Citrus Sinensis ID: 039292

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520

MKREYAEISEISDEEWEPHSESFKPSRVLKINTRSPKPKPKPKPKPPPPIESFAYNKDENLEDDDVEEVVGPTAATNNRGRRFIVDDDEEEEEEEGEEEQEQEHGDFVEALQKCAKISAELKRELYGTTTSAACDRYAEVEASSVRIVTQSDIDDACGDEDSDFQPVLKPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHLNNDPGPHLIVCPASVLENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYSLFERHSVQQKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHELWSLLEFMMPDLFATEDVDLKKLLNGEDRDLIGRMKSILGPFILRRLKSDVMQQLVPKIQWVEYVTMERPQEDAYRVAIEEYRAVSRARIAKLSDADLATIVGVLPQRQISNYFVQFRKIANHPLLVRRIYSDDDVVRFAKKLHPMGAFGFECTLERVIEELKNYSDFSIHQ

cccccHHccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHcccccccEEEEEccccEEEcccccHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHHHHHcHHHHHccHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHccccccccc

ccccHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHccccccHHHHccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccEcccccccHcccccHHHHHHHHHHHHHHHHcccccEEEEHHcccHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccccEEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHEHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEcccccHccHHHHHHHHHHHccHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHcHHHHHHHHHHHHHHHHcccccccc

MKREYAEIseisdeewephsesfkpsrvlkintrspkpkpkpkpkppppiesfaynkdenledddveevvgptaatnnrgrrfivdddeeeeeeegeeeqeQEHGDFVEALQKCAKISAELKRELYGTTTSAACDRYAEVEASSVRIvtqsdiddacgdedsdfqpvlkpyqlvGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHlnndpgphlivcpasvLENWERELKKWcpsfsvlqyhgagrTAYSRELSSLakaglpppfNVLLVCYSLFerhsvqqkddRKILKRWRWSCVLMDEAhalkdknsyRWKNLMSVARNANQRLMLTGTPLQNDLHELWSLLEfmmpdlfatedVDLKKLLNGEDRDLIGRMKSILGPFILRRLKSDVMQQLVPKIQWVEYvtmerpqedAYRVAIEEYRAVSRARIAKLSDADLATIVGVLPQRQISNYFVQFRKIanhpllvrriysDDDVVRFAKklhpmgafgfECTLERVIEELKnysdfsihq

MKREYAEIseisdeewephsesfkpsrvlkintrspkpkpkpkpkppppiESFAYNKDENLEDDDVeevvgptaatnnrgrrfivDDDEEEEEEegeeeqeqehgdFVEALQKCAKISAELKRELYGTTTSAACDRYAEVEASSVRIVTQSDIDDACGDEDSDFQPVLKPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHLNNDPGPHLIVCPASVLENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYSLFErhsvqqkddrkiLKRWRWSCVLMDEahalkdknsyrWKNLMSVARNANQRLMLTGTPLQNDLHELWSLLEFMMPDLFATEDVDLKKLLngedrdligrMKSILGPFILRRLKSDVMQQLVPKIqwveyvtmerpqedaYRVAIEEYRAVSRARIAKLSDADLATIVGVLPQRQISNYFVQFRKIANHPLLVRRIYSDDDVVRFAKKLHPMGAFGFECTLERVIEELknysdfsihq

MKREYAEISEISDEEWEPHSESFKPSRVLKINTRSpkpkpkpkpkppppIESFAYNKDENLedddveevvGPTAATNNRGRRFIVDDDeeeeeeegeeeqeqeHGDFVEALQKCAKISAELKRELYGTTTSAACDRYAEVEASSVRIVTQSDIDDACGDEDSDFQPVLKPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHLNNDPGPHLIVCPASVLENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYSLFERHSVQQKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHELWSLLEFMMPDLFATEDVDLKKLLNGEDRDLIGRMKSILGPFILRRLKSDVMQQLVPKIQWVEYVTMERPQEDAYRVAIEEYRAVSRARIAKLSDADLATIVGVLPQRQISNYFVQFRKIANHPLLVRRIYSDDDVVRFAKKLHPMGAFGFECTLERVIEELKNYSDFSIHQ

**********************************************************************************************************FVEALQKCAKISAELKRELYGTTTSAACDRYAEVEASSVRIV******************VLKPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHLNNDPGPHLIVCPASVLENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYSLFERHSVQQKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHELWSLLEFMMPDLFATEDVDLKKLLNGEDRDLIGRMKSILGPFILRRLKSDVMQQLVPKIQWVEYVTMERPQEDAYRVAIEEYRAVSRARIAKLSDADLATIVGVLPQRQISNYFVQFRKIANHPLLVRRIYSDDDVVRFAKKLHPMGAFGFECTLERVIEELKNYS******

******************************************************************************************************************************************************************DFQPVLKPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHLNNDPGPHLIVCPASVLENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYSLFERHSVQQKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHELWSLLEFMMPDLFATEDVDLKKLLNGEDRDLIGRMKSILGPFILRRLKSDVMQQLVPKIQWVEYVTMERPQEDAYRVAIEEY**************************QISNYFVQFRKIANHPLLVRRIYSDDDVVRFAKKLHPMGAFGFECTLERVIEELKNYSDFSIHQ

************************PSRVLKINTR************PPPIESFAYNKDENLEDDDVEEVVGPTAATNNRGRRFIVDD******************DFVEALQKCAKISAELKRELYGTTTSAACDRYAEVEASSVRIVTQSDIDDACGDEDSDFQPVLKPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHLNNDPGPHLIVCPASVLENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYSLFERHSVQQKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHELWSLLEFMMPDLFATEDVDLKKLLNGEDRDLIGRMKSILGPFILRRLKSDVMQQLVPKIQWVEYVTMERPQEDAYRVAIEEYRAVSRARIAKLSDADLATIVGVLPQRQISNYFVQFRKIANHPLLVRRIYSDDDVVRFAKKLHPMGAFGFECTLERVIEELKNYSDFSIHQ

