Citrus Sinensis ID: 039282

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470------
MAKKNPRGAPIRKTAEQILRESQEHFGEQKSVDPTELYDYRLHKRNDFEDSIRRVPGDTAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWDRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERALEKKLADGDGDDDEGAEQLFVAFAEFEERYKESESEALRKEFGDWVLIEDAIVGKGKAPKDKAYIHFEKSQGERERRRALYERLVERTKHLKVWISYAKFEASALSKDGGNPDLSEADLCERKKQSIRGARRSHRKIYHQFATCLISSLSSSGVFEKGINYYKTSAPEMMEERVMLLEEWLNMERSFGELGDVNLVQAMLPKKLKKRRQIASDNGLSAGYEEYIDYLFPEESQKTNFKILEAASKWIKKKIVSNDQ
ccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcHHHHHHHHHccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccc
ccccccccccHHHcHHHHHHHHHHcccccEcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHEEEEEEEcccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHccccc
makknprgapirKTAEQILRESQEhfgeqksvdptelydyrlhkrndfedsirrvpgdtAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWDRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERALEKkladgdgdddeGAEQLFVAFAEFEERYKESESEALRKEFGDWVLIEDaivgkgkapkdkaYIHFEKSQGERERRRALYERLVERTKHLKVWISYAKFEASalskdggnpdlseadLCERKKQSIRGARRSHRKIYHQFATCLISslsssgvfekginyyktsapeMMEERVMLLEEWLNMERsfgelgdvNLVQAMLPKKLKKRRQIASDNGLSAGYEEYidylfpeesqkTNFKILEAASKWIKKKIVSNDQ
makknprgapirktaEQILREsqehfgeqksvdptelydYRLHkrndfedsirrvpGDTAVWINyakwegsqneFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWDRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVELARQVFERlvqchpnvvssWIKYAKFEMRRGEIDRARNVYERALEKkladgdgdddEGAEQLFVAFAEFEERYKESESEALRKEFGDWVLIEDAivgkgkapkdkayihfeksqgererRRALYERLVERTKHLKVWISYAKFEasalskdggnpdlseadLCERKkqsirgarrshRKIYHQFATCLisslsssgvfEKGINYYKTSAPEMMEERVMLLEEWLNMERSFGELGDVNLVQAMLPKKLKKRRQIASDNGLSAGYEEYIDYLFPEESQKTNFKILEAASKWIKKKIVSNDQ
MAKKNPRGAPIRKTAEQILRESQEHFGEQKSVDPTELYDYRLHKRNDFEDSIRRVPGDTAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWDRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERAlekkladgdgdddegaeQLFVAfaefeerykeseseaLRKEFGDWVLIEDAIVGKGKAPKDKAYIHFEKSQGererrralyerlverTKHLKVWISYAKFEASALSKDGGNPDLSEADLCERKKQSIRGARRSHRKIYHQFATCLISSLSSSGVFEKGINYYKTSAPemmeervmlleewlNMERSFGELGDVNLVQAMLPKKLKKRRQIASDNGLSAGYEEYIDYLFPEESQKTNFKILEAASKWIKKKIVSNDQ
************************************LYDYRLHKRNDFEDSIRRVPGDTAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWDRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYER******************QLFVAFAEFEE*********LRKEFGDWVLIEDAIVGKGKAPKDKAYIHF**********RALYERLVERTKHLKVWISYAKFEA********************************RKIYHQFATCLISSLSSSGVFEKGINYYKTSAPEMMEERVMLLEEWLNMERSFGELGDVNLVQAMLPKKLK***QIASDNGLSAGYEEYIDYLFPEESQKTNFKILEAASKWIKKK******
********A**RKTAEQILRESQEHFGEQKSVDPTELYDYRLHKRNDFEDSIRRVPGDTAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWDRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERALEKKLADGDGDDDEGAEQLFVAFAEFEERYKESESEALRKEFGDWVLIEDAIVGKGKAPKDKAYIHFEKSQGERERRRALYERLVERTKHLKVWISYAKFEASALSKDGGNPDLSEADLCERKKQSIRGARRSHRKIYHQFATCLISSLSSSGVFEKGINYYKTSAPEMMEERVMLLEEWLNMERSFGELGDVNLVQAMLPKKLKKRRQIASDNGLSAGYEEYIDYLFPEESQKTNFKILEAASK***********
**********IRKTAEQILRESQEHFGEQKSVDPTELYDYRLHKRNDFEDSIRRVPGDTAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWDRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERALEKKLADGDGDDDEGAEQLFVAFAEFE**********LRKEFGDWVLIEDAIVGKGKAPKDKAYIHFE********RRALYERLVERTKHLKVWISYAKFEASALSKDGGNPDLSEADLCERKK*********HRKIYHQFATCLISSLSSSGVFEKGINYYKTSAPEMMEERVMLLEEWLNMERSFGELGDVNLVQAMLPKKLKKRRQIASDNGLSAGYEEYIDYLFPEESQKTNFKILEAASKWIKKKIVSNDQ
*********PIRKTAEQILRESQEHFGEQKSVDPTELYDYRLHKRNDFEDSIRRVPGDTAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWDRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERALEKKLADGDGDDDEGAEQLFVAFAEFEERYKESESEALRKEFGDWVLIEDAIVGKGKAPKDKAYIHFEKSQGERERRRALYERLVERTKHLKVWISYAKFEASALSKDGGNPDLSEADLCERKKQSIRGARRSHRKIYHQFATCLISSLSSSGVFEKGINYYKTSAPEMMEERVMLLEEWLNMERSFGELGDVNLVQAMLPKKLKKRRQIASDNGLSAGYEEYIDYLFPEESQKTNFKILEAASKWIKKKI*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKKNPRGAPIRKTAEQILRESQEHFGEQKSVDPTELYDYRLHKRNDFEDSIRRVPGDTAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWDRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERALEKKLADGDGDDDEGAEQLFVAFAEFEERYKESESEALRKEFGDWVLIEDAIVGKGKAPKDKAYIHFEKSQGERERRRALYERLVERTKHLKVWISYAKFEASALSKDGGNPDLSEADLCERKKQSIRGARRSHRKIYHQFATCLISSLSSSGVFEKGINYYKTSAPEMMEERVMLLEEWLNMERSFGELGDVNLVQAMLPKKLKKRRQIASDNGLSAGYEEYIDYLFPEESQKTNFKILEAASKWIKKKIVSNDQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query476 2.2.26 [Sep-21-2011]
P63155 690 Crooked neck-like protein yes no 0.653 0.450 0.432 2e-68
P63154 690 Crooked neck-like protein yes no 0.653 0.450 0.432 2e-68
Q9BZJ0 848 Crooked neck-like protein yes no 0.653 0.366 0.430 3e-68
Q54XP4 705 Crooked neck-like protein yes no 0.665 0.449 0.416 1e-66
P17886 702 Protein crooked neck OS=D yes no 0.653 0.443 0.408 3e-64
Q4PB37 781 Pre-mRNA-splicing factor N/A no 0.661 0.403 0.363 2e-59
Q4WT84 676 Pre-mRNA-splicing factor yes no 0.655 0.461 0.407 6e-58
Q5BDX1 673 Pre-mRNA-splicing factor yes no 0.655 0.463 0.407 8e-58
P0CO10 726 Pre-mRNA-splicing factor yes no 0.657 0.431 0.383 4e-57
P0CO11 726 Pre-mRNA-splicing factor N/A no 0.657 0.431 0.383 4e-57
>sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 Back     alignment and function desciption
 Score =  260 bits (664), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 161/372 (43%), Positives = 211/372 (56%), Gaps = 61/372 (16%)

