 zipA "zipper-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0040233 cana "CENP-ana" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060125-2 rock2b "rho-associated, coiled-coil containing protein kinase 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P07951 TPM2 "Tropomyosin beta chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00010306 F59A2.6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288069 DDB_G0288069 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_970001
hypothetical protein (748 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-08
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 8e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 7e-04
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information 
 Score = 56.6 bits (137), Expect = 2e-08
 Identities = 46/244 (18%), Positives = 96/244 (39%), Gaps = 7/244 (2%)

Query: 110 LNNMQQRLTAAKADTEDLLARLNQEVAVRQFLTTKVKDLEVELETTSENCKENMQQAVLN 169
           L    ++L    A     L  L  E+   +    + ++   E E   E  +  ++Q    
Sbjct: 738 LEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQL--- 794

Query: 170 EKERFTQMQWDMEELRKQLLETELKLKYEQDERARAESSKMSIIQENEMLLQELEVVREQ 229
            KE    ++  ++ELR +L     +    ++     E    +  +  E L +++E + E 
Sbjct: 795 -KEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQIEELSED 853

Query: 230 LENLHKQHEESEV---KSKTDVKLLVKEVKSLRSSQSEVKQELSRLMKEKLEVEGVLQKE 286
           +E+L  + EE E    + +++++ L+ E  SL  + + ++ EL  L +E  E+E    + 
Sbjct: 854 IESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSEL 913

Query: 287 KQRMEHADIANLKLLHECEILRNRLQECSVNFLSEEEDKLTVDTSSPSDAVDLLTTSDNR 346
           ++ +E       +L    E L  R+         E    L    +  +   D    +  R
Sbjct: 914 RRELEELREKLAQLELRLEGLEVRIDNLQERLSEEYSLTLEEAEALENKIEDDEEEARRR 973

Query: 347 IGLL 350
           +  L
Sbjct: 974 LKRL 977

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 439
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.79
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.51
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.5
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.45
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 97.26
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 97.22
PRK02224880 chromosome segregation protein; Provisional 96.78
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.63
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.51
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.47
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.29
PRK02224 880 chromosome segregation protein; Provisional 96.28
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 96.12
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 96.04
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 95.97
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 95.93
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 95.79
PRK04778569 septation ring formation regulator EzrA; Provision 95.74
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 95.73
PHA02562562 46 endonuclease subunit; Provisional 95.69
PRK04863 1486 mukB cell division protein MukB; Provisional 95.68
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.67
PRK09039343 hypothetical protein; Validated 95.66
PRK11637428 AmiB activator; Provisional 95.46
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 95.44
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 95.44
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 95.43
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 95.29
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 95.28
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 95.2
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 95.18
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 95.18
PF00038312 Filament: Intermediate filament protein; InterPro: 95.04
PRK11637428 AmiB activator; Provisional 94.46
KOG0963 629 consensus Transcription factor/CCAAT displacement 94.27
KOG0971 1243 consensus Microtubule-associated protein dynactin 94.25
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.17
PRK09039343 hypothetical protein; Validated 94.09
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 94.05
KOG0933 1174 consensus Structural maintenance of chromosome pro 93.99
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 93.73
PF13851201 GAS: Growth-arrest specific micro-tubule binding 93.64
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 93.6
PRK10361 475 DNA recombination protein RmuC; Provisional 93.48
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.32
PF05701522 WEMBL: Weak chloroplast movement under blue light; 93.26
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 93.14
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 93.08
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 92.9
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 92.58
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 92.41
KOG0996 1293 consensus Structural maintenance of chromosome pro 92.05
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 91.97
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 91.88
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 91.85
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 91.78
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 91.7
PRK04778569 septation ring formation regulator EzrA; Provision 91.65
PLN02939 977 transferase, transferring glycosyl groups 91.38
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 91.35
COG4372 499 Uncharacterized protein conserved in bacteria with 90.64
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 90.46
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 90.42
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 90.33
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 90.11
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 90.1
PRK03918880 chromosome segregation protein; Provisional 89.6
PF13870177 DUF4201: Domain of unknown function (DUF4201) 89.5
PF00435105 Spectrin: Spectrin repeat; InterPro: IPR002017 Spe 89.18
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 89.07
KOG0933 1174 consensus Structural maintenance of chromosome pro 89.06
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 89.03
KOG0964 1200 consensus Structural maintenance of chromosome pro 89.0
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 88.98
PF10186302 Atg14: UV radiation resistance protein and autopha 88.69
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 88.58
KOG0977546 consensus Nuclear envelope protein lamin, intermed 88.57
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 88.47
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 88.45
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 88.4
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 88.35
COG4942 420 Membrane-bound metallopeptidase [Cell division and 88.04
PRK01156895 chromosome segregation protein; Provisional 87.98
PRK10884206 SH3 domain-containing protein; Provisional 87.91
PHA02562562 46 endonuclease subunit; Provisional 87.68
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 87.34
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 87.22
PF135141111 AAA_27: AAA domain 86.63
PF14662193 CCDC155: Coiled-coil region of CCDC155 86.47
PF00038312 Filament: Intermediate filament protein; InterPro: 86.42
KOG4673 961 consensus Transcription factor TMF, TATA element m 86.37
KOG0249 916 consensus LAR-interacting protein and related prot 86.31
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 86.05
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 85.91
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 85.76
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 85.56
cd09238339 V_Alix_like_1 Protein-interacting V-domain of an u 85.24
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 85.22
KOG0964 1200 consensus Structural maintenance of chromosome pro 84.79
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 84.67
KOG0979 1072 consensus Structural maintenance of chromosome pro 83.63
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 83.55
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 83.54
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 83.5
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 83.31
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 83.19
PF03915424 AIP3: Actin interacting protein 3; InterPro: IPR02 83.12
PF13801125 Metal_resist: Heavy-metal resistance; PDB: 3EPV_C 83.03
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 82.98
PF15066527 CAGE1: Cancer-associated gene protein 1 family 82.73
PRK11519 719 tyrosine kinase; Provisional 82.65
PF10186302 Atg14: UV radiation resistance protein and autopha 82.08
PRK10884206 SH3 domain-containing protein; Provisional 81.57
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 81.45
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 81.37
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 80.25
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 80.23
PLN02320 502 seryl-tRNA synthetase 80.23
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information 
Probab=97.79  E-value=0.013  Score=63.54  Aligned_cols=63  Identities=16%  Similarity=0.241  Sum_probs=27.5