****YAEISEISDEEWEPHSESFKPSRVL***********************************D*EEVV*PTAATNNRGRRFIVDDDEEEEEEEGEEEQEQEHGDFVEALQKCAKISAE*************************R*VTQSDIDDACGDEDSDFQPVLKPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHLNNDPGPHLIVCPASVLENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYSLFERHSVQQKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHELWSLLEFMMPDLFATEDVDLKKLLNGEDRDLIGRMKSILGPFILRRLKSDVMQQLVPKIQWVEYVTMERPQEDAYRVAIEEYRAVSRAR****************PQRQISNYFVQFRKIANHPLLVRRIYSDDDVVRFAKKLHPMGAFGFECTLERVIEELKNYS******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		520	2.2.26 [Sep-21-2011]
E7F1C4		954	SWI/SNF-related matrix-as	yes	no	0.619	0.337	0.375	6e-61
Q5FWR0		1003	SWI/SNF-related matrix-as	yes	no	0.690	0.357	0.336	2e-59
Q9H4L7		1026	SWI/SNF-related matrix-as	yes	no	0.613	0.310	0.361	4e-58
E1B7X9		1028	SWI/SNF-related matrix-as	yes	no	0.609	0.308	0.362	1e-57
B0R061		972	SWI/SNF-related matrix-as	no	no	0.615	0.329	0.363	3e-57
D3Z9Z9		1024	SWI/SNF-related matrix-as	yes	no	0.613	0.311	0.355	1e-56
Q04692		1021	SWI/SNF-related matrix-as	yes	no	0.625	0.318	0.356	4e-56
Q9VL72		844	SWI/SNF-related matrix-as	no	no	0.632	0.389	0.381	5e-56
O74842		1284	ATP-dependent helicase ff	yes	no	0.65	0.263	0.375	8e-54
P87114		944	ATP-dependent helicase ff	no	no	0.609	0.335	0.361	1e-52

>sp\|E7F1C4\|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1	Back alignment and function desciption

 Score =  235 bits (599), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 140/373 (37%), Positives = 212/373 (56%), Gaps = 51/373 (13%)

Query: 162 SDFQPVLKPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHLNNDPGPH 221
           S FQ  LKPYQL+G+N+L+LL++  ++G ILADEMGLGKTIQAI++L  L    N  GPH
Sbjct: 425 STFQ--LKPYQLIGLNWLVLLHQNKLSG-ILADEMGLGKTIQAISFLAHLYQEGNH-GPH 480

Query: 222 LIVCPASVLENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYS 281
           LI  PAS L+NW REL  WCPSF VL Y+G+   A  R+            +N+++  Y+
Sbjct: 481 LITVPASTLDNWVRELNLWCPSFKVLVYYGS---ADDRKYMRYEILNQIVEYNIIVSTYN 537

Query: 282 LFERHSVQQKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTP 341
           L    ++    DR +  + +    + DE H LK+ NS R+++LM++  NA  RL+LTGTP
Sbjct: 538 L----AIGNSSDRSLFCKLKLEYAVFDEGHLLKNMNSLRYRHLMAI--NAKYRLLLTGTP 591

Query: 342 LQNDLHELWSLLEFMMPDLFATEDVDLKKLLNGE--------DRDLIGRMKSILGPFILR 393
           LQN+L EL SLL F+MP++F++    + K+ + +        +RD I   K I+ PFILR
Sbjct: 592 LQNNLLELMSLLNFIMPNMFSSSTSQIAKMFSMKSSEEQSSFERDRITHAKLIMKPFILR 651

Query: 394 RLKSDVMQQLVPKIQWVEYVTMERPQEDAYRVAIEEYRAVSRARIAKLSDADLATIVGVL 453
           R+KS+V++QL  K + VE+  M   Q++ Y   + + +  S                   
Sbjct: 652 RVKSEVLKQLPAKEEQVEFCAMSERQQELYSALLHKLKHSSNGE---------------- 695

Query: 454 PQRQISNYFVQFRKIANHPLLVRRIYSDDDVVRFAKKLHPMGAFGFECTLER------VI 507
            +R+++N  +Q RK++NHPLL R+ Y+        +KL  M     +    R      + 
Sbjct: 696 -KRELTNVMMQLRKMSNHPLLHRQFYT-------TEKLKAMSKLMLKEPSHRDADPALIK 747

Query: 508 EELKNYSDFSIHQ 520
           E+++  SDF +H+
Sbjct: 748 EDMEVLSDFELHR 760

DNA helicase that possesses intrinsic ATP-dependent nucleosome-remodeling activity and is both required for DNA repair and heterochromatin organization. Promotes DNA end resection of double-strand breaks (DSBs) following DNA damage: probably acts by weakening histone DNA interactions in nucleosomes flanking DSBs. Required for the restoration of heterochromatin organization after replication.
Danio rerio (taxid: 7955)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2

>sp\|Q5FWR0\|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1	Back alignment and function description

>sp\|Q9H4L7\|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2	Back alignment and function description

>sp\|E1B7X9\|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2	Back alignment and function description

>sp\|B0R061\|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=2 SV=1	Back alignment and function description

>sp\|D3Z9Z9\|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=3 SV=1	Back alignment and function description

>sp\|Q04692\|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2	Back alignment and function description

>sp\|Q9VL72\|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1	Back alignment and function description

>sp\|O74842\|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1	Back alignment and function description

>sp\|P87114\|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		520
359473688		728	PREDICTED: helicase SWR1-like [Vitis vin	0.959	0.685	0.725	0.0
224108163		752	chromatin remodeling complex subunit [Po	0.986	0.682	0.728	0.0
229914880		768	SWI/SNF helicase-like protein [Eutrema h	0.984	0.666	0.683	0.0
356577572		752	PREDICTED: helicase SWR1-like [Glycine m	0.969	0.670	0.704	0.0
297814462		764	CHR19/ETL1 [Arabidopsis lyrata subsp. ly	0.984	0.670	0.677	0.0
449445276		741	PREDICTED: SWI/SNF-related matrix-associ	0.971	0.681	0.695	0.0
15226870		763	SNF2 and helicase domain-containing prot	0.984	0.671	0.670	0.0
312190395		763	unknown [Eutrema parvulum]	0.984	0.671	0.669	0.0
356521080		754	PREDICTED: helicase swr1-like [Glycine m	0.967	0.667	0.695	0.0
38344264		863	OSJNBa0005N02.1 [Oryza sativa Japonica G	0.836	0.504	0.725	0.0

>gi\|359473688\|ref\|XP_003631348.1\| PREDICTED: helicase SWR1-like [Vitis vinifera] gi\|297738311\|emb\|CBI27512.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/551 (72%), Positives = 448/551 (81%), Gaps = 52/551 (9%)