Query: 4   KNPRGAPIRKTAEQILRESQEHFGE-------QKSVDPTELYDYRLHKRNDFEDSIRRVP 56
           KN   A ++ TAEQ+LRE++E   E       QK  D  EL DY+L KR  FED+IR+  
Sbjct: 19  KNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNR 78

Query: 57  GDTAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVW 116
              + WI YA+WE S  E  RARS++E AL+ D RN TLW KYAE EM N+ +NHARN+W
Sbjct: 79  TVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIW 138

Query: 117 DRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQV 176
           DRA+  LP V+Q WYKY  MEE+ GNVA AR +F+RWM W P++QAW SYI FELRY++V
Sbjct: 139 DRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEV 198

Query: 177 ELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERALEKKLADGDGDDDEGA 236
           E AR ++ER V  HP  V +WIKYA+FE +      AR VYERA+E     GD   D   
Sbjct: 199 ERARTIYERFVLVHP-AVKNWIKYARFEEKHAYFAHARKVYERAVE---FFGDEHMD--- 251

Query: 237 EQLFVAFAEFEERYKE---------------SESEA---------LRKEFGDWVLIEDAI 272
           E L+VAFA+FEE  KE               S+ EA           K+FGD   IED I
Sbjct: 252 EHLYVAFAKFEENQKEFERVRVIYKYALDRISKQEAQELFKNYTIFEKKFGDRRGIEDII 311

Query: 273 VGKGKAPKDKA-------------YIHFEKSQGERERRRALYERLVERT----------K 309
           V K +   ++              Y+   +S  E +  R +YER +             +
Sbjct: 312 VSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEADTVREVYERAIANVPPIQEKRHWKR 371

Query: 310 HLKVWISYAKFE 321
           ++ +W++YA +E
Sbjct: 372 YIYLWVNYALYE 383
May be involved in pre-mRNA splicing process.
Rattus norvegicus (taxid: 10116)
>sp|P63154|CRNL1_MOUSE Crooked neck-like protein 1 OS=Mus musculus GN=Crnkl1 PE=2 SV=1 Back     alignment and function description
>sp|Q9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens GN=CRNKL1 PE=1 SV=4 Back     alignment and function description
>sp|Q54XP4|CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum GN=crnkl1 PE=3 SV=1 Back     alignment and function description
>sp|P17886|CRN_DROME Protein crooked neck OS=Drosophila melanogaster GN=crn PE=2 SV=2 Back     alignment and function description
>sp|Q4PB37|CLF1_USTMA Pre-mRNA-splicing factor CLF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLF1 PE=3 SV=1 Back     alignment and function description
>sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 Back     alignment and function description
>sp|Q5BDX1|CLF1_EMENI Pre-mRNA-splicing factor clf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clf1 PE=3 SV=2 Back     alignment and function description
>sp|P0CO10|CLF1_CRYNJ Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CLF1 PE=3 SV=1 Back     alignment and function description
>sp|P0CO11|CLF1_CRYNB Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CLF1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query476
449525555 703 PREDICTED: LOW QUALITY PROTEIN: crooked 0.653 0.442 0.547 4e-96
224058393 687 predicted protein [Populus trichocarpa] 0.653 0.452 0.555 5e-96
449443386 703 PREDICTED: crooked neck-like protein 1-l 0.653 0.442 0.547 5e-96
356539448 695 PREDICTED: crooked neck-like protein 1-l 0.653 0.447 0.539 8e-96
356497297 695 PREDICTED: crooked neck-like protein 1-l 0.653 0.447 0.539 8e-96
225426022 703 PREDICTED: crooked neck-like protein 1 [ 0.653 0.442 0.539 4e-95
357481457 693 Pre-mRNA-splicing factor CLF1 [Medicago 0.754 0.518 0.497 2e-93
224072126 687 predicted protein [Populus trichocarpa] 0.653 0.452 0.541 4e-93
255537721 696 crooked neck protein, putative [Ricinus 0.653 0.446 0.533 1e-92
357501061 695 Pre-mRNA-splicing factor CLF1 [Medicago 0.75 0.513 0.491 2e-91
>gi|449525555|ref|XP_004169782.1| PREDICTED: LOW QUALITY PROTEIN: crooked neck-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  358 bits (918), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 203/371 (54%), Positives = 241/371 (64%), Gaps = 60/371 (16%)

Query: 4   KNPRGAPIRKTAEQILRESQEH------FGEQKSVDPTELYDYRLHKRNDFEDSIRRVPG 57
           KN   API+ TAEQILRE++E         +QK  DPTEL DYRL KR +FED IRRV  
Sbjct: 30  KNKTPAPIQITAEQILREARERQEAEIRPPKQKXTDPTELADYRLRKRKEFEDLIRRVRW 89

Query: 58  DTAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWD 117
           + +VWI YA+WE SQ +F+RARS+WE ALE D RNHTLW KYAE EM NKFINHARNVWD
Sbjct: 90  NISVWIKYAQWEESQKDFNRARSVWERALEVDYRNHTLWLKYAEVEMKNKFINHARNVWD 149

Query: 118 RAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVE 177
           RAV +LP VDQLWYKYI MEE+ GNVA AR IF+RWM W PDQQ WLSYIKFELRY +VE
Sbjct: 150 RAVTLLPRVDQLWYKYIHMEEMLGNVAGARQIFERWMGWMPDQQGWLSYIKFELRYNEVE 209

Query: 178 LARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERALEKKLADGDGDDDEGAE 237
            AR +FER VQCHP  V +WI++AKFEM+ GEI RAR VYE A+E KLA     DDE AE
Sbjct: 210 RARGIFERFVQCHPK-VGAWIRFAKFEMKNGEITRARKVYETAVE-KLA-----DDEEAE 262

Query: 238 QLFVAFAEFEERYKESESE------------------------ALRKEFGDWVLIEDAIV 273
           QLFVAFAEFEER KE+E                          A  K++GD   IEDAIV
Sbjct: 263 QLFVAFAEFEERCKETERARCIYKFALDHIPKGRAEDIYRKFVAFEKQYGDKEGIEDAIV 322

Query: 274 GKGKAPKDKA-------------YIHFEKSQGERERRRALYERLVERT----------KH 310
           GK +   ++              YI  E++ G +ER R +YER +             ++
Sbjct: 323 GKRRFQYEEEVRKNPLNYDSWFDYIRLEETAGNKERIREVYERAIANVPPAEEKRYWQRY 382