Q ss_pred             hhhhhhccHHHHHHHHHHHHHhhhhHHhhhHhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHh
Q 039269          173 RFTQMQWDMEELRKQLLETELKLKYEQDERARAESSKMSIIQENEMLLQELEVVREQLENLHK  235 (439)
Q Consensus       173 r~tqmQWdmeElr~k~~e~E~~Lks~qdek~~~e~~~~s~~~e~~~l~qEL~~~r~~le~L~k  235 (439)
                      .+.+++..+++++....+....+...+..-................+..++..+.+++..+..
T Consensus       783 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~l~~~~~~~~~  845 (1179)
T TIGR02168       783 EIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEE  845 (1179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344444455555555555544444444443333333333333444444444433333333333

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle.
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd09238 V_Alix_like_1 Protein-interacting V-domain of an uncharacterized family of the V_Alix_like superfamily Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF03915 AIP3: Actin interacting protein 3; InterPro: IPR022782 This entry represents a domain found in yeast actin interacting protein 3 and bud site selection protein 6 Back     alignment and domain information
>PF13801 Metal_resist: Heavy-metal resistance; PDB: 3EPV_C 2Y3D_A 2Y3H_D 2Y3G_B 2Y3B_A 2Y39_A 3LAY_H Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PLN02320 seryl-tRNA synthetase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-08
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 5e-07
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-04
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-04
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 2e-04
2xs1_A704 Programmed cell death 6-interacting protein; prote 3e-04
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 6e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 69.1 bits (169), Expect = 1e-12
 Identities = 55/311 (17%), Positives = 118/311 (37%), Gaps = 25/311 (8%)

Query: 101  DQRLKLNRVLNNMQQRLTAAKADTEDLLARLNQEVAVRQFLTTKVKDLEVELETTSENCK 160
            ++    +  L   ++R   A+A+ ++L  +  Q    +  L  K++  E EL   +E  +
Sbjct: 857  EEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQA-ETELYAEAEEMR 915

Query: 161  ENMQQAVLNEKERFTQMQWDMEELRKQLLETELKLKYEQDERARAESSKMSIIQENEMLL 220
              +       +E   +M+  +EE  ++  + + + K  Q +    E      ++E E   
Sbjct: 916  VRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQ----LEEEEAAR 971