Query: 1   MKREYAEISEISDEEWEPHSESFKPSRVLKINTRSPKPKPKPKPKPPPPIESFAYNKD-- 58
           MKR++   +EISD+EW+ HS  FK SR LK                PPPIESF+Y  +  
Sbjct: 1   MKRDF---TEISDDEWDNHS--FKLSRALK-----------KSQGAPPPIESFSYRPEDP 44

Query: 59  -------------------ENLEDDDVEEVVGPTAATNNRGRRFIVDDDEEEEEEEGEEE 99
                              E+LEDDD E +  P +    RGRRF+VD+D +E+  E  E 
Sbjct: 45  QVSPEDVSDGSSDDCVEIKEDLEDDDAEVLAAPVS----RGRRFVVDEDSDEDFAEVVEV 100

Query: 100 QEQEHGDFV----------EALQKCAKISAELKRELYGTTTSAACDRYAEVEASSVRIVT 149
           +     +            +ALQKCAKISAEL+RELYG++ +A CDRYAEVE+SSVRIVT
Sbjct: 101 KSGTEEEAEEEVEEDDVVGKALQKCAKISAELRRELYGSSVTA-CDRYAEVESSSVRIVT 159

Query: 150 QSDIDDACGDEDSDFQPVLKPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLM 209
           Q DID ACG EDSDFQPVLKPYQLVGVNFLLLLYRKGI GAILADEMGLGKTIQAITYL 
Sbjct: 160 QDDIDVACGAEDSDFQPVLKPYQLVGVNFLLLLYRKGIGGAILADEMGLGKTIQAITYLT 219

Query: 210 LLKHLNNDPGPHLIVCPASVLENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGL 269
           LLKH++NDPGPHL+VCPASVLENWERELKKWCPSF+V+QYHGAGRT YS+EL+SL+KAGL
Sbjct: 220 LLKHMDNDPGPHLVVCPASVLENWERELKKWCPSFTVIQYHGAGRTHYSKELNSLSKAGL 279

Query: 270 PPPFNVLLVCYSLFERHSVQQKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMSVAR 329
           PPPFNVLLVCYSLFERHS QQKDDRK+LKRW+WSCVLMDEAHALKDKNSYRWKNLMSVAR
Sbjct: 280 PPPFNVLLVCYSLFERHSQQQKDDRKLLKRWQWSCVLMDEAHALKDKNSYRWKNLMSVAR 339

Query: 330 NANQRLMLTGTPLQNDLHELWSLLEFMMPDLFATEDVDLKKLLNGEDRDLIGRMKSILGP 389
           NANQRLMLTGTPLQNDLHELWSLLEFMMPDLF T DVDLKKLLN EDRDLI RMKSILGP
Sbjct: 340 NANQRLMLTGTPLQNDLHELWSLLEFMMPDLFTTGDVDLKKLLNAEDRDLIARMKSILGP 399

Query: 390 FILRRLKSDVMQQLVPKIQWVEYVTMERPQEDAYRVAIEEYRAVSRARIAKLSDADLATI 449
           FILRRLKSDVMQQLVPKIQ VEYV ME+ QEDAY+ AIEEYRA SRARIAK+SD +  ++
Sbjct: 400 FILRRLKSDVMQQLVPKIQRVEYVYMEKNQEDAYKEAIEEYRAASRARIAKISDVNRNSV 459

Query: 450 VGVLPQRQISNYFVQFRKIANHPLLVRRIYSDDDVVRFAKKLHPMGAFGFECTLERVIEE 509
           V VLP+RQISNYFVQFRKIANHPLLVRRIY+D+D+VRFAK+L+PMG FGFEC L+RVIEE
Sbjct: 460 VRVLPRRQISNYFVQFRKIANHPLLVRRIYNDEDIVRFAKRLYPMGVFGFECNLDRVIEE 519

Query: 510 LKNYSDFSIHQ 520
           LK+Y+DFSIH+
Sbjct: 520 LKSYNDFSIHR 530

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224108163\|ref\|XP_002314744.1\| chromatin remodeling complex subunit [Populus trichocarpa] gi\|222863784\|gb\|EEF00915.1\| chromatin remodeling complex subunit [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|229914880\|gb\|ACQ90605.1\| SWI/SNF helicase-like protein [Eutrema halophilum]	Back alignment and taxonomy information

>gi\|356577572\|ref\|XP_003556898.1\| PREDICTED: helicase SWR1-like [Glycine max]	Back alignment and taxonomy information

>gi\|297814462\|ref\|XP_002875114.1\| CHR19/ETL1 [Arabidopsis lyrata subsp. lyrata] gi\|297320952\|gb\|EFH51373.1\| CHR19/ETL1 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|449445276\|ref\|XP_004140399.1\| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B-like [Cucumis sativus] gi\|449487891\|ref\|XP_004157852.1\| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|15226870|ref|NP_178318.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] gi|4038042|gb|AAC97224.1| putative helicase [Arabidopsis thaliana] gi|16648975|gb|AAL24339.1| SNF2/RAD54 family (ETL1 subfamily) protein [Arabidopsis thaliana] gi|27311941|gb|AAO00936.1| SNF2/RAD54 family (ETL1 subfamily) protein [Arabidopsis thaliana] gi|330250451|gb|AEC05545.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|312190395\|gb\|ADQ43195.1\| unknown [Eutrema parvulum]	Back alignment and taxonomy information

>gi\|356521080\|ref\|XP_003529186.1\| PREDICTED: helicase swr1-like [Glycine max]	Back alignment and taxonomy information