Query: 311 LKVWISYAKFE 321
           + +WI+YA +E
Sbjct: 383 IYLWINYALYE 393

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224058393|ref|XP_002299492.1| predicted protein [Populus trichocarpa] gi|222846750|gb|EEE84297.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449443386|ref|XP_004139458.1| PREDICTED: crooked neck-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356539448|ref|XP_003538210.1| PREDICTED: crooked neck-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356497297|ref|XP_003517497.1| PREDICTED: crooked neck-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|225426022|ref|XP_002273571.1| PREDICTED: crooked neck-like protein 1 [Vitis vinifera] gi|147864786|emb|CAN81550.1| hypothetical protein VITISV_028250 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357481457|ref|XP_003611014.1| Pre-mRNA-splicing factor CLF1 [Medicago truncatula] gi|355512349|gb|AES93972.1| Pre-mRNA-splicing factor CLF1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224072126|ref|XP_002303629.1| predicted protein [Populus trichocarpa] gi|222841061|gb|EEE78608.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255537721|ref|XP_002509927.1| crooked neck protein, putative [Ricinus communis] gi|223549826|gb|EEF51314.1| crooked neck protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357501061|ref|XP_003620819.1| Pre-mRNA-splicing factor CLF1 [Medicago truncatula] gi|357501261|ref|XP_003620919.1| Pre-mRNA-splicing factor CLF1 [Medicago truncatula] gi|355495834|gb|AES77037.1| Pre-mRNA-splicing factor CLF1 [Medicago truncatula] gi|355495934|gb|AES77137.1| Pre-mRNA-splicing factor CLF1 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query476
TAIR|locus:2152965 705 AT5G41770 [Arabidopsis thalian 0.453 0.306 0.632 1.3e-118
TAIR|locus:2161363 673 AT5G45990 [Arabidopsis thalian 0.453 0.320 0.611 4.6e-109
UNIPROTKB|J9P5Z1 728 CRNKL1 "Uncharacterized protei 0.460 0.300 0.539 4.5e-87
UNIPROTKB|Q5JY65 836 CRNKL1 "Crooked neck-like prot 0.460 0.261 0.539 5.7e-87
UNIPROTKB|Q9BZJ0 848 CRNKL1 "Crooked neck-like prot 0.460 0.258 0.539 5.7e-87
MGI|MGI:1914127 690 Crnkl1 "Crn, crooked neck-like 0.460 0.317 0.543 7.2e-87
RGD|620507 690 Crnkl1 "crooked neck pre-mRNA 0.460 0.317 0.543 7.2e-87
UNIPROTKB|F1MZT2 781 CRNKL1 "Uncharacterized protei 0.460 0.280 0.534 2.4e-86
FB|FBgn0000377 702 crn "crooked neck" [Drosophila 0.460 0.311 0.517 3.9e-86
ZFIN|ZDB-GENE-040426-694 754 crnkl1 "crooked neck pre-mRNA 0.460 0.290 0.524 5.5e-85
TAIR|locus:2152965 AT5G41770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 751 (269.4 bits), Expect = 1.3e-118, Sum P(4) = 1.3e-118
 Identities = 141/223 (63%), Positives = 170/223 (76%)

Query:     4 KNPRGAPIRKTAEQILRESQEHFG------EQKSVDPTELYDYRLHKRNDFEDSIRRVPG 57
             KN   API+ TAEQILRE++E         +QK  D TEL DYRL +R +FED IRR   
Sbjct:    31 KNKTPAPIQITAEQILREARERQEAEIRPPKQKITDSTELSDYRLRRRKEFEDQIRRARW 90

Query:    58 DTAVWINYAKWEGSQNEFDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWD 117
             +  VW+ YA+WE SQ ++ RARS+WE A+E D RNHTLW KYAEFEM NKF+N ARNVWD
Sbjct:    91 NIQVWVKYAQWEESQKDYARARSVWERAIEGDYRNHTLWLKYAEFEMKNKFVNSARNVWD 150

Query:   118 RAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQQAWLSYIKFELRYEQVE 177
             RAV +LP VDQLWYKYI MEEI GN+A AR IF+RWM W+PDQQ WLS+IKFELRY ++E
Sbjct:   151 RAVTLLPRVDQLWYKYIHMEEILGNIAGARQIFERWMDWSPDQQGWLSFIKFELRYNEIE 210

Query:   178 LARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERA 220
              AR ++ER V CHP V S++I+YAKFEM+ GE+ R R+VYERA
Sbjct:   211 RARTIYERFVLCHPKV-SAYIRYAKFEMKGGEVARCRSVYERA 252
GO:0005622 "intracellular" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006396 "RNA processing" evidence=IEA;ISS
TAIR|locus:2161363 AT5G45990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|J9P5Z1 CRNKL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5JY65 CRNKL1 "Crooked neck-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BZJ0 CRNKL1 "Crooked neck-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914127 Crnkl1 "Crn, crooked neck-like 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620507 Crnkl1 "crooked neck pre-mRNA splicing factor-like 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZT2 CRNKL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0000377 crn "crooked neck" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-694 crnkl1 "crooked neck pre-mRNA splicing factor-like 1 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_I000327
hypothetical protein (687 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00440042
hypothetical protein (2357 aa)
   •• • 0.626
estExt_Genewise1_v1.C_LG_IV2251
hypothetical protein (909 aa)
   •• ••0.561
estExt_Genewise1_v1.C_LG_X3939
SubName- Full=Putative uncharacterized protein; (480 aa)
   •• • 0.527

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
smart0038633 smart00386, HAT, HAT (Half-A-TPR) repeats 5e-05
smart0038633 smart00386, HAT, HAT (Half-A-TPR) repeats 3e-04
COG5191435 COG5191, COG5191, Uncharacterized conserved protei 0.001
pfam0218432 pfam02184, HAT, HAT (Half-A-TPR) repeat 0.004
>gnl|CDD|214642 smart00386, HAT, HAT (Half-A-TPR) repeats Back     alignment and domain information 
 Score = 39.8 bits (94), Expect = 5e-05
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 174 EQVELARQVFERLVQCHPNVVSSWIKYAKFEMR 206
             +E AR+++ER ++  P  V  W+KYA+FE R
Sbjct: 1   GDIERARKIYERALEKFPKSVELWLKYAEFEER 33