Query: 221  QELEVVREQLENLHKQHEESEVKSKTDVKLLVKEVKSLRSSQSEVKQEL----------- 269
            Q+L++ +   +   K+ E+  +  +     L KE K L    S++   L           
Sbjct: 972  QKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLT 1031

Query: 270  ---SRLMKEKLEVEGVLQKEKQRMEHADIANLKLLHECEILRNRLQECSVNF------LS 320
               ++      E+E  L+KE++  +  +    KL  E   L  ++ E           L+
Sbjct: 1032 KLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLA 1091

Query: 321  EEEDKLTVDTSSPSDAVDLLTTSDNRIGLLVAETQLLAQDIERSMTGLDKTCNANGSDRR 380
            ++E++L    +   D       +  +I  L +    L +D+E      +K          
Sbjct: 1092 KKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSE 1151

Query: 381  SDDELRQMLTD 391
              + L+  L D
Sbjct: 1152 ELEALKTELED 1162
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query439
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.76
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.6
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.03
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 96.88
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 96.0
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.86
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.83
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 95.81
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 95.59
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 93.49
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 93.13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.72
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 92.19
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 91.61
1nfn_A191 Apolipoprotein E3; lipid transport, heparin-bindin 90.7
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 90.61
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 90.32
3s84_A273 Apolipoprotein A-IV; four helix bundle, transport 87.32
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 86.39
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 86.04
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 85.07
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 84.94
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 84.43
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 83.51
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 83.42
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 83.0
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 82.81
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 81.79
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 81.68
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 80.6
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
Probab=97.76  E-value=0.015  Score=49.70  Aligned_cols=26  Identities=15%  Similarity=0.164  Sum_probs=9.7

Q ss_pred             HHHHHhhhhHHHHHHHHHHHHHHHHH
Q 039269          254 EVKSLRSSQSEVKQELSRLMKEKLEV  279 (439)
Q Consensus       254 EVKsLR~sq~elkqEl~~~~~eK~el  279 (439)
                      ++..++.....+...+...-.....+
T Consensus       224 ~l~~l~~~~~~~~~~~~~~~~~~~~~  249 (284)
T 1c1g_A          224 EIKVLSDKLKEAETRAEFAERSVTKL  249 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33333333333333333333333333
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query439
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 90.16
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: tRNA-binding arm
family: Seryl-tRNA synthetase (SerRS)
domain: Seryl-tRNA synthetase (SerRS)
species: Thermus thermophilus, strain hb27 [TaxId: 274]

Probab=90.16  E-value=1.4  Score=34.21  Aligned_cols=93  Identities=12%  Similarity=0.138  Sum_probs=61.0

Q ss_pred             HHHHHHHHHHHHHhhhhHHhhhHhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhccccchhHHHHHHHHHhh
Q 039269          181 MEELRKQLLETELKLKYEQDERARAESSKMSIIQENEMLLQELEVVREQLENLHKQHEESEVKSKTDVKLLVKEVKSLRS  260 (439)
Q Consensus       181 meElr~k~~e~E~~Lks~qdek~~~e~~~~s~~~e~~~l~qEL~~~r~~le~L~k~~~ElEakskad~KvLvKEVKsLR~  260 (439)
                      +--+|.....+..+|+...- .... ........+...+..+++.+|.+-..++++.+..   .+.+..-|.+|+|+|+.
T Consensus         4 ik~ir~n~e~v~~~l~~R~~-~~~l-d~i~~ld~~rr~l~~~~e~l~~~rN~~sk~i~k~---~~~~~~~l~~~~k~lk~   78 (110)
T d1seta1           4 LKRLRQEPEVFHRAIREKGV-ALDL-EALLALDREVQELKKRLQEVQTERNQVAKRVPKA---PPEEKEALIARGKALGE   78 (110)
T ss_dssp             HHHHHHCHHHHHHHHHHTTC-CCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGC---CHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhCHHHHHHHHHHcCC-ccCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh---hccchHHHHHHHHHHHH
Confidence            33455555555555544421 1111 3455566777788888888888888888887632   34566778899999998


Q ss_pred             hhHHHHHHHHHHHHHHHH
Q 039269          261 SQSEVKQELSRLMKEKLE  278 (439)
Q Consensus       261 sq~elkqEl~~~~~eK~e  278 (439)
                      ...++.+++.....+..+
T Consensus        79 ~i~~le~~~~~~~~~l~~   96 (110)
T d1seta1          79 EAKRLEEALREKEARLEA   96 (110)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            888888888776655443