>gi\|38344264\|emb\|CAE02069.2\| OSJNBa0005N02.1 [Oryza sativa Japonica Group] gi\|38345412\|emb\|CAE03103.2\| OSJNBa0017B10.18 [Oryza sativa Japonica Group] gi\|116309716\|emb\|CAH66762.1\| OSIGBa0158F05.11 [Oryza sativa Indica Group]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		520
TAIR\|locus:2051678		763	ETL1 [Arabidopsis thaliana (ta	0.790	0.538	0.825	3.2e-194
DICTYBASE\|DDB_G0267556		1159	DDB_G0267556 "CHR group protei	0.501	0.225	0.464	1e-62
UNIPROTKB\|Q5FWR0		1003	smarcad1 "SWI/SNF-related matr	0.682	0.353	0.345	3.1e-57
UNIPROTKB\|F1NAD2		963	SMARCAD1 "Uncharacterized prot	0.626	0.338	0.353	5.3e-53
UNIPROTKB\|Q9H4L7		1026	SMARCAD1 "SWI/SNF-related matr	0.625	0.316	0.353	1.3e-52
UNIPROTKB\|E2RG62		1026	SMARCAD1 "Uncharacterized prot	0.625	0.316	0.356	8.7e-52
UNIPROTKB\|J9NX47		1026	SMARCAD1 "Uncharacterized prot	0.625	0.316	0.356	8.7e-52
UNIPROTKB\|J9PA79		1026	SMARCAD1 "Uncharacterized prot	0.625	0.316	0.356	8.7e-52
UNIPROTKB\|F1RWW3		1029	SMARCAD1 "Uncharacterized prot	0.625	0.315	0.356	1.5e-51
FB\|FBgn0032157		844	Etl1 "Etl1 homologue" [Drosoph	0.630	0.388	0.383	1.9e-51

TAIR\|locus:2051678 ETL1 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1806 (640.8 bits), Expect = 3.2e-194, Sum P(3) = 3.2e-194
 Identities = 340/412 (82%), Positives = 376/412 (91%)

Query:   109 EALQKCAKISAELKRELYGTTTSAACDRYAEVEASSVRIVTQSDIDDACGDEDSDFQPVL 168
             +ALQKCAKISA+L++ELYGT+ S   DRY+EVE S+VRIVTQ+DIDDAC  EDSDFQP+L
Sbjct:   155 KALQKCAKISADLRKELYGTS-SGVTDRYSEVETSTVRIVTQNDIDDACKAEDSDFQPIL 213

Query:   169 KPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHLNNDPGPHLIVCPAS 228
             KPYQLVGVNFLLLLY+KGI GAILADEMGLGKTIQAITYL LL  LNNDPGPHL+VCPAS
Sbjct:   214 KPYQLVGVNFLLLLYKKGIEGAILADEMGLGKTIQAITYLTLLSRLNNDPGPHLVVCPAS 273

Query:   229 VLENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYSLFERHSV 288
             VLENWEREL+KWCPSF+VLQYHGA R AYSREL+SL+KAG PPPFNVLLVCYSLFERHS 
Sbjct:   274 VLENWERELRKWCPSFTVLQYHGAARAAYSRELNSLSKAGKPPPFNVLLVCYSLFERHSE 333

Query:   289 QQKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHE 348
             QQKDDRK+LKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHE
Sbjct:   334 QQKDDRKVLKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHE 393

Query:   349 LWSLLEFMMPDLFATEDVDLKKLLNGEDRDLIGRMKSILGPFILRRLKSDVMQQLVPKIQ 408
             LWSLLEFM+PD+F TE+VDLKKLLN ED +LI RMKSILGPFILRRLKSDVMQQLVPKIQ
Sbjct:   394 LWSLLEFMLPDIFTTENVDLKKLLNAEDTELITRMKSILGPFILRRLKSDVMQQLVPKIQ 453

Query:   409 WVEYVTMERPQEDAYRVAIEEYRAVSRARIAKLSDADLATIVGVLPQRQISNYFVQFRKI 468
              VEYV MER QEDAY+ AIEEYRA S+AR+ KLS   L ++   LP+RQISNYF QFRKI
Sbjct:   454 RVEYVLMERKQEDAYKEAIEEYRAASQARLVKLSSKSLNSLAKALPKRQISNYFTQFRKI 513

Query:   469 ANHPLLVRRIYSDDDVVRFAKKLHPMGAFGFECTLERVIEELKNYSDFSIHQ 520
             ANHPLL+RRIYSD+DV+R A+KLHP+GAFGFEC+L+RVIEE+K ++DF IHQ
Sbjct:   514 ANHPLLIRRIYSDEDVIRIARKLHPIGAFGFECSLDRVIEEVKGFNDFRIHQ 565

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0003677 "DNA binding" evidence=IEA;ISS

GO:0004386 "helicase activity" evidence=IEA;ISS

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM

DICTYBASE\|DDB_G0267556 DDB_G0267556 "CHR group protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5FWR0 smarcad1 "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NAD2 SMARCAD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9H4L7 SMARCAD1 "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RG62 SMARCAD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|J9NX47 SMARCAD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|J9PA79 SMARCAD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RWW3 SMARCAD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

FB\|FBgn0032157 Etl1 "Etl1 homologue" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4.12	LOW CONFIDENCE prediction!
3rd Layer	3.6.4	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	CHR922	chromatin remodeling complex subunit (752 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	eugene3.00160277	hypothetical protein (97 aa)	•	0.501

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		520
pfam00176		301	pfam00176, SNF2_N, SNF2 family N-terminal domain	1e-72
PLN03142		1033	PLN03142, PLN03142, Probable chromatin-remodeling	5e-52
COG0553		866	COG0553, HepA, Superfamily II DNA/RNA helicases, S	1e-51
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	2e-28
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	1e-17

>gnl\|CDD\|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain	Back alignment and domain information

 Score =  232 bits (594), Expect = 1e-72
 Identities = 115/320 (35%), Positives = 158/320 (49%), Gaps = 34/320 (10%)

Query: 171 YQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLM-LLKHLNNDPGPHLIVCPASV 229
           YQL GVN+L+ L   G+ G ILADEMGLGKT+Q I  L   LK   +  GP L+VCP S 
Sbjct: 1   YQLEGVNWLISLESNGLGG-ILADEMGLGKTLQTIALLATYLKEGKDRRGPTLVVCPLST 59

Query: 230 LENWERELKKWCPSFSVLQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYSLFERHSVQ 289
           L NW  E +KW P+  V+ YHG GR    R     + A     ++V++  Y +  +    
Sbjct: 60  LHNWLNEFEKWAPALRVVVYHGDGR---ERSKLRQSMAKRLDTYDVVITTYEVLRK---- 112

Query: 290 QKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNANQRLMLTGTPLQNDLHEL 349
            K    +L +  W  V++DEAH LK+  S  +K L  +      RL+LTGTP+QN+L EL
Sbjct: 113 DKKLLSLLNKVEWDRVVLDEAHRLKNSKSKLYKALKKL--KTRNRLLLTGTPIQNNLEEL 170