Present in several RNA-binding proteins. Structurally and sequentially thought to be similar to TPRs. Length = 33
>gnl|CDD|214642 smart00386, HAT, HAT (Half-A-TPR) repeats Back     alignment and domain information
>gnl|CDD|227518 COG5191, COG5191, Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|111114 pfam02184, HAT, HAT (Half-A-TPR) repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 476
KOG1915677 consensus Cell cycle control protein (crooked neck 100.0
KOG1915677 consensus Cell cycle control protein (crooked neck 100.0
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.97
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.95
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.94
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.9
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.9
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.89
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.88
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.82
KOG0547606 consensus Translocase of outer mitochondrial membr 99.82
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.81
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.79
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.78
KOG1258577 consensus mRNA processing protein [RNA processing 99.78
PLN03218 1060 maturation of RBCL 1; Provisional 99.77
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 99.77
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.77
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.76
PRK12370553 invasion protein regulator; Provisional 99.76
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.76
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.75
KOG2076 895 consensus RNA polymerase III transcription factor 99.75
PLN03218 1060 maturation of RBCL 1; Provisional 99.74
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.73
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.73
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.73
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.72
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.71
PRK12370553 invasion protein regulator; Provisional 99.71
KOG1126638 consensus DNA-binding cell division cycle control 99.71
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.7
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.69
PRK11189296 lipoprotein NlpI; Provisional 99.69
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.69
KOG1126638 consensus DNA-binding cell division cycle control 99.69
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.68
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.67
PLN03077 857 Protein ECB2; Provisional 99.67
PLN03077857 Protein ECB2; Provisional 99.65
KOG0547606 consensus Translocase of outer mitochondrial membr 99.65
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.64
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.64
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.63
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.63
KOG1258577 consensus mRNA processing protein [RNA processing 99.61
PRK14574 822 hmsH outer membrane protein; Provisional 99.59
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.59
PRK11189296 lipoprotein NlpI; Provisional 99.59
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.59
KOG1125579 consensus TPR repeat-containing protein [General f 99.58
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.56
KOG1125579 consensus TPR repeat-containing protein [General f 99.55
KOG2076 895 consensus RNA polymerase III transcription factor 99.55
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.55
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.54
PLN02789320 farnesyltranstransferase 99.54
PRK14574 822 hmsH outer membrane protein; Provisional 99.53
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.53
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.52
KOG1129478 consensus TPR repeat-containing protein [General f 99.51
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 99.5
KOG1129478 consensus TPR repeat-containing protein [General f 99.49
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.46
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.44
PLN02789320 farnesyltranstransferase 99.43
PRK15359144 type III secretion system chaperone protein SscB; 99.42
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.41
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.41
PRK10370198 formate-dependent nitrite reductase complex subuni 99.38
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.37
PRK15359144 type III secretion system chaperone protein SscB; 99.36
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.31
KOG2003840 consensus TPR repeat-containing protein [General f 99.31
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.3
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 99.29
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.29
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.28
PRK10370198 formate-dependent nitrite reductase complex subuni 99.28
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.27
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.26
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.25
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.25
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.25
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.25
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.24
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.23
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.2
KOG2003840 consensus TPR repeat-containing protein [General f 99.2
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.2
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.2
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.19
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.19
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.19
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.18
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.15
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.15
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.13
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.09
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.04
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.03
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.03
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.02
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 99.01
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.01
KOG1128777 consensus Uncharacterized conserved protein, conta 99.01
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.01
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.98
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.98
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.92
KOG1128777 consensus Uncharacterized conserved protein, conta 98.92
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.9
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.86
KOG0553304 consensus TPR repeat-containing protein [General f 98.86
KOG0553304 consensus TPR repeat-containing protein [General f 98.83
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.78
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.75
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.75
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.75
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.75
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.73
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.72
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.71
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.71
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.71
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.68
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.68
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.67
PRK11906458 transcriptional regulator; Provisional 98.66
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.65
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 98.61
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.61
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.6
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.58
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.58
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.57
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.57
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.56
PRK04841903 transcriptional regulator MalT; Provisional 98.55
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.54
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.54
PRK11906458 transcriptional regulator; Provisional 98.52
KOG2376652 consensus Signal recognition particle, subunit Srp 98.51
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.51
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.5
PRK04841903 transcriptional regulator MalT; Provisional 98.47
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.46
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.44
PRK10803263 tol-pal system protein YbgF; Provisional 98.41
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.41
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.4
PF1337173 TPR_9: Tetratricopeptide repeat 98.39
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.38
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.37
COG4700251 Uncharacterized protein conserved in bacteria cont 98.36
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.36
PRK15331165 chaperone protein SicA; Provisional 98.35
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.34
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.34
PRK10803263 tol-pal system protein YbgF; Provisional 98.34
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.31
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.3
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.3
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.29
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.29
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.29
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.25
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.24
COG4700251 Uncharacterized protein conserved in bacteria cont 98.24
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.23
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.19
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.19
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.16
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.11
PF12688120 TPR_5: Tetratrico peptide repeat 98.11
PF1342844 TPR_14: Tetratricopeptide repeat 98.1
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 98.09
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.07
COG3898531 Uncharacterized membrane-bound protein [Function u 98.06
PF12688120 TPR_5: Tetratrico peptide repeat 98.06
PF1337173 TPR_9: Tetratricopeptide repeat 98.02
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.93
COG3898531 Uncharacterized membrane-bound protein [Function u 97.93
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.91
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.87
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.86
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.83
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.82
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 97.8
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.78
PRK15331165 chaperone protein SicA; Provisional 97.78
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.76
PF1342844 TPR_14: Tetratricopeptide repeat 97.74
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 97.74
PF13512142 TPR_18: Tetratricopeptide repeat 97.69
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.63
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.63
PF13512142 TPR_18: Tetratricopeptide repeat 97.6
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.6
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.58
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.58
KOG4555175 consensus TPR repeat-containing protein [Function 97.54
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.54
KOG4648536 consensus Uncharacterized conserved protein, conta 97.41
PF1343134 TPR_17: Tetratricopeptide repeat 97.38
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.36
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.34
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.34
PF1343134 TPR_17: Tetratricopeptide repeat 97.32
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 97.31
KOG4234271 consensus TPR repeat-containing protein [General f 97.29
KOG1585308 consensus Protein required for fusion of vesicles 97.28
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.26
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.25
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 97.23
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 97.21
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.18
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.17
KOG4234271 consensus TPR repeat-containing protein [General f 97.17
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.16
KOG4555175 consensus TPR repeat-containing protein [Function 97.08
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.07
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 97.05
KOG1586288 consensus Protein required for fusion of vesicles 97.05
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.01
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.99
KOG1941518 consensus Acetylcholine receptor-associated protei 96.97
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.97
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.83
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.81
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.81
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.76
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.73
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.7
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.67
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.65
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.58
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.56
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.54
KOG4648536 consensus Uncharacterized conserved protein, conta 96.44
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.41
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.4
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.38
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.33
KOG1586288 consensus Protein required for fusion of vesicles 96.33
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.21
KOG1941518 consensus Acetylcholine receptor-associated protei 96.18
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.16
KOG2422665 consensus Uncharacterized conserved protein [Funct 96.14
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.09
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.05
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.95
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.76
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 95.62
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 95.58
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.54
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 95.53
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.34
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 95.17
KOG0530318 consensus Protein farnesyltransferase, alpha subun 95.04
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.96
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.89
KOG20411189 consensus WD40 repeat protein [General function pr 94.86
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.82
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.75
KOG1585308 consensus Protein required for fusion of vesicles 94.72
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.57
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 94.56
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.47
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.44
KOG2471696 consensus TPR repeat-containing protein [General f 94.3
COG4976287 Predicted methyltransferase (contains TPR repeat) 94.27
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 94.25
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 93.97
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 93.7
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.58
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 93.55
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.52
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.36
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.35
PRK10941269 hypothetical protein; Provisional 93.26
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 92.93
KOG4507 886 consensus Uncharacterized conserved protein, conta 92.87
COG3629280 DnrI DNA-binding transcriptional activator of the 92.79
KOG2422665 consensus Uncharacterized conserved protein [Funct 92.64
KOG0529421 consensus Protein geranylgeranyltransferase type I 92.58
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 92.56
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 92.25
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 92.11
KOG2471696 consensus TPR repeat-containing protein [General f 92.02
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 92.01
COG2976207 Uncharacterized protein conserved in bacteria [Fun 91.57
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 91.18
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 91.13
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.7
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 89.87
PRK10941269 hypothetical protein; Provisional 89.86
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.76
KOG4507 886 consensus Uncharacterized conserved protein, conta 89.58
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 89.47
COG3629280 DnrI DNA-binding transcriptional activator of the 88.09
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.57
TIGR0299642 rpt_mate_G_obs repeat-companion domain TIGR02996. 87.44
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.4
KOG15381081 consensus Uncharacterized conserved protein WDR10, 87.33
PF1304150 PPR_2: PPR repeat family 87.13
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 87.07
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.58
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 86.43
PF1304150 PPR_2: PPR repeat family 86.3
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 86.13
PF1285434 PPR_1: PPR repeat 86.03
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 85.29
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.19
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 84.06
PF1285434 PPR_1: PPR repeat 83.88
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.84
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 83.29
COG3947361 Response regulator containing CheY-like receiver a 83.27
COG3947361 Response regulator containing CheY-like receiver a 83.19
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.13
KOG0529421 consensus Protein geranylgeranyltransferase type I 83.0
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 82.98
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 82.17
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 81.18
PF14929547 TAF1_subA: TAF RNA Polymerase I subunit A 80.57
KOG3364149 consensus Membrane protein involved in organellar 80.31
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information 
Probab=100.00  E-value=2.6e-101  Score=731.19  Aligned_cols=460  Identities=54%  Similarity=0.884  Sum_probs=436.3

Q ss_pred             CCCCCCCCCcccccHHHHHHHHhhc------cCCCCCCChHHhhHHHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhCCC
Q 039282            1 MAKKNPRGAPIRKTAEQILRESQEH------FGEQKSVDPTELYDYRLHKRNDFEDSIRRVPGDTAVWINYAKWEGSQNE   74 (476)
Q Consensus         1 ~~~~~~~~~~~qi~a~q~l~~a~~~------~~~~~i~d~eel~e~~~~a~~~~e~~l~~~p~~~~~w~~~a~~~~~~~~   74 (476)
                      |+||||+|||+|||||||||||+++      +|+|+|+|++||.+||.++|+.||..|++|+.+++.|++||+|+.++++
T Consensus         9 ~~vknktpa~vqItAEQlLRea~er~~~~~~ppk~~ItD~~EL~eYq~RkRkefEd~irrnR~~~~~WikYaqwEesq~e   88 (677)
T KOG1915|consen    9 AKVKNKTPAPVQITAEQLLREARERQLAAPRPPKQKITDSEELSEYQLRKRKEFEDQIRRNRLNMQVWIKYAQWEESQKE   88 (677)
T ss_pred             hhccCCCCCcceecHHHHHHHHHHhhcccCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHH
Confidence            5799999999999999999999997      7999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHhCCHHHHHHHHHHHH
Q 039282           75 FDRARSMWELALEEDCRNHTLWCKYAEFEMINKFINHARNVWDRAVAVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWM  154 (476)
Q Consensus        75 ~~~A~~~~eral~~~p~~~~lw~~y~~~e~~~~~~~~A~~~~~ral~~~p~~~~lw~~~~~~~~~~g~~~~A~~~~eral  154 (476)
                      +.+||++|+|||.++..++++|++|+++++++++++|||++++||+++.|+.+++|++|+.|++.+||+.+||++|+||+
T Consensus        89 ~~RARSv~ERALdvd~r~itLWlkYae~Emknk~vNhARNv~dRAvt~lPRVdqlWyKY~ymEE~LgNi~gaRqiferW~  168 (677)
T KOG1915|consen   89 IQRARSVFERALDVDYRNITLWLKYAEFEMKNKQVNHARNVWDRAVTILPRVDQLWYKYIYMEEMLGNIAGARQIFERWM  168 (677)
T ss_pred             HHHHHHHHHHHHhcccccchHHHHHHHHHHhhhhHhHHHHHHHHHHHhcchHHHHHHHHHHHHHHhcccHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCHHHHHHHHHHHHHhhhHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhhcCCCCCCChh
Q 039282          155 HWTPDQQAWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRARNVYERALEKKLADGDGDDDE  234 (476)
Q Consensus       155 ~~~P~~~~w~~~~~~~~~~g~~~~A~~~~~r~l~~~p~~~~~w~~~a~~~~~~g~~~~A~~~~e~al~~~~p~~~~~~~~  234 (476)
                      .|.|+.++|++|++|+.+++++++||++|++.+..||+ +..|+.|+.|+.++|....|+.+|++|++. +.     ++.
T Consensus       169 ~w~P~eqaW~sfI~fElRykeieraR~IYerfV~~HP~-v~~wikyarFE~k~g~~~~aR~VyerAie~-~~-----~d~  241 (677)
T KOG1915|consen  169 EWEPDEQAWLSFIKFELRYKEIERARSIYERFVLVHPK-VSNWIKYARFEEKHGNVALARSVYERAIEF-LG-----DDE  241 (677)
T ss_pred             cCCCcHHHHHHHHHHHHHhhHHHHHHHHHHHHheeccc-HHHHHHHHHHHHhcCcHHHHHHHHHHHHHH-hh-----hHH
Confidence            99999999999999999999999999999999999999 999999999999999999999999999999 88     788


Q ss_pred             hHHHHHHHHHHHHHHccchhHH------------------------HHHHHhCChHHHHHHHHhc---------------
Q 039282          235 GAEQLFVAFAEFEERYKESESE------------------------ALRKEFGDWVLIEDAIVGK---------------  275 (476)
Q Consensus       235 ~~~~l~~~~a~~e~~~~~~e~A------------------------~~ek~~g~~~~~~~~i~~~---------------  275 (476)
                      ....++.+||.|+++++++++|                        .|||+||+..+|+++|.++               
T Consensus       242 ~~e~lfvaFA~fEe~qkE~ERar~iykyAld~~pk~raeeL~k~~~~fEKqfGd~~gIEd~Iv~KRk~qYE~~v~~np~n  321 (677)
T KOG1915|consen  242 EAEILFVAFAEFEERQKEYERARFIYKYALDHIPKGRAEELYKKYTAFEKQFGDKEGIEDAIVGKRKFQYEKEVSKNPYN  321 (677)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcccHHHHHHHHHHHHHHhcchhhhHHHHhhhhhhHHHHHHHhCCCC
Confidence            8899999999999999999999                        7999999999999999887               


Q ss_pred             --------------------------------------------------------------------------------
Q 039282          276 --------------------------------------------------------------------------------  275 (476)
Q Consensus       276 --------------------------------------------------------------------------------  275 (476)
                                                                                                      
T Consensus       322 YDsWfdylrL~e~~g~~~~Ire~yErAIanvpp~~ekr~W~RYIYLWinYalyeEle~ed~ertr~vyq~~l~lIPHkkF  401 (677)
T KOG1915|consen  322 YDSWFDYLRLEESVGDKDRIRETYERAIANVPPASEKRYWRRYIYLWINYALYEELEAEDVERTRQVYQACLDLIPHKKF  401 (677)
T ss_pred             chHHHHHHHHHHhcCCHHHHHHHHHHHHccCCchhHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHhhcCcccc
Confidence                                                                                            


Q ss_pred             ------------------------------cCCCCch---hhHHHHHHcCCHHHHHHHHHHHHhccC-CHHHHHHHHHHH
Q 039282          276 ------------------------------GKAPKDK---AYIHFEKSQGERERRRALYERLVERTK-HLKVWISYAKFE  321 (476)
Q Consensus       276 ------------------------------~~~p~~~---~~~~~~~~~g~~e~Ar~l~e~~l~~~~-~~~vw~~~a~~e  321 (476)
                                                    |+||+++   .||+++.+++++++.|++|++.|+..| +...|..|+.+|
T Consensus       402 tFaKiWlmyA~feIRq~~l~~ARkiLG~AIG~cPK~KlFk~YIelElqL~efDRcRkLYEkfle~~Pe~c~~W~kyaElE  481 (677)
T KOG1915|consen  402 TFAKIWLMYAQFEIRQLNLTGARKILGNAIGKCPKDKLFKGYIELELQLREFDRCRKLYEKFLEFSPENCYAWSKYAELE  481 (677)
T ss_pred             hHHHHHHHHHHHHHHHcccHHHHHHHHHHhccCCchhHHHHHHHHHHHHhhHHHHHHHHHHHHhcChHhhHHHHHHHHHH
Confidence                                          9999987   899999999999999999999999999 899999999999