Query: 350 WSLLEFMMPDLFATEDV------------DLKKLLNGEDRDL-IGRMKSILGPFILRRLK 396
           W+LL F+ P  F +  V               K  N E     I R+  +L PF+LRR K
Sbjct: 171 WALLNFLRPGPFGSFKVFEEWFNIPIANTADNKNKNLEKGKEGINRLHKLLKPFLLRRTK 230

Query: 397 SDVMQQLVPKIQWVEYVTMERPQEDAYR-VAIEEYRAVSRARIAKLSDADLATIVGVLPQ 455
            DV + L PK + V Y  +   Q   Y+ +  +   A+S A      +  +         
Sbjct: 231 DDVEKSLPPKTEHVLYCNLSDEQRKLYKKLLTKRRLALSFAVEGGEKNVGI--------- 281

Query: 456 RQISNYFVQFRKIANHPLLV 475
             + N  +Q RKI NHP L 
Sbjct: 282 ASLLNLIMQLRKICNHPYLF 301

This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g. ERCC6, RAD16, RAD5), DNA recombination (e.g. RAD54), and chromatin unwinding (e.g. ISWI) as well as a variety of other proteins with little functional information (e.g. lodestar, ETL1). Length = 301

>gnl\|CDD\|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>gnl\|CDD\|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		520
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	100.0
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	100.0
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	100.0
KOG0387		923	consensus Transcription-coupled repair protein CSB	100.0
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	100.0
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	100.0
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	100.0
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	100.0
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	100.0
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	100.0
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	100.0
KOG1002		791	consensus Nucleotide excision repair protein RAD16	100.0
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	100.0
KOG4439		901	consensus RNA polymerase II transcription terminat	100.0
KOG1016		1387	consensus Predicted DNA helicase, DEAD-box superfa	100.0
KOG0383		696	consensus Predicted helicase [General function pre	100.0
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	100.0
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	100.0
KOG1001		674	consensus Helicase-like transcription factor HLTF/	100.0
PRK04914		956	ATP-dependent helicase HepA; Validated	99.98
KOG0298		1394	consensus DEAD box-containing helicase-like transc	99.94
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.91
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.78
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.75
KOG1123		776	consensus RNA polymerase II transcription initiati	99.72
PRK13766		773	Hef nuclease; Provisional	99.71
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.65
PHA02558		501	uvsW UvsW helicase; Provisional	99.65
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	99.63
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.61
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.58
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.53
COG4096		875	HsdR Type I site-specific restriction-modification	99.5
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.48
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.45
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	99.38
KOG0354		746	consensus DEAD-box like helicase [General function	99.37
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	99.32
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	99.31
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	99.31
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	99.3
PTZ00424		401	helicase 45; Provisional	99.27
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	99.25
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	99.24
PRK02362		737	ski2-like helicase; Provisional	99.23
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	99.23
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	99.22
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	99.22
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	99.21
PRK01172		674	ski2-like helicase; Provisional	99.21
COG4889		1518	Predicted helicase [General function prediction on	99.21
PRK10689		1147	transcription-repair coupling factor; Provisional	99.21
PTZ00110		545	helicase; Provisional	99.2
PRK00254		720	ski2-like helicase; Provisional	99.2
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	99.19
PRK13767		876	ATP-dependent helicase; Provisional	99.19
COG1205		851	Distinct helicase family with a unique C-terminal	99.15
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	99.14
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	99.14
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.14
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	99.13
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	99.1
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	99.1
COG1204		766	Superfamily II helicase [General function predicti	99.09
PRK05580		679	primosome assembly protein PriA; Validated	99.07
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.05
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	99.02
PRK09401		1176	reverse gyrase; Reviewed	99.02
COG1201		814	Lhr Lhr-like helicases [General function predictio	99.02
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	99.02
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	98.98
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	98.96
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	98.92
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	98.9
KOG0343		758	consensus RNA Helicase [RNA processing and modific	98.86
TIGR00595		505	priA primosomal protein N'. All proteins in this f	98.82
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	98.81
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	98.8
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.78
COG0610		962	Type I site-specific restriction-modification syst	98.76
PRK14701		1638	reverse gyrase; Provisional	98.74
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	98.74
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	98.71
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	98.7
PHA02653		675	RNA helicase NPH-II; Provisional	98.68
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	98.67
PRK15483		986	type III restriction-modification system StyLTI en	98.66
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	98.64
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	98.62
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	98.61
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	98.61
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	98.58
PRK09694		878	helicase Cas3; Provisional	98.56
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	98.53
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	98.38
PRK09200		790	preprotein translocase subunit SecA; Reviewed	98.34
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	98.34
KOG0347		731	consensus RNA helicase [RNA processing and modific	98.32
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	98.31
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	98.3
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	98.23
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	98.2
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	98.16
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	98.14
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	98.12
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	98.12
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	98.12
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	98.1
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	98.08
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	98.07
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	98.05
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	98.02
KOG0353		695	consensus ATP-dependent DNA helicase [General func	97.98
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	97.96
KOG1513		1300	consensus Nuclear helicase MOP-3/SNO (DEAD-box sup	97.95
COG1198		730	PriA Primosomal protein N' (replication factor Y)	97.95
COG1202		830	Superfamily II helicase, archaea-specific [General	97.92
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	97.91
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	97.9
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	97.89
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	97.88
PRK12904		830	preprotein translocase subunit SecA; Reviewed	97.84
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	97.79
KOG0334		997	consensus RNA helicase [RNA processing and modific	97.78
PRK12326		764	preprotein translocase subunit SecA; Reviewed	97.77
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	97.73
KOG4284		980	consensus DEAD box protein [Transcription]	97.73
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	97.73
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	97.7
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	97.69
KOG1803		649	consensus DNA helicase [Replication, recombination	97.69
PRK13107		908	preprotein translocase subunit SecA; Reviewed	97.65
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.63
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	97.62
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	97.55
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	97.52
PRK10536		262	hypothetical protein; Provisional	97.52
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	97.52
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	97.51
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	97.51
PRK14873		665	primosome assembly protein PriA; Provisional	97.5
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	97.49
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	97.48
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	97.46
KOG0346		569	consensus RNA helicase [RNA processing and modific	97.4
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	97.39
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	97.37
TIGR00376		637	DNA helicase, putative. The gene product may repre	97.35
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	97.34
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	97.33
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	97.22
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	97.12
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	97.06
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	97.02
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	97.01
COG3587		985	Restriction endonuclease [Defense mechanisms]	97.0
KOG1805		1100	consensus DNA replication helicase [Replication, r	96.93
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	96.92
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	96.91
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	96.9
CHL00122		870	secA preprotein translocase subunit SecA; Validate	96.87
PF11496		297	HDA2-3: Class II histone deacetylase complex subun	96.84
PRK04296		190	thymidine kinase; Provisional	96.81
KOG1131		755	consensus RNA polymerase II transcription initiati	96.81
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	96.74
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	96.7
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	96.68
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	96.67
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	96.66
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	96.63
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	96.62
smart00382		148	AAA ATPases associated with a variety of cellular	96.61
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	96.59
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	96.56
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	96.53
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	96.5
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.48
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	96.44
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	96.38
PRK10875		615	recD exonuclease V subunit alpha; Provisional	96.38
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	96.29
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	96.22
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	96.22
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	96.21
PRK14974		336	cell division protein FtsY; Provisional	96.15
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	96.11
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	96.11
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	96.1
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	96.1
PF13245		76	AAA_19: Part of AAA domain	96.0
PF05876		557	Terminase_GpA: Phage terminase large subunit (GpA)	96.0
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	95.96
PRK09112		351	DNA polymerase III subunit delta'; Validated	95.95
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	95.92
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	95.86
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	95.86
PRK06526		254	transposase; Provisional	95.78
PLN03025		319	replication factor C subunit; Provisional	95.73
PRK07952		244	DNA replication protein DnaC; Validated	95.7
PTZ00112		1164	origin recognition complex 1 protein; Provisional	95.67
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	95.66
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	95.62
PRK05298		652	excinuclease ABC subunit B; Provisional	95.61
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	95.57
PRK05707		328	DNA polymerase III subunit delta'; Validated	95.5
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	95.5
KOG0327		397	consensus Translation initiation factor 4F, helica	95.42
PRK08084		235	DNA replication initiation factor; Provisional	95.35
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	95.32
PRK00771		437	signal recognition particle protein Srp54; Provisi	95.27
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	95.21