Q ss_pred             hhcCCCCCC--------C-CCCch-h------HHHHhhHhhHHhhhhhhhHHhHHHHh------hhhc------------
Q 039282          322 ASALSKDGG--------N-PDLSE-A------DLCERKKQSIRGARRSHRKIYHQFAT------CLIS------------  367 (476)
Q Consensus       322 ~~~~~~~~~--------~-~~~~~-~------~~~~~~~~~~~~A~~~~~~~~~~~~~------~~~~------------  367 (476)
                      .+.|+.++.        + +.+.. +      +.|++..|.+++|    |.||+++|+      +|+|            
T Consensus       482 ~~LgdtdRaRaifelAi~qp~ldmpellwkaYIdFEi~~~E~eka----R~LYerlL~rt~h~kvWisFA~fe~s~~~~~  557 (677)
T KOG1915|consen  482 TSLGDTDRARAIFELAISQPALDMPELLWKAYIDFEIEEGEFEKA----RALYERLLDRTQHVKVWISFAKFEASASEGQ  557 (677)
T ss_pred             HHhhhHHHHHHHHHHHhcCcccccHHHHHHHhhhhhhhcchHHHH----HHHHHHHHHhcccchHHHhHHHHhccccccc
Confidence            999987663        1 22221 1      4599999999999    999999997      4766            


Q ss_pred             --------------cCchhHHHHHHHHHhhhcCCCChHHHHHHHHHHHHHHHhcCCHhhHHHHHhhCChhhhhhccccCC
Q 039282          368 --------------SLSSSGVFEKGINYYKTSAPEMMEERVMLLEEWLNMERSFGELGDVNLVQAMLPKKLKKRRQIASD  433 (476)
Q Consensus       368 --------------~~~~r~ifera~~~~~~~~~~~~~~r~~l~~~~~~fE~~~G~~~~~~~v~~~~p~~~~~~~~~~~~  433 (476)
                                    ...||.||++|+..++..  +.+++|++||++|++||..+|+..+++.|.++||++|||||++..+
T Consensus       558 ~~~~~~~~e~~~~~~~~AR~iferAn~~~k~~--~~KeeR~~LLEaw~~~E~~~G~~~d~~~V~s~mPk~vKKrr~~~~e  635 (677)
T KOG1915|consen  558 EDEDLAELEITDENIKRARKIFERANTYLKES--TPKEERLMLLEAWKNMEETFGTEGDVERVQSKMPKKVKKRRKIQRE  635 (677)
T ss_pred             cccchhhhhcchhHHHHHHHHHHHHHHHHHhc--CcHHHHHHHHHHHHHHHHhcCchhhHHHHHHhccHHHHhhhhhhcc
Confidence                          257999999999999988  6699999999999999999999999999999999999999999999


Q ss_pred             CCCCCceEEeeeeecCCCCC-CcchHHHHHHHHHHHHhhccc
Q 039282          434 NGLSAGYEEYIDYLFPEESQ-KTNFKILEAASKWIKKKIVSN  474 (476)
Q Consensus       434 ~~~~~~~~e~~~~~fp~~~~-~~~~~~~~~a~~~~~~~~~~~  474 (476)
                      || ++++|||+|||||||.+ ++|+|||++|++||+++....
T Consensus       636 dG-~~~~EEy~DYiFPed~~~~~~~K~LeaA~kWK~q~~~~~  676 (677)
T KOG1915|consen  636 DG-DTEYEEYFDYIFPEDASATKNLKILEAAKKWKKQKAKAE  676 (677)
T ss_pred             cC-chhHHHHHHhcCccccccCcchHHHHHHHHHHHHHHhcc
Confidence            99 66999999999999976 889999999999999887654

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>TIGR02996 rpt_mate_G_obs repeat-companion domain TIGR02996 Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14929 TAF1_subA: TAF RNA Polymerase I subunit A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-38
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-24
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 6e-22
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-14
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-29
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-22
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-19
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-05
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 1e-22
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 2e-19
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 4e-19
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 2e-17
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 6e-12
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 5e-11
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 3e-08
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 6e-22
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 9e-22
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 1e-19
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 4e-19
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 6e-15
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 9e-04
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
 Score =  140 bits (354), Expect = 3e-38
 Identities = 48/294 (16%), Positives = 97/294 (32%), Gaps = 48/294 (16%)

Query: 60  AVWINYAKWEGSQNE--------FDRARSMWELALEEDCRNHTLWCKYAEF--------- 102
            +W  Y +WE S             R    +E  L     +  +W + A++         
Sbjct: 9   DMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLA 68

Query: 103 -----EMINKFINHARNVWDRAV-AVLPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHW 156
                     F + A N+++RA+  +L     L++ Y   EE          I++R +  
Sbjct: 69  EKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAI 128

Query: 157 TPDQQ--AWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMR-RGEIDRA 213
                   ++ Y+KF  R E ++  R +F++  +        ++  A  E     +   A
Sbjct: 129 EDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRHHVYVTAALMEYYCSKDKSVA 188

Query: 214 RNVYERALEKKLADGDGDDDEGAEQLFVAFAEFEERYKESESEALRKEFGDWVLIEDAIV 273
             ++E  L+K      GD      +  +A+ ++     E  +          VL E  + 
Sbjct: 189 FKIFELGLKK-----YGDI----PEYVLAYIDYLSHLNEDNNT--------RVLFERVLT 231

Query: 274 GKGKAPKD-----KAYIHFEKSQGERERRRALYERLVERTKHLKVWISYAKFEA 322
                P+        ++ FE + G+      + +R     +        A    
Sbjct: 232 SGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFREEYEGKETALLVD 285
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query476
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 100.0
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.98
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.96
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.95
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.95
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.94
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.93
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.93
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.93
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.92
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.92
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.92
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.9
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.89
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.89
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.88
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.88
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.86
3u4t_A272 TPR repeat-containing protein; structural genomics 99.86
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.85
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.85
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.83
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.83
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.83
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.83
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.83
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.83
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.82
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.82
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.82
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.8
3u4t_A272 TPR repeat-containing protein; structural genomics 99.79
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.79
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.79
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.78
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.77
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.76
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.76
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.76
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.76
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.76
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.76
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.74
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.73
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.72
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.72
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.72
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.71
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.68
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.67
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.67
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.66
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.66
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.66
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.66
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.66
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.66
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.65
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.65
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.63
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.63
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.63
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.62
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.62
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.6
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.6
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.59
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.58
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.58
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.58
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.58
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.57
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.57
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.56
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.55
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.55
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.55
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.54
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.53
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.51
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.51
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.51
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.51
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.5
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.48
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.48
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.48
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.48
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.47
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.45
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.45
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.44
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.44
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.44
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.42
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.41
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.41
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.41
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.41
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.4
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.4
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.39
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.39
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.38
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.37
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.37
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.35
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.35
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.33
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.33
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.32
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.32
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.31
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.31
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.3
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.3
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.29
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.29
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.28
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.28
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.28
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.28
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.28
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.28
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.27
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.27
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.27
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.26
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.26
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.25
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.25
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.24
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.23
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.23
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.23
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.22
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.21
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.18
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.17
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.17
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.17
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.16
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.16
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.14
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.13
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.12
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.12
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.11
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.11
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.1
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.1
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.08
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.05
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.03
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.02
3k9i_A117 BH0479 protein; putative protein binding protein, 99.02
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.01
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.01
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.0
3k9i_A117 BH0479 protein; putative protein binding protein, 98.99
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.97
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.96
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.94
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.93
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.92
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.9
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.9
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.89
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.88
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.88
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.87
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.84
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.81
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.8
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.76
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.76
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.66
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.65
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.59
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.58
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.55
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.55
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.53
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.49
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.42
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.42
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.33
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.32
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.24
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.21
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.18
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.14
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.96
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.85
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 97.83
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.81
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 97.74
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 97.49
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 97.34
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.33
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.32
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.31
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 97.1
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.1
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.95
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.88
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 96.83
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.7
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 96.65
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 96.37
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.88
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.63
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.49
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.41
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.31
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.09
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.97
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.75
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.66
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.13
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.12
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.09
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.94
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.61
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 92.98
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.97
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.55
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 90.26
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 90.08
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 90.07
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.85
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.35
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 83.76
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 81.0
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.86
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
Probab=100.00  E-value=1.4e-32  Score=292.33  Aligned_cols=200  Identities=12%  Similarity=0.112  Sum_probs=161.1