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	95.2
CHL00181		287	cbbX CbbX; Provisional	95.2
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	95.17
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	95.08
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	95.07
PRK06893		229	DNA replication initiation factor; Validated	95.04
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	95.03
PRK04195		482	replication factor C large subunit; Provisional	95.02
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	95.01
PRK08181		269	transposase; Validated	95.01
PRK13889		988	conjugal transfer relaxase TraA; Provisional	94.97
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	94.97
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	94.97
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	94.96
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	94.93
PRK12402		337	replication factor C small subunit 2; Reviewed	94.92
PRK14088		440	dnaA chromosomal replication initiation protein; P	94.91
PRK14087		450	dnaA chromosomal replication initiation protein; P	94.91
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	94.82
PHA02533		534	17 large terminase protein; Provisional	94.78
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	94.77
cd03115		173	SRP The signal recognition particle (SRP) mediates	94.76
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	94.7
PRK00149		450	dnaA chromosomal replication initiation protein; R	94.68
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	94.57
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	94.54
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	94.49
PRK07940		394	DNA polymerase III subunit delta'; Validated	94.47
PRK08727		233	hypothetical protein; Validated	94.43
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	94.41
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	94.39
PRK06835		329	DNA replication protein DnaC; Validated	94.38
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	94.27
PF00004		132	AAA: ATPase family associated with various cellula	94.26
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	94.26
PRK06921		266	hypothetical protein; Provisional	94.24
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	94.24
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	94.22
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	94.18
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	94.13
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	94.08
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	94.06
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	94.02
COG2256		436	MGS1 ATPase related to the helicase subunit of the	93.95
PRK00411		394	cdc6 cell division control protein 6; Reviewed	93.93
PRK10416		318	signal recognition particle-docking protein FtsY;	93.88
PHA03372		668	DNA packaging terminase subunit 1; Provisional	93.87
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	93.84
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	93.79
PRK13826		1102	Dtr system oriT relaxase; Provisional	93.75
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	93.69
COG1484		254	DnaC DNA replication protein [DNA replication, rec	93.61
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	93.6
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	93.58
PRK14086		617	dnaA chromosomal replication initiation protein; P	93.55
PRK11823		446	DNA repair protein RadA; Provisional	93.54
PRK08116		268	hypothetical protein; Validated	93.53
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	93.53
PRK00440		319	rfc replication factor C small subunit; Reviewed	93.45
COG3421		812	Uncharacterized protein conserved in bacteria [Fun	93.35
TIGR00064		272	ftsY signal recognition particle-docking protein F	93.35
PRK08903		227	DnaA regulatory inactivator Hda; Validated	93.34
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	93.26
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	93.2
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	93.18
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	93.13
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	93.11
PHA03368		738	DNA packaging terminase subunit 1; Provisional	93.09
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	93.02
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	92.98
PRK07993		334	DNA polymerase III subunit delta'; Validated	92.98
PRK06090		319	DNA polymerase III subunit delta'; Validated	92.85
PRK08769		319	DNA polymerase III subunit delta'; Validated	92.85
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	92.84
PRK07471		365	DNA polymerase III subunit delta'; Validated	92.81
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	92.75
PHA02544		316	44 clamp loader, small subunit; Provisional	92.72
PRK10867		433	signal recognition particle protein; Provisional	92.69
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	92.64
PRK12422		445	chromosomal replication initiation protein; Provis	92.6
KOG0780		483	consensus Signal recognition particle, subunit Srp	92.56
PTZ00293		211	thymidine kinase; Provisional	92.55
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	92.53
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	92.43
PRK05642		234	DNA replication initiation factor; Validated	92.39
PRK08058		329	DNA polymerase III subunit delta'; Validated	92.37
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	92.25
CHL00095		821	clpC Clp protease ATP binding subunit	92.24
PF06733		174	DEAD_2: DEAD_2; InterPro: IPR010614 This represent	92.2
PRK06871		325	DNA polymerase III subunit delta'; Validated	92.17
PHA03333		752	putative ATPase subunit of terminase; Provisional	92.13
COG4626		546	Phage terminase-like protein, large subunit [Gener	92.11
PRK13342		413	recombination factor protein RarA; Reviewed	91.98
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	91.92
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	91.81
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	91.74
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	91.67
PRK08533		230	flagellar accessory protein FlaH; Reviewed	91.62
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	91.62
TIGR00959		428	ffh signal recognition particle protein. This mode	91.62
PRK10865		857	protein disaggregation chaperone; Provisional	91.59
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	91.54
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	91.5
COG1066		456	Sms Predicted ATP-dependent serine protease [Postt	91.35
CHL00206		2281	ycf2 Ycf2; Provisional	91.32
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	91.26
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	91.25
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	91.18
PF00265		176	TK: Thymidine kinase; InterPro: IPR001267 Thymidin	91.08
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	91.04
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	90.93
COG2842		297	Uncharacterized ATPase, putative transposase [Gene	90.88
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	90.76
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	90.76
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	90.75
PRK12377		248	putative replication protein; Provisional	90.69
PRK03992		389	proteasome-activating nucleotidase; Provisional	90.6
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	90.6
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	90.53
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	90.5
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	90.43
PRK09183		259	transposase/IS protein; Provisional	90.42
PRK11054		684	helD DNA helicase IV; Provisional	90.37
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	90.3
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	90.27
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	90.15
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	90.1
PRK06067		234	flagellar accessory protein FlaH; Validated	90.07
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	90.06
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	90.05
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	90.0
PRK06964		342	DNA polymerase III subunit delta'; Validated	89.92
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	89.89
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	89.76
PRK09087		226	hypothetical protein; Validated	89.67
CHL00176		638	ftsH cell division protein; Validated	89.44
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	89.39
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	89.38
PRK09376		416	rho transcription termination factor Rho; Provisio	89.34
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	89.3
PRK13341		725	recombination factor protein RarA/unknown domain f	89.24
PF01443		234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	89.21
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	89.2
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	89.14
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	89.13
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	89.13
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	89.1
PF07015		231	VirC1: VirC1 protein; InterPro: IPR009744 This fam	89.07
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	88.95
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	88.9
PRK06904		472	replicative DNA helicase; Validated	88.84
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	88.68
COG0593		408	DnaA ATPase involved in DNA replication initiation	88.35
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	88.32
PRK04132		846	replication factor C small subunit; Provisional	88.3
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	88.29
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	88.23
PF13173		128	AAA_14: AAA domain	88.2
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	88.16
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	88.15
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	88.04
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	87.65
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	87.57
PF05707		193	Zot: Zonular occludens toxin (Zot); InterPro: IPR0	87.5
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	87.49
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	87.42
PRK04328		249	hypothetical protein; Provisional	87.27
PRK08760		476	replicative DNA helicase; Provisional	87.23
PF06564		243	YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p	87.01
TIGR02237		209	recomb_radB DNA repair and recombination protein R	86.96
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	86.92
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	86.76
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	86.61
COG3973		747	Superfamily I DNA and RNA helicases [General funct	86.47
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	86.45
PRK05748		448	replicative DNA helicase; Provisional	86.3
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	86.24
cd02037		169	MRP-like MRP (Multiple Resistance and pH adaptatio	85.96
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	85.73
PRK08699		325	DNA polymerase III subunit delta'; Validated	85.49
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	85.28
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	84.9
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	84.82
CHL00195		489	ycf46 Ycf46; Provisional	84.78
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	84.71
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	84.6
PHA02542		473	41 41 helicase; Provisional	84.57
cd02034		116	CooC The accessory protein CooC, which contains a	84.42
PHA00012		361	I assembly protein	84.36
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	84.16
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	84.15
TIGR00665		434	DnaB replicative DNA helicase. This model describe	84.13
PRK07399		314	DNA polymerase III subunit delta'; Validated	84.04
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	83.98
COG1702		348	PhoH Phosphate starvation-inducible protein PhoH,	83.91
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	83.87
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	83.81
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	83.67
PRK13833		323	conjugal transfer protein TrbB; Provisional	83.61
TIGR00767		415	rho transcription termination factor Rho. Members	83.42
PHA02244		383	ATPase-like protein	83.41
CHL00095		821	clpC Clp protease ATP binding subunit	83.38
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	83.34
PRK05973		237	replicative DNA helicase; Provisional	83.19
PRK10865		857	protein disaggregation chaperone; Provisional	83.16
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	83.16
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	83.1
KOG2028		554	consensus ATPase related to the helicase subunit o	83.0
PRK08840		464	replicative DNA helicase; Provisional	82.76
PF03237		384	Terminase_6: Terminase-like family; InterPro: IPR0	82.36
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	82.31
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	82.19
PRK05022		509	anaerobic nitric oxide reductase transcription reg	82.04
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	82.0
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	81.88
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	81.5
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	81.49
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	81.24
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	81.0
PRK09165		497	replicative DNA helicase; Provisional	80.99
COG1373		398	Predicted ATPase (AAA+ superfamily) [General funct	80.62
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	80.31
PRK07004		460	replicative DNA helicase; Provisional	80.22
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	80.04