Q ss_pred             HHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHH-HHHHHHHHhhcCCCCCCChhhHHHHHHHHHHHHHHccchhH
Q 039282          177 ELARQVFERLVQCHPNVVSSWIKYAKFEMRRGEIDRAR-NVYERALEKKLADGDGDDDEGAEQLFVAFAEFEERYKESES  255 (476)
Q Consensus       177 ~~A~~~~~r~l~~~p~~~~~w~~~a~~~~~~g~~~~A~-~~~e~al~~~~p~~~~~~~~~~~~l~~~~a~~e~~~~~~e~  255 (476)
                      .+++.+|++++..+|.++++|+.|+.++...|+.+.|+ .+|++|+.. +|        ....+|..|+.+++..|++++
T Consensus       326 ~Rv~~~Ye~aL~~~p~~~~lW~~ya~~~~~~~~~~~a~r~il~rAi~~-~P--------~s~~Lwl~~a~~ee~~~~~e~  396 (679)
T 4e6h_A          326 ARMTYVYMQAAQHVCFAPEIWFNMANYQGEKNTDSTVITKYLKLGQQC-IP--------NSAVLAFSLSEQYELNTKIPE  396 (679)
T ss_dssp             HHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHSCCTTHHHHHHHHHHHH-CT--------TCHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHHHHHHHHHHHcCCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHh-CC--------CCHHHHHHHHHHHHHhCCHHH
Confidence            34567788999999999999999999999999988896 999999998 88        567899999999999999998


Q ss_pred             H--HHHHHhCChH----------------------HHHHHHHhccCCCCchhhHHHHHHcCCHHHHHHHHHHHHhc-cC-
Q 039282          256 E--ALRKEFGDWV----------------------LIEDAIVGKGKAPKDKAYIHFEKSQGERERRRALYERLVER-TK-  309 (476)
Q Consensus       256 A--~~ek~~g~~~----------------------~~~~~i~~~~~~p~~~~~~~~~~~~g~~e~Ar~l~e~~l~~-~~-  309 (476)
                      |  .|++......                      .+..+..         .|++|+.+.|+.+.||.+|.++++. .+ 
T Consensus       397 aR~iyek~l~~l~~~~~~~~~~~p~~~~~~~~~~~~~~~vWi---------~y~~~erR~~~l~~AR~vf~~A~~~~~~~  467 (679)
T 4e6h_A          397 IETTILSCIDRIHLDLAALMEDDPTNESAINQLKSKLTYVYC---------VYMNTMKRIQGLAASRKIFGKCRRLKKLV  467 (679)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHSTTCHHHHHHHHHHHHHHHH---------HHHHHHHHHHCHHHHHHHHHHHHHTGGGS
T ss_pred             HHHHHHHHHHHHHHHhhhhhhccCcchhhhhhhccchHHHHH---------HHHHHHHHcCCHHHHHHHHHHHHHhcCCC
Confidence            8  5665543210                      1111222         7889999999999999999999988 43 


Q ss_pred             CHHHHHHHHHHHhhcCCCCCCCCCCchhHHHHhhHhhHHhhhhhhhHHhHHHHhh----------hhc-------cCchh
Q 039282          310 HLKVWISYAKFEASALSKDGGNPDLSEADLCERKKQSIRGARRSHRKIYHQFATC----------LIS-------SLSSS  372 (476)
Q Consensus       310 ~~~vw~~~a~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~~----------~~~-------~~~~r  372 (476)
                      ...+|+.++.+|...+                   ++++.|    |+||+++++.          |++       .++||
T Consensus       468 ~~~lyi~~A~lE~~~~-------------------~d~e~A----r~ife~~Lk~~p~~~~~w~~y~~fe~~~~~~~~AR  524 (679)
T 4e6h_A          468 TPDIYLENAYIEYHIS-------------------KDTKTA----CKVLELGLKYFATDGEYINKYLDFLIYVNEESQVK  524 (679)
T ss_dssp             CTHHHHHHHHHHHTTT-------------------SCCHHH----HHHHHHHHHHHTTCHHHHHHHHHHHHHHTCHHHHH
T ss_pred             ChHHHHHHHHHHHHhC-------------------CCHHHH----HHHHHHHHHHCCCchHHHHHHHHHHHhCCCHHHHH
Confidence            6899999999998772                   346778    8888888862          111       68999


Q ss_pred             HHHHHHHHHhhhcCCCChHHHHHHHHHHHHHHHhcCCHhhHHHHHhhCCh
Q 039282          373 GVFEKGINYYKTSAPEMMEERVMLLEEWLNMERSFGELGDVNLVQAMLPK  422 (476)
Q Consensus       373 ~ifera~~~~~~~~~~~~~~r~~l~~~~~~fE~~~G~~~~~~~v~~~~p~  422 (476)
                      .+|+||+...++.     +.+..||..|+.||..+|+.+++.+|.+|+..
T Consensus       525 ~lferal~~~~~~-----~~~~~lw~~~~~fE~~~G~~~~~~~v~~R~~~  569 (679)
T 4e6h_A          525 SLFESSIDKISDS-----HLLKMIFQKVIFFESKVGSLNSVRTLEKRFFE  569 (679)
T ss_dssp             HHHHHHTTTSSST-----THHHHHHHHHHHHHHHTCCSHHHHHHHHHHHH
T ss_pred             HHHHHHHHhcCCH-----HHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            9999999877631     34589999999999999999999999998654
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 476
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 1e-19
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 1e-14
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 5e-13
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 2e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-04
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 87.0 bits (214), Expect = 1e-19
 Identities = 43/286 (15%), Positives = 92/286 (32%), Gaps = 38/286 (13%)

Query: 61  VWINYAKWEGSQNE--------FDRARSMWELALEEDCRNHTLWCKYAEFE--------- 103
           +W  Y +WE S             R    +E  L     +  +W + A++          
Sbjct: 10  MWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAE 69

Query: 104 -----MINKFINHARNVWDRAVAVL-PHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWT 157
                    F + A N+++RA++ L      L++ Y   EE          I++R +   
Sbjct: 70  KGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAIE 129

Query: 158 PDQ--QAWLSYIKFELRYEQVELARQVFERLVQCHPNVVSSWIKYAKFEMRR-GEIDRAR 214
                  ++ Y+KF  R E ++  R +F++  +        ++  A  E     +   A 
Sbjct: 130 DIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRHHVYVTAALMEYYCSKDKSVAF 189