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

Probab=100.00  E-value=1.1e-75  Score=608.94  Aligned_cols=329  Identities=48%  Similarity=0.793  Sum_probs=290.3

Q ss_pred             CCcHHHHHHHHHHHHHHhcCCCceEEeCCCCCCHHHHHHHHHHHHHHhCCCCCCEEEEeCCcchhhHHHHHHHhcCCCeE
Q 039292          167 VLKPYQLVGVNFLLLLYRKGIAGAILADEMGLGKTIQAITYLMLLKHLNNDPGPHLIVCPASVLENWERELKKWCPSFSV  246 (520)
Q Consensus       167 ~Lr~~Q~~gv~~l~~~~~~~~~g~ILademGlGKTi~aia~l~~l~~~~~~~~~~LIV~P~sll~~W~~E~~~~~p~~~v  246 (520)
                      +|+|||+.||+||.-++.++.+| |||||||||||+|+|||+++|+. .+..||+|||||.|++.||.+||.+|||.++|
T Consensus       399 ~LkdYQlvGvNWL~Llyk~~l~g-ILADEMGLGKTiQvIaFlayLkq-~g~~gpHLVVvPsSTleNWlrEf~kwCPsl~V  476 (941)
T KOG0389|consen  399 QLKDYQLVGVNWLLLLYKKKLNG-ILADEMGLGKTIQVIAFLAYLKQ-IGNPGPHLVVVPSSTLENWLREFAKWCPSLKV  476 (941)
T ss_pred             cccchhhhhHHHHHHHHHccccc-eehhhccCcchhHHHHHHHHHHH-cCCCCCcEEEecchhHHHHHHHHHHhCCceEE
Confidence            69999999999999999999987 99999999999999999999987 55699999999999999999999999999999


Q ss_pred             EEecCCCchhhhHHHHHHhhcCCCCCccEEEeehhhHhhhhccccchHHHHhhcCccEEEEeCccccCCcchHHHHHHHH
Q 039292          247 LQYHGAGRTAYSRELSSLAKAGLPPPFNVLLVCYSLFERHSVQQKDDRKILKRWRWSCVLMDEAHALKDKNSYRWKNLMS  326 (520)
Q Consensus       247 ~~~~g~~~~~~~~~~~~~~~~~~~~~~~vlitty~~l~~~~~~~~~~~~~l~~~~~~~vIiDEaH~ikn~~s~~~~~l~~  326 (520)
                      ..|+|+...+  +.++........ +|+|++|||..+..    .++++.+|+..+|+++|+||+|.+||..|.+|+.++.
T Consensus       477 e~YyGSq~ER--~~lR~~i~~~~~-~ydVllTTY~la~~----~kdDRsflk~~~~n~viyDEgHmLKN~~SeRy~~LM~  549 (941)
T KOG0389|consen  477 EPYYGSQDER--RELRERIKKNKD-DYDVLLTTYNLAAS----SKDDRSFLKNQKFNYVIYDEGHMLKNRTSERYKHLMS  549 (941)
T ss_pred             EeccCcHHHH--HHHHHHHhccCC-CccEEEEEeecccC----ChHHHHHHHhccccEEEecchhhhhccchHHHHHhcc
Confidence            9999998443  333333333333 79999999998874    5569999999999999999999999999999999999


Q ss_pred             HhhhcCcEEEEeccCCCCCHHHHHHHHHHhCCCCCCChHHHHHHhhcCCc------------hHHHHHHHHhhcchhhhe
Q 039292          327 VARNANQRLMLTGTPLQNDLHELWSLLEFMMPDLFATEDVDLKKLLNGED------------RDLIGRMKSILGPFILRR  394 (520)
Q Consensus       327 l~~~~~~rl~LTgTPi~n~~~el~~ll~fl~p~~~~~~~~~~~~~~~~~~------------~~~~~~L~~~l~~~~lRR  394 (520)
                      +  ++.+||+|||||+|||+.|||+||.|+.|++|.+....+..++....            .+.+.+.+.+|+||+|||
T Consensus       550 I--~An~RlLLTGTPLQNNL~ELiSLL~FvlP~vF~~~~~dl~~if~~k~~~d~d~e~~~l~qerIsrAK~im~PFILRR  627 (941)
T KOG0389|consen  550 I--NANFRLLLTGTPLQNNLKELISLLAFVLPKVFDSSMEDLDVIFKAKKTSDGDIENALLSQERISRAKTIMKPFILRR  627 (941)
T ss_pred             c--cccceEEeeCCcccccHHHHHHHHHHHhhHhhhccchHHHHHHhccCCccchhhHHHHHHHHHHHHHHhhhHHHHHH
Confidence            9  89999999999999999999999999999999999888888776433            456899999999999999


Q ss_pred             eHhHHhhhcCCcEEEEEEeCCCHHHHHHHHHHHHHHHHHHHHHHhhhcccchhhhhcCCChhHHHHHHHHHhhhccCccc
Q 039292          395 LKSDVMQQLVPKIQWVEYVTMERPQEDAYRVAIEEYRAVSRARIAKLSDADLATIVGVLPQRQISNYFVQFRKIANHPLL  474 (520)
Q Consensus       395 ~k~~v~~~LP~k~e~~v~v~ms~~Q~~~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~LRkicnHP~L  474 (520)
                      .|++|+++||||+.++.+|+|+..|+++|..+++.+....    ...+. +  +      ...-.++||+|||++|||.|
T Consensus       628 ~K~qVL~~LPpK~~~Ie~c~mse~Q~~~Y~~~~~~~~~~~----~~~~~-n--s------~~~~~~vlmqlRK~AnHPLL  694 (941)
T KOG0389|consen  628 LKSQVLKQLPPKIQRIEYCEMSEKQKQLYDELIELYDVKL----NEVSK-N--S------ELKSGNVLMQLRKAANHPLL  694 (941)
T ss_pred             HHHHHHHhcCCccceeEeeecchHHHHHHHHHHHHHhhhc----ccccc-c--c------ccccchHHHHHHHHhcChhH
Confidence            9999999999999999999999999999999988762111    11111 0  0      00115689999999999999


Q ss_pred             ccccCCChHHHHHHHhhCCCCCccccccHHHHHHHHhcCCCcccCC
Q 039292          475 VRRIYSDDDVVRFAKKLHPMGAFGFECTLERVIEELKNYSDFSIHQ  520 (520)
Q Consensus       475 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~h~  520 (520)
                      +|.+|+++.+.+|+++++.++.+.+ ++.++|+|+|.+||||+|||
T Consensus       695 ~R~~Y~de~L~~mak~il~e~ay~~-~n~qyIfEDm~~msDfelHq  739 (941)
T KOG0389|consen  695 FRSIYTDEKLRKMAKRILNEPAYKK-ANEQYIFEDMEVMSDFELHQ  739 (941)
T ss_pred             HHHhccHHHHHHHHHHHhCchhhhh-cCHHHHHHHHHhhhHHHHHH
Confidence            9999999999999999999999965 99999999999999999996

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>KOG0383 consensus Predicted helicase [General function prediction only]	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms]	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PHA03372 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>COG3421 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PTZ00293 thymidine kinase; Provisional	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>COG4626 Phage terminase-like protein, large subunit [General function prediction only]	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only]	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot)	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PHA02542 41 41 helicase; Provisional	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>PHA00012 I assembly protein	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK08840 replicative DNA helicase; Provisional	Back alignment and domain information

>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging []	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK09165 replicative DNA helicase; Provisional	Back alignment and domain information

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK07004 replicative DNA helicase; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		520
3mwy_W		800	Crystal Structure Of The Chromodomain-atpase Portio		3e-36
1z6a_A		500	Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN		2e-29
1z63_A		500	Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM		7e-28
1z3i_X		644	Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA		6e-25
3dmq_A		968	Crystal Structure Of Rapa, A Swi2SNF2 PROTEIN THAT		2e-07

>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800