Query: 215 NVYERALEKKLADGDGDDDEGAEQLFVAFAEFEERYKESESEALRKEFGDWVLIEDAIVG 274
            ++E  L+K     +           +A+ ++     E  +  +  E             
Sbjct: 190 KIFELGLKKYGDIPE---------YVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPP--- 237

Query: 275 KGKAPKDKAYIHFEKSQGERERRRALYERLVERTKHLKVWISYAKF 320
           +        ++ FE + G+      + +R     +        A  
Sbjct: 238 EKSGEIWARFLAFESNIGDLASILKVEKRRFTAFREEYEGKETALL 283
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query476
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.96
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.95
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.87
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.79
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.77
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.7
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.69
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.66
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.65
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.54
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.43
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.38
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.33
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.28
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.26
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.25
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.24
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.21
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.11
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.1
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.09
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.08
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.06
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.05
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.05
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.01
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.0
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.98
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.97
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.94
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.88
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.87
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.82
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.75
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.71
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.57
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.52
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.49
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.33
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.33
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.19
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.08
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.08
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.83
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.16
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.99
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.25
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 93.4
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 83.63
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.96  E-value=7.5e-27  Score=224.77  Aligned_cols=237  Identities=19%  Similarity=0.366  Sum_probs=211.4

Q ss_pred             CHHHHHHHHHHHHhCC--------CHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHcC--------------CHHHHHHH
Q 039282           58 DTAVWINYAKWEGSQN--------EFDRARSMWELALEEDCRNHTLWCKYAEFEMINK--------------FINHARNV  115 (476)
Q Consensus        58 ~~~~w~~~a~~~~~~~--------~~~~A~~~~eral~~~p~~~~lw~~y~~~e~~~~--------------~~~~A~~~  115 (476)
                      ..+.|..|+.++..++        ..++++.+|+|||...|.++.+|+.|+.++...+              .+++|+.+
T Consensus         7 ~~~~W~~yi~~E~~~~~~~~~~~~~~~Rv~~vyerAl~~~~~~~~lW~~y~~~~~~~~~~~~~~~~~~~~~~~~~~a~~i   86 (308)
T d2onda1           7 QVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANI   86 (308)
T ss_dssp             HHHHHHHHHHHHHTCTTCCCCHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHTSCCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhCcccccccchhHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHcCchHHHHHHHhhcccchHHHHHH
Confidence            4689999999998764        3678999999999999999999999999876543              35899999


Q ss_pred             HHHHHHh-CCCcHHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCH--HHHHHHHHHHHHhhhHHHHHHHHHHHHHhCCC
Q 039282          116 WDRAVAV-LPHVDQLWYKYIRMEEIAGNVAAARLIFDRWMHWTPDQ--QAWLSYIKFELRYEQVELARQVFERLVQCHPN  192 (476)
Q Consensus       116 ~~ral~~-~p~~~~lw~~~~~~~~~~g~~~~A~~~~eral~~~P~~--~~w~~~~~~~~~~g~~~~A~~~~~r~l~~~p~  192 (476)
                      |++|+.. .|.+..+|..|+.++...|+++.|+.+|++++...|.+  .+|..|+.++.+.|+++.|+.+|++++..+|.
T Consensus        87 ~~ral~~~~p~~~~l~~~ya~~~~~~~~~~~a~~i~~~~l~~~~~~~~~~w~~~~~~~~~~~~~~~ar~i~~~al~~~~~  166 (308)
T d2onda1          87 YERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDART  166 (308)
T ss_dssp             HHHHHTTTTTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHTSSSSCTHHHHHHHHHHHHHHHCHHHHHHHHHHHHTSTTC
T ss_pred             HHHHHHHcCCCCHHHHHHHHHHHHhcccHHHHHHHHHHHHHHhcCChHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCC
Confidence            9999975 78899999999999999999999999999999999864  68999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHH-cCCHHHHHHHHHHHHHhhcCCCCCCChhhHHHHHHHHHHHHHHccchhHHHHHHHhCChHHHHHH
Q 039282          193 VVSSWIKYAKFEMR-RGEIDRARNVYERALEKKLADGDGDDDEGAEQLFVAFAEFEERYKESESEALRKEFGDWVLIEDA  271 (476)
Q Consensus       193 ~~~~w~~~a~~~~~-~g~~~~A~~~~e~al~~~~p~~~~~~~~~~~~l~~~~a~~e~~~~~~e~A~~ek~~g~~~~~~~~  271 (476)
                      +...|..++.++.. .|+.+.|+.+|++++.. +|        ....+|..|+.+                         
T Consensus       167 ~~~~~~~~a~~e~~~~~~~~~a~~i~e~~l~~-~p--------~~~~~w~~y~~~-------------------------  212 (308)
T d2onda1         167 RHHVYVTAALMEYYCSKDKSVAFKIFELGLKK-YG--------DIPEYVLAYIDY-------------------------  212 (308)
T ss_dssp             CTHHHHHHHHHHHHTSCCHHHHHHHHHHHHHH-HT--------TCHHHHHHHHHH-------------------------
T ss_pred             cHHHHHHHHHHHHHhccCHHHHHHHHHHHHHh-hh--------hhHHHHHHHHHH-------------------------
Confidence            99999999988765 58999999999999999 88        567788777654                         


Q ss_pred             HHhccCCCCchhhHHHHHHcCCHHHHHHHHHHHHhccC-C----HHHHHHHHHHHhhcCCCCCCCCCCchhHHHHhhHhh
Q 039282          272 IVGKGKAPKDKAYIHFEKSQGERERRRALYERLVERTK-H----LKVWISYAKFEASALSKDGGNPDLSEADLCERKKQS  346 (476)
Q Consensus       272 i~~~~~~p~~~~~~~~~~~~g~~e~Ar~l~e~~l~~~~-~----~~vw~~~a~~e~~~~~~~~~~~~~~~~~~~~~~~~~  346 (476)
                                      +...|++++||.+|++++...| +    ..+|..|+.||..+                    |+
T Consensus       213 ----------------~~~~g~~~~aR~~fe~ai~~~~~~~~~~~~iw~~~~~fE~~~--------------------G~  256 (308)
T d2onda1         213 ----------------LSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNI--------------------GD  256 (308)
T ss_dssp             ----------------HHTTCCHHHHHHHHHHHHHSSSSCGGGCHHHHHHHHHHHHHH--------------------SC
T ss_pred             ----------------HHHcCChHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHHc--------------------CC
Confidence                            3467899999999999999876 3    45999999999999                    89


Q ss_pred             HHhhhhhhhHHhHHHHhhhhccCchhHHHHHHHHHhhhc
Q 039282          347 IRGARRSHRKIYHQFATCLISSLSSSGVFEKGINYYKTS  385 (476)
Q Consensus       347 ~~~A~~~~~~~~~~~~~~~~~~~~~r~ifera~~~~~~~  385 (476)
                      ++.+                     +.+++|+.+.++..
T Consensus       257 ~~~~---------------------~~~~~r~~~~~~~~  274 (308)
T d2onda1         257 LASI---------------------LKVEKRRFTAFREE  274 (308)
T ss_dssp             HHHH---------------------HHHHHHHHHHTTTT
T ss_pred             HHHH---------------------HHHHHHHHHHCccc
Confidence            9999                     99999999999865
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure