Citrus Sinensis ID: 039302


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
AVIKWFAASRTQRRPKERTRTQKKGNGSSSSSIPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVSNISGKRRELVPNKPATGDEDADGESSDSDDDSDDEEEGGSGTPILQLRKVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLEKDEEEEAEFKAKTREQVNAPEDLPPQLLFIHQGQKDLKELHWHTQVPGMIVSTAADGFNILMPSNIQSTLPQDAV
cHHHHHccccccccccHHHHHHcccccccccccccccccEEcccccccccccEEccccHHHHHHHHcccccccEEEEEEcccccccccccccEEEEEEEEEcccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccccccccccccccEEEccccccEEEEEEccccccEEEEEcccccEEEEcccccccccccccccccccccEEEEEEEcccccEEEEEEccccEEEEEccccccccEEEccccccEEEEEEccccccEEEEEEccccEEEEEccccccccccEEEcccccccEEEEEEccccccEEEEEEccccEEEEEccccccHHHHHHHHcccccccccccccccEEEEEEcccccccEEEEEcccccEEEEEEcccccEEEEEEcccccccccc
ccHHHHHHccccccccccccccccccccccccccccccEEEcccccccccccEEEccHHHHHHHHHHccccccEEEEEcccccccccccccEEEEEEEccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEcccccccccccccccccccccccccccEEEEEcccccccEEEcccccccEEEEcccccEEEEEEccccccEEccccccccccccEEEcccccccccEEEEEccccEEEEEEcccccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEcHcccccccEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEccccccHHHHHHHHcccccccccHcccccEEEEEEcccccHHHccccccccEEEEEEccccccEEEEEEcHHccccccc
AVIKWFAasrtqrrpkertrtqkkgngsssssipslptkvwqpgvdkleegeelqcdptaynslhafhigwpclsFDILRDTLglvrnefpytayfvagsqaekpswnsigvfkvsnisgkrrelvpnkpatgdedadgessdsdddsddeeeggsgtpilQLRKVAHQGCVNRIRamsqnphicaswadtghvqVWDFRSHLNAlaesetvaghgapqvlnqsplvkfgghkdegyaidwnpvapgrlvsgdcnscihlwepasdatwnvdpnpfighaasvedlqwsptesdvfascsvdgniaiwdtRVGKSALMSFKAHNADVNVISWNRLASCLLasgsddgtfsihdlrllkggdsvvahfeyhkhpvtsiewsphegstlavssadnqltiwdlslekDEEEEAEFKAKTreqvnapedlppqllFIHQGQKDLKElhwhtqvpgmIVSTAadgfnilmpsniqstlpqdav
avikwfaasrtqrrpkertrtqkkgngsssssipslptkvWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGsqaekpswnSIGVFkvsnisgkrrelvpnkpatgdedadgessdsdddsdDEEEggsgtpilqlrKVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLEKDEEEEAEFKAktreqvnapedLPPQLLFIHQGQKDLKELHWHTQVPGMIVSTAADGFNILMpsniqstlpqdav
AVIKWFAASRTQRRPKERTRTQKKGNGsssssIPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVSNISGKRRELVPNKPATgdedadgessdsdddsddeeeggsgTPILQLRKVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLekdeeeeaefkakTREQVNAPEDLPPQLLFIHQGQKDLKELHWHTQVPGMIVSTAADGFNILMPSNIQSTLPQDAV
*****************************************************LQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVSN******************************************ILQLRKVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDL****************************QLLFIHQGQKDLKELHWHTQVPGMIVSTAADGFNILM*************
****************************************WQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVSNISGKRRELVPNKPATGDEDADGES**SDD*SDDEEEGGSGTPILQLRKVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNA*************QVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLEKD****************APEDLPPQLLFIHQGQKDLKELHWHTQVPGMIVSTAADGFNILMPSNIQSTLPQDAV
AVIKWFAAS**************************LPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVSNISGKRRELVPNKP*************************SGTPILQLRKVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLEK*************EQVNAPEDLPPQLLFIHQGQKDLKELHWHTQVPGMIVSTAADGFNILMPSNIQ********
************************************PTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVSNISGKR*********************************SGTPILQLRKVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLEK*****A************PEDLPPQLLFIHQGQKDLKELHWHTQVPGMIVSTAADGFNILMPSNIQSTLPQ***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AVIKWFAASRTQRRPKERTRTQKKGNGSSSSSIPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVSNISGKRRELVPNKPATGDEDADGESSDSDDDSDDEEEGGSGTPILQLRKVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLEKDEEEEAEFKAKTREQVNAPEDLPPQLLFIHQGQKDLKELHWHTQVPGMIVSTAADGFNILMPSNIQSTLPQDAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query479 2.2.26 [Sep-21-2011]
Q54ED4482 Glutamate-rich WD repeat- yes no 0.855 0.850 0.462 1e-101
Q9BQ67446 Glutamate-rich WD repeat- yes no 0.908 0.975 0.433 2e-93
Q1JQD2446 Glutamate-rich WD repeat- yes no 0.901 0.968 0.428 3e-92
Q810D6446 Glutamate-rich WD repeat- yes no 0.893 0.959 0.429 7e-92
Q5XI13445 Glutamate-rich WD repeat- yes no 0.847 0.912 0.439 1e-91
Q9P783480 Ribosome assembly protein yes no 0.824 0.822 0.415 8e-87
Q04225511 Ribosome assembly protein yes no 0.803 0.753 0.352 4e-64
Q60973425 Histone-binding protein R no no 0.668 0.752 0.331 2e-37
Q71UF4425 Histone-binding protein R no no 0.668 0.752 0.331 3e-37
Q4R304425 Histone-binding protein R N/A no 0.668 0.752 0.331 3e-37
>sp|Q54ED4|GRWD1_DICDI Glutamate-rich WD repeat-containing protein 1 OS=Dictyostelium discoideum GN=grwd1 PE=3 SV=1 Back     alignment and function desciption
 Score =  369 bits (947), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 201/435 (46%), Positives = 271/435 (62%), Gaps = 25/435 (5%)

Query: 37  PTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYF 96
           P KVW+ GVD LEE E L  D TAY+ +H+  + WPCLSF  ++D LG  RN++P+T Y 
Sbjct: 68  PKKVWRAGVDPLEEDEVLDYDSTAYDMMHSMSVEWPCLSFHPIKDELGAQRNKYPHTMYL 127

Query: 97  VAGSQAEKPSWNSIGVFKVSNISGKRRELVPNKPATGDEDADGESSDSDDDSDDEEEGGS 156
           VAG+QA++   N + + K   +   + +   +      +D +    + D+D D +     
Sbjct: 128 VAGTQADEAKNNKVIIMKAKQLHKTKHDDEDSDDDEDSDDDEESDDEDDEDKDVD----- 182

Query: 157 GTPILQLRKVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHG 216
             P LQL  + H G VNRIR+M Q  +I A+W+D   V +W+  +HL AL ++ETV    
Sbjct: 183 --PELQLAFINHNGAVNRIRSMDQQSNIVATWSDNRSVYIWNIANHLKAL-DNETV---- 235

Query: 217 APQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPF 276
           AP+    +PL     H  EGYA+DW+P   GRL +GDCN+ I +   AS++TW  D   F
Sbjct: 236 APK--QTAPLHTISNHSIEGYALDWSPKIAGRLATGDCNNSIFV-TNASESTWKTDTQAF 292

Query: 277 IGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISWNRLA 336
            GH  SVED+QWSP+E  VFASCS+D  + IWD R  K A+ + KAH ADVNVISW+R  
Sbjct: 293 KGHTESVEDIQWSPSEEKVFASCSIDQTVRIWDIRKPKPAI-TVKAHTADVNVISWSRNV 351

Query: 337 SCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQL 396
             LL SG DDG+F + DLR  K  +S V+ F+YH  P+TSIEW+P+E S + VSS+D+Q+
Sbjct: 352 EYLLVSGCDDGSFRVWDLRAFK-DNSPVSDFKYHTGPITSIEWNPYEESQVIVSSSDDQV 410

Query: 397 TIWDLSLEKDEEEEAEFKAKTREQVNAPEDL--PPQLLFIHQGQKDLKELHWHTQVPGMI 454
           TIWD SLE+D EE       T    N  +D   PPQL FIHQGQ D+KE+HWH Q+P + 
Sbjct: 411 TIWDFSLEEDTEE------FTNANANPDDDFQYPPQLFFIHQGQHDIKEVHWHPQIPHVA 464

Query: 455 VSTAADGFNILMPSN 469
           +ST+ DGFNI   SN
Sbjct: 465 ISTSIDGFNIFKSSN 479





Dictyostelium discoideum (taxid: 44689)
>sp|Q9BQ67|GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens GN=GRWD1 PE=1 SV=1 Back     alignment and function description
>sp|Q1JQD2|GRWD1_BOVIN Glutamate-rich WD repeat-containing protein 1 OS=Bos taurus GN=GRWD1 PE=2 SV=1 Back     alignment and function description
>sp|Q810D6|GRWD1_MOUSE Glutamate-rich WD repeat-containing protein 1 OS=Mus musculus GN=Grwd1 PE=2 SV=2 Back     alignment and function description
>sp|Q5XI13|GRWD1_RAT Glutamate-rich WD repeat-containing protein 1 OS=Rattus norvegicus GN=Grwd1 PE=2 SV=1 Back     alignment and function description
>sp|Q9P783|RRB1_SCHPO Ribosome assembly protein rrb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrb1 PE=1 SV=1 Back     alignment and function description
>sp|Q04225|RRB1_YEAST Ribosome assembly protein RRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRB1 PE=1 SV=1 Back     alignment and function description
>sp|Q60973|RBBP7_MOUSE Histone-binding protein RBBP7 OS=Mus musculus GN=Rbbp7 PE=1 SV=1 Back     alignment and function description
>sp|Q71UF4|RBBP7_RAT Histone-binding protein RBBP7 OS=Rattus norvegicus GN=Rbbp7 PE=2 SV=1 Back     alignment and function description
>sp|Q4R304|RBBP7_MACFA Histone-binding protein RBBP7 OS=Macaca fascicularis GN=RBBP7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query479
225444932474 PREDICTED: glutamate-rich WD repeat-cont 0.968 0.978 0.794 0.0
255573609476 WD-repeat protein, putative [Ricinus com 0.974 0.981 0.766 0.0
449435854475 PREDICTED: glutamate-rich WD repeat-cont 0.977 0.985 0.769 0.0
449532697465 PREDICTED: glutamate-rich WD repeat-cont 0.964 0.993 0.779 0.0
356512379475 PREDICTED: glutamate-rich WD repeat-cont 0.922 0.930 0.825 0.0
356525166472 PREDICTED: LOW QUALITY PROTEIN: glutamat 0.920 0.934 0.791 0.0
224081134443 predicted protein [Populus trichocarpa] 0.924 1.0 0.783 0.0
297836302470 transducin family protein [Arabidopsis l 0.935 0.953 0.746 0.0
15224798469 transducin-like protein [Arabidopsis tha 0.933 0.953 0.741 0.0
82400122464 WD-40 repeat protein-like protein [Solan 0.906 0.935 0.726 0.0
>gi|225444932|ref|XP_002282252.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Vitis vinifera] gi|297738673|emb|CBI27918.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/467 (79%), Positives = 418/467 (89%), Gaps = 3/467 (0%)

Query: 10  RTQRRPKERTRTQKKGNGSSSSSIPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHI 69
           +  ++ K + +  KKG GSSS  +PSLPTKVWQPGVDKLEEGEELQCDP+AYNSLHAFH+
Sbjct: 6   KNPKKAKRKNKGSKKGEGSSS--VPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHV 63

Query: 70  GWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVSNISGKRRELVPNK 129
           GWPCLSFDI+RD+LGLVR+EFP+TAYFVAG+QAEK SWNSIG+FK+SNISGK+RELVP  
Sbjct: 64  GWPCLSFDIVRDSLGLVRSEFPHTAYFVAGTQAEKASWNSIGIFKLSNISGKKRELVPTT 123

Query: 130 PATGDEDADGESSDSDDDSD-DEEEGGSGTPILQLRKVAHQGCVNRIRAMSQNPHICASW 188
            +TGD+          D+   +EE+GGSGTPILQ+RKVAH+GCVNRIRAM+QNPHICASW
Sbjct: 124 KSTGDDSDMDGDGSDSDEDSENEEDGGSGTPILQMRKVAHEGCVNRIRAMTQNPHICASW 183

Query: 189 ADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGR 248
           ADTGHVQVWDF SHLNALAESET A  G+   +NQ+PLVKFGGHKDEGYAIDW+PV PG+
Sbjct: 184 ADTGHVQVWDFSSHLNALAESETDANQGSTPAINQAPLVKFGGHKDEGYAIDWSPVVPGK 243

Query: 249 LVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIW 308
           LV+GDC +CI+LWEP SDATW VD NPFIGH ASVEDLQWSPTE  VFASCSVDGNIAIW
Sbjct: 244 LVTGDCKNCIYLWEPTSDATWKVDTNPFIGHTASVEDLQWSPTEVHVFASCSVDGNIAIW 303

Query: 309 DTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFE 368
           DTR+G+S   SFKAHNADVNV+SWNRLASC+LASGSDDGTFSI DLRLLK GDSVVAHFE
Sbjct: 304 DTRLGRSPAASFKAHNADVNVLSWNRLASCMLASGSDDGTFSIRDLRLLKDGDSVVAHFE 363

Query: 369 YHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLEKDEEEEAEFKAKTREQVNAPEDLP 428
           YHKHP+TSIEWSPHE STLAVSS+DNQLTIWDLSLEKDEEEEAEF+A+T+EQVNAPEDLP
Sbjct: 364 YHKHPITSIEWSPHEASTLAVSSSDNQLTIWDLSLEKDEEEEAEFRAQTKEQVNAPEDLP 423

Query: 429 PQLLFIHQGQKDLKELHWHTQVPGMIVSTAADGFNILMPSNIQSTLP 475
           PQLLF+HQGQKDLKELHWH+Q+PGMI+STAADGFN+LMPSNIQ+ LP
Sbjct: 424 PQLLFVHQGQKDLKELHWHSQIPGMIISTAADGFNVLMPSNIQNVLP 470




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255573609|ref|XP_002527727.1| WD-repeat protein, putative [Ricinus communis] gi|223532868|gb|EEF34640.1| WD-repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449435854|ref|XP_004135709.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449532697|ref|XP_004173317.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|356512379|ref|XP_003524897.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356525166|ref|XP_003531198.1| PREDICTED: LOW QUALITY PROTEIN: glutamate-rich WD repeat-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|224081134|ref|XP_002306305.1| predicted protein [Populus trichocarpa] gi|222855754|gb|EEE93301.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297836302|ref|XP_002886033.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297331873|gb|EFH62292.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15224798|ref|NP_179544.1| transducin-like protein [Arabidopsis thaliana] gi|13877611|gb|AAK43883.1|AF370506_1 putative WD-40 repeat protein [Arabidopsis thaliana] gi|4191784|gb|AAD10153.1| putative WD-40 repeat protein [Arabidopsis thaliana] gi|22136272|gb|AAM91214.1| putative WD-40 repeat protein [Arabidopsis thaliana] gi|330251799|gb|AEC06893.1| transducin-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|82400122|gb|ABB72800.1| WD-40 repeat protein-like protein [Solanum tuberosum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query479
TAIR|locus:2050388469 AT2G19540 "AT2G19540" [Arabido 0.962 0.982 0.676 5.9e-176
DICTYBASE|DDB_G0291566482 grwd1 "glutamate-rich WD repea 0.855 0.850 0.448 1.1e-94
RGD|1310649445 Grwd1 "glutamate-rich WD repea 0.620 0.667 0.463 1.2e-87
UNIPROTKB|Q9BQ67446 GRWD1 "Glutamate-rich WD repea 0.620 0.665 0.459 6.4e-87
UNIPROTKB|F1RL85445 GRWD1 "Uncharacterized protein 0.620 0.667 0.459 1e-86
FB|FBgn0022288456 l(2)09851 "lethal (2) 09851" [ 0.855 0.899 0.425 1.6e-86
ZFIN|ZDB-GENE-030131-9844452 grwd1 "glutamate-rich WD repea 0.841 0.891 0.418 1.6e-86
UNIPROTKB|Q1JQD2446 GRWD1 "Glutamate-rich WD repea 0.620 0.665 0.453 4.4e-86
UNIPROTKB|E2RBY0440 GRWD1 "Uncharacterized protein 0.620 0.675 0.453 1.2e-85
MGI|MGI:2141989446 Grwd1 "glutamate-rich WD repea 0.891 0.957 0.412 2.7e-84
TAIR|locus:2050388 AT2G19540 "AT2G19540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1709 (606.7 bits), Expect = 5.9e-176, P = 5.9e-176
 Identities = 314/464 (67%), Positives = 358/464 (77%)

Query:    14 RPKERTRTQKKGNGXXXXXIPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPC 73
             + K + + +KK        IPS+PT+VWQPGVD LE+GEELQCDP+AYNSLH FH+GWPC
Sbjct:     6 KTKAKRKNKKKAEASSSE-IPSIPTRVWQPGVDTLEDGEELQCDPSAYNSLHGFHVGWPC 64

Query:    74 LSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVSNISGKRRELVPNKPATX 133
             LSFDIL D LGL R EFP+T Y VAG+QAEK + NSIG+FK++N+SGKRR++VP K    
Sbjct:    65 LSFDILGDKLGLNRTEFPHTLYMVAGTQAEKAAHNSIGLFKITNVSGKRRDVVP-KTFGN 123

Query:   134 XXXXXXXXXXXXXXXXXXXXXXXXTPILQLRKVAHQGCVNRIRAMSQNPHICASWADTGH 193
                                     TP +Q+R+VAH GCVNRIRAM QN HIC SWAD+GH
Sbjct:   124 GEDEDEDDEDDSDSDDDDGDEASKTPNIQVRRVAHHGCVNRIRAMPQNSHICVSWADSGH 183

Query:   194 VQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGD 253
             VQVWD  SHLNALAESET    G   VLNQ+PLV F GHKDEGYAIDW+P   GRL+SGD
Sbjct:   184 VQVWDMSSHLNALAESETEGKDGTSPVLNQAPLVNFSGHKDEGYAIDWSPATAGRLLSGD 243

Query:   254 CNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVG 313
             C S IHLWEPAS  +W VDP PF GH ASVEDLQWSP E +VFASCSVDG++A+WD R+G
Sbjct:   244 CKSMIHLWEPAS-GSWAVDPIPFAGHTASVEDLQWSPAEENVFASCSVDGSVAVWDIRLG 302

Query:   314 KSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHP 373
             KS  +SFKAHNADVNVISWNRLASC+LASGSDDGTFSI DLRL+KGGD+VVAHFEYHKHP
Sbjct:   303 KSPALSFKAHNADVNVISWNRLASCMLASGSDDGTFSIRDLRLIKGGDAVVAHFEYHKHP 362

Query:   374 VTSIEWSPHEGSTLAVSSADNQLTIWDLSLXXXXXXXXXXXXXTREQVNAPEDLPPQLLF 433
             +TSIEWS HE STLAV+S DNQLTIWDLSL             T+E VN P+DLPPQLLF
Sbjct:   363 ITSIEWSAHEASTLAVTSGDNQLTIWDLSLEKDEEEEAEFNAQTKELVNTPQDLPPQLLF 422

Query:   434 IHQGQKDLKELHWHTQVPGMIVSTAADGFNILMPSNIQSTLPQD 477
             +HQGQKDLKELHWH Q+PGMI+STA DGFNILMP NIQ+TLP +
Sbjct:   423 VHQGQKDLKELHWHNQIPGMIISTAGDGFNILMPYNIQNTLPSE 466




GO:0000166 "nucleotide binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
DICTYBASE|DDB_G0291566 grwd1 "glutamate-rich WD repeat-containing protein 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|1310649 Grwd1 "glutamate-rich WD repeat containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BQ67 GRWD1 "Glutamate-rich WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RL85 GRWD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0022288 l(2)09851 "lethal (2) 09851" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9844 grwd1 "glutamate-rich WD repeat containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JQD2 GRWD1 "Glutamate-rich WD repeat-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBY0 GRWD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2141989 Grwd1 "glutamate-rich WD repeat containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q54ED4GRWD1_DICDINo assigned EC number0.46200.85590.8506yesno
Q1JQD2GRWD1_BOVINNo assigned EC number0.42850.90180.9686yesno
Q5XI13GRWD1_RATNo assigned EC number0.43900.84750.9123yesno
Q9P783RRB1_SCHPONo assigned EC number0.41590.82460.8229yesno
Q810D6GRWD1_MOUSENo assigned EC number0.42910.89350.9596yesno
Q9BQ67GRWD1_HUMANNo assigned EC number0.43340.90810.9753yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00016571001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (474 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00020673001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (607 aa)
     0.854
GSVIVG00037695001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (245 aa)
      0.769
GSVIVG00026600001
SubName- Full=Chromosome chr12 scaffold_38, whole genome shotgun sequence; (229 aa)
       0.759
GSVIVG00034559001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (840 aa)
       0.747
GSVIVG00028481001
SubName- Full=Chromosome chr7 scaffold_44, whole genome shotgun sequence; (316 aa)
      0.746
GSVIVG00021307001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (586 aa)
      0.746
GSVIVG00005498001
SubName- Full=Putative uncharacterized protein (Chromosome chr13 scaffold_152, whole genome sho [...] (293 aa)
       0.742
GSVIVG00019376001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (1041 aa)
       0.740
GSVIVG00033408001
SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (430 aa)
       0.732
GSVIVG00002877001
SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (801 aa)
      0.731

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-23
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-21
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-19
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-19
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-17
pfam1226573 pfam12265, CAF1C_H4-bd, Histone-binding protein RB 9e-17
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-11
PTZ00420 568 PTZ00420, PTZ00420, coronin; Provisional 3e-07
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 9e-07
PTZ00421 493 PTZ00421, PTZ00421, coronin; Provisional 9e-06
smart0032040 smart00320, WD40, WD40 repeats 7e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-04
PTZ00421 493 PTZ00421, PTZ00421, coronin; Provisional 2e-04
smart0032040 smart00320, WD40, WD40 repeats 2e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-04
PTZ00420 568 PTZ00420, PTZ00420, coronin; Provisional 4e-04
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 8e-04
smart0032040 smart00320, WD40, WD40 repeats 0.003
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.003
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 98.9 bits (247), Expect = 3e-23
 Identities = 61/238 (25%), Positives = 91/238 (38%), Gaps = 35/238 (14%)

Query: 168 HQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLV 227
           H G V  +        +     D G ++VWD                           L 
Sbjct: 8   HTGGVTCVAFSPDGKLLATGSGD-GTIKVWDLE---------------------TGELLR 45

Query: 228 KFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQ 287
              GH      +  +      L SG  +  I LW+  +            GH + V  + 
Sbjct: 46  TLKGHTGPVRDVAASADGT-YLASGSSDKTIRLWDLETGEC----VRTLTGHTSYVSSVA 100

Query: 288 WSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDG 347
           +SP    + +S S D  I +WD   GK  L + + H   VN ++++   +  +AS S DG
Sbjct: 101 FSPD-GRILSSSSRDKTIKVWDVETGK-CLTTLRGHTDWVNSVAFSPDGT-FVASSSQDG 157

Query: 348 TFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLEK 405
           T  + DLR  K     VA    H   V S+ +SP +G  L  SS+D  + +WDLS  K
Sbjct: 158 TIKLWDLRTGK----CVATLTGHTGEVNSVAFSP-DGEKLLSSSSDGTIKLWDLSTGK 210


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|221499 pfam12265, CAF1C_H4-bd, Histone-binding protein RBBP4 or subunit C of CAF1 complex Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 479
KOG0302440 consensus Ribosome Assembly protein [General funct 100.0
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0284 464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0313423 consensus Microtubule binding protein YTM1 (contai 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0772 641 consensus Uncharacterized conserved protein, conta 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.98
KOG0293519 consensus WD40 repeat-containing protein [Function 99.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.98
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.98
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.98
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.97
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.97
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.97
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.97
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.97
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.97
PTZ00421 493 coronin; Provisional 99.96
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.96
PTZ00420 568 coronin; Provisional 99.96
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.96
PTZ00420 568 coronin; Provisional 99.96
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.96
KOG0645312 consensus WD40 repeat protein [General function pr 99.96
KOG0300481 consensus WD40 repeat-containing protein [Function 99.96
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.96
KOG0318 603 consensus WD40 repeat stress protein/actin interac 99.96
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.96
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.96
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.96
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG0270463 consensus WD40 repeat-containing protein [Function 99.95
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0641350 consensus WD40 repeat protein [General function pr 99.95
KOG0270463 consensus WD40 repeat-containing protein [Function 99.95
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.95
KOG0289506 consensus mRNA splicing factor [General function p 99.95
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.95
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.95
KOG0643327 consensus Translation initiation factor 3, subunit 99.95
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.95
KOG0294362 consensus WD40 repeat-containing protein [Function 99.95
KOG0300481 consensus WD40 repeat-containing protein [Function 99.95
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.95
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.95
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.95
KOG0289506 consensus mRNA splicing factor [General function p 99.94
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.94
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.94
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.94
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.94
KOG4328498 consensus WD40 protein [Function unknown] 99.94
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.94
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.94
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.93
KOG0267 825 consensus Microtubule severing protein katanin p80 99.93
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.93
KOG0302440 consensus Ribosome Assembly protein [General funct 99.93
KOG0296399 consensus Angio-associated migratory cell protein 99.93
KOG0641350 consensus WD40 repeat protein [General function pr 99.93
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.93
KOG0646476 consensus WD40 repeat protein [General function pr 99.93
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.93
KOG0283712 consensus WD40 repeat-containing protein [Function 99.92
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.92
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.92
KOG0643327 consensus Translation initiation factor 3, subunit 99.92
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.92
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.92
KOG0293519 consensus WD40 repeat-containing protein [Function 99.92
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.92
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.92
KOG4283397 consensus Transcription-coupled repair protein CSA 99.91
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.91
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.91
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.91
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.91
KOG0772641 consensus Uncharacterized conserved protein, conta 99.91
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.91
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.9
KOG2096420 consensus WD40 repeat protein [General function pr 99.9
KOG4328498 consensus WD40 protein [Function unknown] 99.9
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.9
KOG0267 825 consensus Microtubule severing protein katanin p80 99.9
KOG1539 910 consensus WD repeat protein [General function pred 99.9
KOG0646476 consensus WD40 repeat protein [General function pr 99.9
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.89
KOG4283397 consensus Transcription-coupled repair protein CSA 99.89
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.89
KOG0294362 consensus WD40 repeat-containing protein [Function 99.89
KOG0639705 consensus Transducin-like enhancer of split protei 99.89
KOG0639705 consensus Transducin-like enhancer of split protei 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.88
KOG1274 933 consensus WD40 repeat protein [General function pr 99.88
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.88
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.88
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.88
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.88
KOG2055514 consensus WD40 repeat protein [General function pr 99.88
KOG1188376 consensus WD40 repeat protein [General function pr 99.88
KOG1273405 consensus WD40 repeat protein [General function pr 99.88
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.87
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.87
KOG4227 609 consensus WD40 repeat protein [General function pr 99.86
KOG2106626 consensus Uncharacterized conserved protein, conta 99.86
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.85
KOG2048 691 consensus WD40 repeat protein [General function pr 99.85
KOG1274 933 consensus WD40 repeat protein [General function pr 99.85
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.84
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.84
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.84
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.84
KOG2048 691 consensus WD40 repeat protein [General function pr 99.84
KOG2106626 consensus Uncharacterized conserved protein, conta 99.83
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.83
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.83
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.83
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.83
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.82
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.82
KOG2055514 consensus WD40 repeat protein [General function pr 99.81
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.81
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.81
KOG1310 758 consensus WD40 repeat protein [General function pr 99.8
KOG1188376 consensus WD40 repeat protein [General function pr 99.8
PF1226574 CAF1C_H4-bd: Histone-binding protein RBBP4 or subu 99.79
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.79
KOG1539 910 consensus WD repeat protein [General function pred 99.78
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.78
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.78
KOG0649325 consensus WD40 repeat protein [General function pr 99.78
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.78
KOG2096 420 consensus WD40 repeat protein [General function pr 99.77
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.77
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.77
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.77
KOG0649325 consensus WD40 repeat protein [General function pr 99.77
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.76
COG2319466 FOG: WD40 repeat [General function prediction only 99.75
COG2319 466 FOG: WD40 repeat [General function prediction only 99.72
PRK11028330 6-phosphogluconolactonase; Provisional 99.72
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.72
KOG1273 405 consensus WD40 repeat protein [General function pr 99.72
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.71
KOG0771398 consensus Prolactin regulatory element-binding pro 99.71
KOG1334 559 consensus WD40 repeat protein [General function pr 99.7
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.7
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.69
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.69
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.68
KOG1523 361 consensus Actin-related protein Arp2/3 complex, su 99.68
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.66
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.66
KOG4227 609 consensus WD40 repeat protein [General function pr 99.65
KOG1009 434 consensus Chromatin assembly complex 1 subunit B/C 99.65
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.65
KOG2321 703 consensus WD40 repeat protein [General function pr 99.65
KOG1963 792 consensus WD40 repeat protein [General function pr 99.65
PRK01742429 tolB translocation protein TolB; Provisional 99.64
PRK01742429 tolB translocation protein TolB; Provisional 99.63
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.63
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.63
KOG0771398 consensus Prolactin regulatory element-binding pro 99.62
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.6
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.59
KOG2139445 consensus WD40 repeat protein [General function pr 99.59
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.59
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.58
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.58
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.58
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.58
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.58
KOG1310 758 consensus WD40 repeat protein [General function pr 99.57
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.57
KOG2111346 consensus Uncharacterized conserved protein, conta 99.55
KOG1334559 consensus WD40 repeat protein [General function pr 99.55
KOG2110391 consensus Uncharacterized conserved protein, conta 99.55
KOG1409404 consensus Uncharacterized conserved protein, conta 99.54
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.54
PRK03629429 tolB translocation protein TolB; Provisional 99.54
KOG2139445 consensus WD40 repeat protein [General function pr 99.54
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.53
PRK11028330 6-phosphogluconolactonase; Provisional 99.52
PRK02889427 tolB translocation protein TolB; Provisional 99.52
PRK05137435 tolB translocation protein TolB; Provisional 99.51
KOG1963 792 consensus WD40 repeat protein [General function pr 99.51
PRK04922433 tolB translocation protein TolB; Provisional 99.51
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.5
PRK03629429 tolB translocation protein TolB; Provisional 99.49
PRK04922433 tolB translocation protein TolB; Provisional 99.49
PRK05137435 tolB translocation protein TolB; Provisional 99.48
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.46
KOG2111346 consensus Uncharacterized conserved protein, conta 99.46
PRK02889427 tolB translocation protein TolB; Provisional 99.45
KOG2321 703 consensus WD40 repeat protein [General function pr 99.43
KOG4497 447 consensus Uncharacterized conserved protein WDR8, 99.42
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.41
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.41
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.39
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.38
KOG4547 541 consensus WD40 repeat-containing protein [General 99.37
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.31
PRK00178430 tolB translocation protein TolB; Provisional 99.31
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.3
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.3
PRK04792448 tolB translocation protein TolB; Provisional 99.27
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.26
PRK00178430 tolB translocation protein TolB; Provisional 99.26
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.26
PRK04792448 tolB translocation protein TolB; Provisional 99.25
PRK01029428 tolB translocation protein TolB; Provisional 99.25
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.24
KOG4714319 consensus Nucleoporin [Nuclear structure] 99.22
PRK01029428 tolB translocation protein TolB; Provisional 99.21
KOG4532344 consensus WD40-like repeat containing protein [Gen 99.19
KOG1409404 consensus Uncharacterized conserved protein, conta 99.19
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.18
KOG2315566 consensus Predicted translation initiation factor 99.11
KOG4547 541 consensus WD40 repeat-containing protein [General 99.09
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.07
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.06
KOG2315 566 consensus Predicted translation initiation factor 99.05
KOG1008 783 consensus Uncharacterized conserved protein, conta 99.03
KOG4714319 consensus Nucleoporin [Nuclear structure] 99.02
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.02
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.0
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.98
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.97
KOG2695425 consensus WD40 repeat protein [General function pr 98.95
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.94
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.94
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.9
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.88
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.88
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.88
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.85
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.85
KOG2314 698 consensus Translation initiation factor 3, subunit 98.8
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.8
KOG2695425 consensus WD40 repeat protein [General function pr 98.79
PRK04043419 tolB translocation protein TolB; Provisional 98.76
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.76
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.75
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.74
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.74
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.72
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.71
KOG1008 783 consensus Uncharacterized conserved protein, conta 98.7
PRK04043419 tolB translocation protein TolB; Provisional 98.7
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.69
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.67
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.67
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.64
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.62
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.55
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.55
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.54
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.54
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.53
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.5
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.45
COG4946 668 Uncharacterized protein related to the periplasmic 98.43
KOG2314 698 consensus Translation initiation factor 3, subunit 98.42
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.34
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.34
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.31
COG4946668 Uncharacterized protein related to the periplasmic 98.3
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.3
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.3
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.29
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.28
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.24
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.21
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.13
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.1
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.06
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.05
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.99
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.97
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.96
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.95
KOG3621 726 consensus WD40 repeat-containing protein [General 97.93
KOG3621 726 consensus WD40 repeat-containing protein [General 97.84
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.79
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.76
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.67
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.64
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.63
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.63
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.6
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.58
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.55
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.55
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.54
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.52
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.49
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.46
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.45
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.42
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.34
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.33
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.28
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.27
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.23
KOG2395644 consensus Protein involved in vacuole import and d 97.15
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.05
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.01
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.01
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.91
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 96.91
KOG4649 354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 96.86
PRK02888 635 nitrous-oxide reductase; Validated 96.83
COG3391381 Uncharacterized conserved protein [Function unknow 96.79
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.79
KOG2444238 consensus WD40 repeat protein [General function pr 96.78
PRK02888 635 nitrous-oxide reductase; Validated 96.75
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.69
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.61
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.54
KOG2444238 consensus WD40 repeat protein [General function pr 96.51
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.47
COG3391381 Uncharacterized conserved protein [Function unknow 96.41
KOG2395644 consensus Protein involved in vacuole import and d 96.38
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.36
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.33
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.05
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 96.03
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 95.99
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 95.91
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 95.9
PRK13616591 lipoprotein LpqB; Provisional 95.85
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.83
KOG2377 657 consensus Uncharacterized conserved protein [Funct 95.78
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.72
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.67
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.64
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.64
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.56
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.3
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.29
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.22
PHA02713557 hypothetical protein; Provisional 95.22
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.07
PRK13616591 lipoprotein LpqB; Provisional 95.04
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.02
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 94.73
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.61
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.53
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.46
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 94.14
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 94.03
PF14727 418 PHTB1_N: PTHB1 N-terminus 93.97
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 93.92
COG5167776 VID27 Protein involved in vacuole import and degra 93.72
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 93.63
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 93.59
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 93.47
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 93.46
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 93.4
COG3204316 Uncharacterized protein conserved in bacteria [Fun 93.21
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.09
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 93.03
PRK13684334 Ycf48-like protein; Provisional 93.02
COG3490366 Uncharacterized protein conserved in bacteria [Fun 92.49
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 92.49
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 92.35
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.34
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.32
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 92.27
PHA03098534 kelch-like protein; Provisional 92.27
PF14727418 PHTB1_N: PTHB1 N-terminus 91.95
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 91.78
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 91.74
PHA02713557 hypothetical protein; Provisional 91.72
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 91.64
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 91.46
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 90.65
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 90.57
PRK10115 686 protease 2; Provisional 90.24
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 90.18
KOG2247 615 consensus WD40 repeat-containing protein [General 89.11
KOG2377 657 consensus Uncharacterized conserved protein [Funct 88.91
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 88.87
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 88.6
PF12768281 Rax2: Cortical protein marker for cell polarity 88.6
KOG2247 615 consensus WD40 repeat-containing protein [General 88.48
PHA02790480 Kelch-like protein; Provisional 88.05
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 87.87
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 87.44
PRK10115 686 protease 2; Provisional 87.34
COG5167776 VID27 Protein involved in vacuole import and degra 86.43
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 86.07
COG5276370 Uncharacterized conserved protein [Function unknow 86.07
PHA03098534 kelch-like protein; Provisional 85.62
KOG18961366 consensus mRNA cleavage and polyadenylation factor 85.29
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 84.81
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 84.62
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 84.48
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 83.64
PF12768281 Rax2: Cortical protein marker for cell polarity 82.93
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 81.82
COG4590 733 ABC-type uncharacterized transport system, permeas 80.12
KOG1898 1205 consensus Splicing factor 3b, subunit 3 [RNA proce 80.05
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=6.8e-86  Score=594.01  Aligned_cols=407  Identities=54%  Similarity=0.975  Sum_probs=360.9

Q ss_pred             CCCCCCeeecCCcc-cCCCCceeeeChhHHHhhhcccccCceeeEEEeeCCCCCCcccCCceEEEEEeecCCCCCCceEE
Q 039302           33 IPSLPTKVWQPGVD-KLEEGEELQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIG  111 (479)
Q Consensus        33 ~~~~~~~~~~~~~~-~~~~~~~l~~d~~~Y~~~~~~~~~wP~ls~~~~~d~~~~~~~~~~~~~~~~~gt~~~~~~~n~i~  111 (479)
                      .+....++|+||.. +|++||+|++||++|.|+|.++++||||+|+++||.+|++|++||++.|+|+||||.....|.|+
T Consensus        31 i~~d~~~~~lpg~~~~l~~~EeL~~DpsaYe~lH~~~~gwPcLsfDVi~D~LG~eR~e~P~~~Ylv~gtQa~~~~~N~l~  110 (440)
T KOG0302|consen   31 IEEDGAQVYLPGMSRPLGDDEELVADPSAYEMLHNFNSGWPCLSFDVIPDRLGDERTEFPHTAYLVAGTQALDAPDNELM  110 (440)
T ss_pred             cccccceeeccCCCCCCCCCceEecCHHHHHHhhcccCCCcccceeeecCCCCcccccCchHhhhhhhhhccccccCceE
Confidence            45555889999965 49999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeeecCCccccCCCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCceeEEEEecCCcceeEEEEecCC-CcEEEEEeC
Q 039302          112 VFKVSNISGKRRELVPNKPATGDEDADGESSDSDDDSDDEEEGGSGTPILQLRKVAHQGCVNRIRAMSQN-PHICASWAD  190 (479)
Q Consensus       112 v~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~p~~~~~~~~H~~~V~~v~~~p~~-~~~lat~s~  190 (479)
                      ||+++||++++...            +.++.++++|++++     ++|++..+.++|.+.||+++.++.+ ..++|+++.
T Consensus       111 vlkl~nl~~t~~~~------------~gd~~~~~eddedD-----~~P~~~~~~i~h~g~~NRvr~~~~~~~~~~aswse  173 (440)
T KOG0302|consen  111 VLKLSNLHKTRNPN------------DGDGEDEEEDDEDD-----RKPQIEMKSIPHYGGINRVRVSRLGNEVLCASWSE  173 (440)
T ss_pred             EEEeeeeecccCCc------------cCCCCCccccchhh-----ccccccccccccccccceeeecccCCcceeeeecc
Confidence            99999999998732            11111111111111     5899999999999999999999985 689999999


Q ss_pred             CceEEEEeCCCCcccccccccccCCCCCccccCCCcEEecCCCCceEEEEeCCCCCCeEEEEeCCCeEEEEecCCCCccc
Q 039302          191 TGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWN  270 (479)
Q Consensus       191 dg~V~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~v~~l~~s~~~~~~l~sg~~dg~I~lwd~~~~~~~~  270 (479)
                      .|.|+||++..+.+.+..+......     ...+|++++.+|..+.++|+|||...+.|+||++-+.|++|...+ +.|.
T Consensus       174 ~G~V~Vw~l~~~l~~l~~~~~~~~~-----s~~~Pl~t~~ghk~EGy~LdWSp~~~g~LlsGDc~~~I~lw~~~~-g~W~  247 (440)
T KOG0302|consen  174 NGRVQVWDLAPHLNALSEPGLEVKD-----SEFRPLFTFNGHKGEGYGLDWSPIKTGRLLSGDCVKGIHLWEPST-GSWK  247 (440)
T ss_pred             cCcEEEEEchhhhhhhcCccccccc-----cccCceEEecccCccceeeecccccccccccCccccceEeeeecc-Ccee
Confidence            9999999999988887766554443     357899999999999999999998888999999999999999988 7899


Q ss_pred             cCCCCcccCCCcEEEEEECCCCCcEEEEEeCCCcEEEEEcCCCC-ceeeEEecCCCCEEEEEEcCCCCcEEEEEeCCCeE
Q 039302          271 VDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGK-SALMSFKAHNADVNVISWNRLASCLLASGSDDGTF  349 (479)
Q Consensus       271 ~~~~~~~~h~~~V~~l~~sp~~~~~l~s~s~dg~I~iwD~~~~~-~~~~~~~~h~~~v~~l~~~p~~~~~l~sgs~dg~i  349 (479)
                      +...+|.+|+.+|.+|+|||...++|++||.||+|+|||+|.+. .+....++|.+.||.|+||... .+||+|++||++
T Consensus       248 vd~~Pf~gH~~SVEDLqWSptE~~vfaScS~DgsIrIWDiRs~~~~~~~~~kAh~sDVNVISWnr~~-~lLasG~DdGt~  326 (440)
T KOG0302|consen  248 VDQRPFTGHTKSVEDLQWSPTEDGVFASCSCDGSIRIWDIRSGPKKAAVSTKAHNSDVNVISWNRRE-PLLASGGDDGTL  326 (440)
T ss_pred             ecCccccccccchhhhccCCccCceEEeeecCceEEEEEecCCCccceeEeeccCCceeeEEccCCc-ceeeecCCCceE
Confidence            99999999999999999999999999999999999999999983 3445559999999999999998 599999999999


Q ss_pred             EEEeCCCCCCCCceEEEeecCCCCeEEEEEeCCCCCEEEEEeCCCcEEEEECCCCCChHHHHHHhhhcccccCCCCCCCC
Q 039302          350 SIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLEKDEEEEAEFKAKTREQVNAPEDLPP  429 (479)
Q Consensus       350 ~iwDlr~~~~~~~~~~~~~~h~~~I~~v~~sp~~~~~las~s~Dg~I~iwdl~~~~~~~~~~~~~~~~~~~~~~~~~~p~  429 (479)
                      +|||||+.+. ..++.+|+.|+.+|++|.|+|+....|+++|.|++|.||||....+.++...      .......++||
T Consensus       327 ~iwDLR~~~~-~~pVA~fk~Hk~pItsieW~p~e~s~iaasg~D~QitiWDlsvE~D~ee~~~------~a~~~L~dlPp  399 (440)
T KOG0302|consen  327 SIWDLRQFKS-GQPVATFKYHKAPITSIEWHPHEDSVIAASGEDNQITIWDLSVEADEEEIDQ------EAAEGLQDLPP  399 (440)
T ss_pred             EEEEhhhccC-CCcceeEEeccCCeeEEEeccccCceEEeccCCCcEEEEEeeccCChhhhcc------ccccchhcCCc
Confidence            9999999886 4799999999999999999999999999999999999999999987655432      12333668999


Q ss_pred             ceEEeecCCCCeeeEEEeCCCCcEEEEEcCCCceEEeeecc
Q 039302          430 QLLFIHQGQKDLKELHWHTQVPGMIVSTAADGFNILMPSNI  470 (479)
Q Consensus       430 ~l~~~h~g~~~V~~v~w~p~~~~ll~s~~~dgi~iw~~~~~  470 (479)
                      ||+|+|+|++.|++++||++.|++|+|++.+||+||++.++
T Consensus       400 QLLFVHqGQke~KevhWH~QiPG~lvsTa~dGfnVfktIsv  440 (440)
T KOG0302|consen  400 QLLFVHQGQKEVKEVHWHRQIPGLLVSTAIDGFNVFKTISV  440 (440)
T ss_pred             eeEEEecchhHhhhheeccCCCCeEEEecccceeEEEeccC
Confidence            99999999999999999999999999999999999999874



>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12265 CAF1C_H4-bd: Histone-binding protein RBBP4 or subunit C of CAF1 complex; InterPro: IPR022052 The CAF-1 complex is a conserved heterotrimeric protein complex that promotes histone H3 and H4 deposition onto newly synthesized DNA during replication or DNA repair; specifically it facilitates replication-dependent nucleosome assembly with the major histone H3 (H3 Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1896 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 3e-36
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 1e-35
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 1e-35
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-35
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 2e-35
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 8e-35
4gqb_B344 Crystal Structure Of The Human Prmt5:mep50 Complex 3e-10
4a11_B 408 Structure Of The Hsddb1-Hscsa Complex Length = 408 8e-09
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 8e-09
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 1e-07
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 7e-07
2gnq_A336 Structure Of Wdr5 Length = 336 7e-07
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 8e-07
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 9e-07
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 9e-07
2h9l_A329 Wdr5delta23 Length = 329 1e-06
2aq5_A 402 Crystal Structure Of Murine Coronin-1 Length = 402 1e-06
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-06
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-06
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-06
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-06
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-06
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-06
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-06
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-06
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-06
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-06
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 2e-06
2b4e_A 402 Crystal Structure Of Murine Coronin-1: Monoclinic F 2e-06
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 3e-06
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 6e-06
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 7e-06
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 1e-05
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 1e-05
3bg0_A316 Architecture Of A Coat For The Nuclear Pore Membran 2e-05
3jro_A 753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 2e-05
3jrp_A 379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 3e-05
2pm6_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 4e-05
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 5e-05
4g56_B357 Crystal Structure Of Full Length Prmt5/mep50 Comple 6e-05
2pm9_B297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 7e-05
2pm9_A416 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 1e-04
2pm7_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 1e-04
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 1e-04
3fm0_A 345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 2e-04
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 3e-04
3ei4_B436 Structure Of The Hsddb1-Hsddb2 Complex Length = 436 8e-04
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure

Iteration: 1

Score = 149 bits (377), Expect = 3e-36, Method: Compositional matrix adjust. Identities = 102/304 (33%), Positives = 147/304 (48%), Gaps = 31/304 (10%) Query: 165 KVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQS 224 K+ H+G VNR R M QNP I A+ + V V+D+ H + S + Sbjct: 120 KINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGEC-----------N 168 Query: 225 PLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWN--VDPNP-FIGHAA 281 P ++ GH+ EGY + WNP G L+S + I LW+ ++ VD F GH A Sbjct: 169 PDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTA 228 Query: 282 SVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSAL--MSFKAHNADVNVISWNRLASCL 339 VED+ W +F S + D + IWDTR ++ S AH A+VN +S+N + + Sbjct: 229 VVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFI 288 Query: 340 LASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIW 399 LA+GS D T ++ DLR LK + FE HK + ++WSPH + LA S D +L +W Sbjct: 289 LATGSADKTVALWDLRNLKLK---LHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVW 345 Query: 400 DLSLXXXXXXXXXXXXXTREQVNAPEDLPPQLLFIHQGQK-DLKELHWHTQVPGMIVSTA 458 DLS + ED PP+LLFIH G + + W+ P +I S + Sbjct: 346 DLS-----------KIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVS 394 Query: 459 ADGF 462 D Sbjct: 395 EDNI 398
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|4GQB|B Chain B, Crystal Structure Of The Human Prmt5:mep50 Complex Length = 344 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3BG0|A Chain A, Architecture Of A Coat For The Nuclear Pore Membrane Length = 316 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|2PM6|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Native Version Length = 297 Back     alignment and structure
>pdb|4G56|B Chain B, Crystal Structure Of Full Length Prmt5/mep50 Complexes From Xenopus Laevis Length = 357 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|2PM9|A Chain A, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 416 Back     alignment and structure
>pdb|2PM7|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Selenomethionine Version Length = 297 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3EI4|B Chain B, Structure Of The Hsddb1-Hsddb2 Complex Length = 436 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query479
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.98
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.98
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.98
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.98
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.98
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.98
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.96
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
3jro_A 753 Fusion protein of protein transport protein SEC13 99.96
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.95
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.95
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.95
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.94
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.93
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.93
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.92
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.91
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.9
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.9
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.9
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.88
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.88
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.87
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.87
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.86
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.86
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.85
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.84
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.84
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.84
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.84
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.84
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.83
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.83
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.82
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.82
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.81
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.8
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.78
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.78
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.77
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.76
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.75
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.75
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.75
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.74
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.73
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.72
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.7
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.7
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.69
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.68
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.68
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.66
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.64
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.63
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.63
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.62
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.62
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.6
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.6
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.56
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.56
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.54
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.5
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.5
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.49
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.49
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.48
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.48
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.47
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.46
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.45
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.45
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.44
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.43
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.42
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.4
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.38
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.37
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.37
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.35
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.35
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.34
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.34
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.33
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.33
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.32
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.31
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.3
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.29
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.27
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.26
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.24
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.24
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.23
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.13
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.13
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.09
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.08
2ece_A462 462AA long hypothetical selenium-binding protein; 99.06
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.03
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.96
2qe8_A343 Uncharacterized protein; structural genomics, join 98.94
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.9
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.9
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.9
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.8
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.78
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.76
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.76
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.69
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.67
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.66
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.62
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.6
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.58
2qe8_A343 Uncharacterized protein; structural genomics, join 98.57
2ece_A462 462AA long hypothetical selenium-binding protein; 98.53
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.49
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.39
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.38
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.37
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.36
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.34
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.33
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.33
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.32
3v65_B386 Low-density lipoprotein receptor-related protein; 98.32
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.3
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.3
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.28
3v65_B386 Low-density lipoprotein receptor-related protein; 98.27
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.27
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.21
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.2
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.2
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.19
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.17
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.16
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.07
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.07
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.06
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.04
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.02
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.02
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.01
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.0
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.99
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.97
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.96
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.95
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.94
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.93
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.91
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.88
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.88
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.88
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.86
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.84
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 97.73
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.72
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.69
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.68
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.55
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.53
3kya_A496 Putative phosphatase; structural genomics, joint c 97.52
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 97.5
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.31
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.31
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.29
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.28
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.28
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.26
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.24
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.24
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.23
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.19
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.17
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 97.15
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.13
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.12
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 97.02
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.02
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.96
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.94
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.81
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.77
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.66
3kya_A496 Putative phosphatase; structural genomics, joint c 96.61
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.59
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.58
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.53
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.52
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.42
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.33
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 96.29
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.16
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.02
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.87
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 95.37
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.18
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 95.15
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 94.91
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 94.89
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 94.61
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 94.32
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 94.24
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 93.81
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 93.62
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 93.62
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 93.57
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 93.45
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 93.34
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 93.19
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 93.06
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 92.98
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 92.66
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 91.9
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 90.96
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 90.45
3ott_A 758 Two-component system sensor histidine kinase; beta 90.09
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 89.76
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 88.69
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 87.77
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 87.59
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 87.47
3ott_A 758 Two-component system sensor histidine kinase; beta 87.37
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 87.04
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 86.76
1sqj_A 789 OXG-RCBH, oligoxyloglucan reducing-END-specific ce 86.59
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 86.1
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 84.69
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 82.99
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 82.08
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 82.02
1sqj_A 789 OXG-RCBH, oligoxyloglucan reducing-END-specific ce 80.58
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
Probab=100.00  E-value=1.8e-53  Score=428.84  Aligned_cols=378  Identities=31%  Similarity=0.541  Sum_probs=297.9

Q ss_pred             CCeeecCCcccCCCCceeeeChhHHHhhhcccccCceeeEEEeeCCCCCCcccCCceEEEEEeecCCCCCCceEEEEEee
Q 039302           37 PTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVS  116 (479)
Q Consensus        37 ~~~~~~~~~~~~~~~~~l~~d~~~Y~~~~~~~~~wP~ls~~~~~d~~~~~~~~~~~~~~~~~gt~~~~~~~n~i~v~~~~  116 (479)
                      +.++|+...+            +||+|+|++.++||||+|||+|+..+..+.+|| .+++++|||+.+ ..|+|+|+++.
T Consensus        24 ~~~~wk~n~~------------~~y~~~~~~~l~wp~l~~~~~p~~~~~~~~~~~-~~~~~~GT~t~~-~~n~i~i~~~~   89 (430)
T 2xyi_A           24 EYKIWKKNTP------------FLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYS-VHRLILGTHTSD-EQNHLLIASVQ   89 (430)
T ss_dssp             HHHHHHHHHH------------HHEEEEEEEECSSCCSCEEECSCCEECTTCSCE-EEEEEEECCCSS-SCEEEEEEEEE
T ss_pred             HHhhHhhCCh------------HHHHHHhhcCCCCCceEEEECcccccccCCCcc-eEEEEEEEcCCC-CCCEEEEEEEE
Confidence            3568887776            999999999999999999999999888888898 699999999998 99999999996


Q ss_pred             ecCCccccCCCCCCCCCCCCCCCCCCCCCCCCccccCCC--CCCcee-EEEEecCCcceeEEEEecCCCcEEEEEeCCce
Q 039302          117 NISGKRRELVPNKPATGDEDADGESSDSDDDSDDEEEGG--SGTPIL-QLRKVAHQGCVNRIRAMSQNPHICASWADTGH  193 (479)
Q Consensus       117 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~--~~~p~~-~~~~~~H~~~V~~v~~~p~~~~~lat~s~dg~  193 (479)
                       ++....          +.  ++.++    |+++++.++  ...+.+ ....++|.+.|++++|+|+++.+||+++.+|.
T Consensus        90 -lp~~~~----------~~--~~~~~----d~~~~~~~~~~~~~~~~~~~~~~~h~~~v~~l~~~p~~~~~lat~~~dg~  152 (430)
T 2xyi_A           90 -LPSEDA----------QF--DGSHY----DNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSD  152 (430)
T ss_dssp             -EC------------------------------------------CEEEEEEEEESSCCSEEEEETTEEEEEEEECSSSC
T ss_pred             -CCCCcc----------cc--ccccc----cccccccccccCCCCceEEEEEEcCCCcEEEEEECCCCCcEEEEECCCCc
Confidence             432211          00  11111    111111111  124444 46789999999999999986689999999999


Q ss_pred             EEEEeCCCCcccccccccccCCCCCccccCCCcEEecCCCCceEEEEeCCCCCCeEEEEeCCCeEEEEecCCCCccc---
Q 039302          194 VQVWDFRSHLNALAESETVAGHGAPQVLNQSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWN---  270 (479)
Q Consensus       194 V~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~v~~l~~s~~~~~~l~sg~~dg~I~lwd~~~~~~~~---  270 (479)
                      |+||++.........           .....++..+.+|...|++|+|+|.+.++|++|+.||.|++|++.......   
T Consensus       153 V~vwd~~~~~~~~~~-----------~~~~~~~~~~~~h~~~v~~l~~~~~~~~~l~s~~~dg~i~vwd~~~~~~~~~~~  221 (430)
T 2xyi_A          153 VLVFDYTKHPSKPEP-----------SGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVI  221 (430)
T ss_dssp             EEEEEGGGSCSSCCT-----------TCCCCCSEEEECCSSCCCCEEECTTSTTEEEEECTTSCEEEEETTSCCBGGGEE
T ss_pred             EEEEECCCcccccCc-----------cccCCCcEEecCCCCCeEEEEeCCCCCCeEEEEeCCCeEEEEeCCCCCCCCcee
Confidence            999999763222110           012577888999999999999999987799999999999999998743211   


Q ss_pred             cCCCCcccCCCcEEEEEECCCCCcEEEEEeCCCcEEEEEcCCCC--ceeeEEecCCCCEEEEEEcCCCCcEEEEEeCCCe
Q 039302          271 VDPNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGK--SALMSFKAHNADVNVISWNRLASCLLASGSDDGT  348 (479)
Q Consensus       271 ~~~~~~~~h~~~V~~l~~sp~~~~~l~s~s~dg~I~iwD~~~~~--~~~~~~~~h~~~v~~l~~~p~~~~~l~sgs~dg~  348 (479)
                      .....+.+|...|.+++|+|.+..+|++++.||.|++||+++..  .++..+..|...|++++|+|++..+|++|+.||.
T Consensus       222 ~~~~~~~~h~~~v~~v~~~p~~~~~l~s~~~dg~i~i~d~~~~~~~~~~~~~~~~~~~v~~i~~~p~~~~~l~tg~~dg~  301 (430)
T 2xyi_A          222 DAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKT  301 (430)
T ss_dssp             ECSEEECCCSSCEEEEEECSSCTTEEEEEETTSEEEEEETTCSCSSSCSEEEECCSSCEEEEEECSSCTTEEEEEETTSE
T ss_pred             ccceeecCCCCCEeeeEEeCCCCCEEEEEeCCCeEEEEECCCCCCCcceeEeecCCCCeEEEEeCCCCCCEEEEEeCCCe
Confidence            11244668999999999999766699999999999999999873  3667778999999999999999779999999999


Q ss_pred             EEEEeCCCCCCCCceEEEeecCCCCeEEEEEeCCCCCEEEEEeCCCcEEEEECCCCCChHHHHHHhhhcccccCCCCCCC
Q 039302          349 FSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSADNQLTIWDLSLEKDEEEEAEFKAKTREQVNAPEDLP  428 (479)
Q Consensus       349 i~iwDlr~~~~~~~~~~~~~~h~~~I~~v~~sp~~~~~las~s~Dg~I~iwdl~~~~~~~~~~~~~~~~~~~~~~~~~~p  428 (479)
                      |++||++....   ++..+..|..+|++++|+|++..+|++++.|++|+|||+..........           .....+
T Consensus       302 v~vwd~~~~~~---~~~~~~~h~~~v~~i~~sp~~~~~l~s~~~d~~i~iwd~~~~~~~~~~~-----------~~~~~~  367 (430)
T 2xyi_A          302 VALWDLRNLKL---KLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTE-----------DAEDGP  367 (430)
T ss_dssp             EEEEETTCTTS---CSEEEECCSSCEEEEEECSSCTTEEEEEETTSCCEEEEGGGTTCCCCHH-----------HHHHCC
T ss_pred             EEEEeCCCCCC---CeEEeecCCCCEEEEEECCCCCCEEEEEeCCCcEEEEeCCCCccccCcc-----------ccccCC
Confidence            99999998654   7889999999999999999887899999999999999998743210000           011456


Q ss_pred             CceEEeecCCC-CeeeEEEeCCCCcEEEEEcCCC-ceEEeeecc
Q 039302          429 PQLLFIHQGQK-DLKELHWHTQVPGMIVSTAADG-FNILMPSNI  470 (479)
Q Consensus       429 ~~l~~~h~g~~-~V~~v~w~p~~~~ll~s~~~dg-i~iw~~~~~  470 (479)
                      +++++.|.+|. .|++++|+|+++++|++++.|+ |+||++...
T Consensus       368 ~~~~~~~~~h~~~v~~~~~~p~~~~~l~s~s~dg~i~iw~~~~~  411 (430)
T 2xyi_A          368 PELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAEN  411 (430)
T ss_dssp             TTEEEECCCCSSCEEEEEECSSSTTEEEEEETTSEEEEEEECHH
T ss_pred             cceEEEcCCCCCCceEEEECCCCCCEEEEEECCCCEEEeEcccc
Confidence            78899998877 5999999999988999999999 999999764



>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 479
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-16
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-11
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-10
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-06
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-15
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-11
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-06
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 6e-11
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-08
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 7e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.001
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.002
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-08
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-04
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.001
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 6e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 6e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-07
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-07
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-07
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-06
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 8e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-04
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-04
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-06
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.001
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.001
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.004
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 6e-06
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 7e-05
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.003
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 8e-04
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 2e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-04
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 75.9 bits (185), Expect = 7e-16
 Identities = 37/248 (14%), Positives = 79/248 (31%), Gaps = 23/248 (9%)

Query: 168 HQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLNQSPLV 227
                 ++        I        +V       + + +  +         +V     + 
Sbjct: 78  SADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVK 137

Query: 228 KFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPAS---------------DATWNVD 272
            F GH++    +  N      + S   +  + +W  A+                 +W  +
Sbjct: 138 TFTGHREWVRMVRPNQDGT-LIASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPE 196

Query: 273 PNPFIGHAASVEDLQWSPTESDVFASCSVDGNIAIWDTRVGKSALMSFKAHNADVNVISW 332
            +      A+  + + S        S S D  I +WD   G   LM+   H+  V  + +
Sbjct: 197 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMC-LMTLVGHDNWVRGVLF 255

Query: 333 NRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPHEGSTLAVSSA 392
           +      + S +DD T  + D +        +     H+H VTS+++       +   S 
Sbjct: 256 HS-GGKFILSCADDKTLRVWDYK----NKRCMKTLNAHEHFVTSLDFHKT-APYVVTGSV 309

Query: 393 DNQLTIWD 400
           D  + +W+
Sbjct: 310 DQTVKVWE 317


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query479
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.94
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.93
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.92
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.89
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.89
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.88
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.86
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.84
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.81
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.8
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.78
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.77
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.76
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.75
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.71
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.6
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.6
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.5
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.49
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.47
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.47
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.25
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.24
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.24
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.12
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.11
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.02
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.99
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.97
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.97
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.94
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.83
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.83
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.82
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.63
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.63
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.59
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.55
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.47
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.41
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.36
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.18
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.14
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.08
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.06
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.98
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.57
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.46
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.43
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.08
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.75
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.52
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 95.77
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.07
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 94.14
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 94.1
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.63
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 92.88
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 92.77
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 92.33
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 91.28
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 91.03
d2ebsa1 427 Oligoxyloglucan reducing end-specific cellobiohydr 88.02
d2ebsa1 427 Oligoxyloglucan reducing end-specific cellobiohydr 87.35
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 86.64
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 84.88
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 84.77
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 83.4
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.03
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 82.77
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 80.32
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.8e-35  Score=283.64  Aligned_cols=292  Identities=14%  Similarity=0.237  Sum_probs=236.7

Q ss_pred             hhhcccccCceeeEEEeeCCCCCCcccCCceEEEEEeecCCCCCCceEEEEEeeecCCccccCCCCCCCCCCCCCCCCCC
Q 039302           63 SLHAFHIGWPCLSFDILRDTLGLVRNEFPYTAYFVAGSQAEKPSWNSIGVFKVSNISGKRRELVPNKPATGDEDADGESS  142 (479)
Q Consensus        63 ~~~~~~~~wP~ls~~~~~d~~~~~~~~~~~~~~~~~gt~~~~~~~n~i~v~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  142 (479)
                      .+|.....-+..++.|-|+.           .+|++|.      ++.|.||++....                       
T Consensus        44 ~~~~~~H~~~V~~v~fs~~g-----------~~latg~------dg~V~iWd~~~~~-----------------------   83 (337)
T d1gxra_          44 QINTLNHGEVVCAVTISNPT-----------RHVYTGG------KGCVKVWDISHPG-----------------------   83 (337)
T ss_dssp             EEEEECCSSCCCEEEECSSS-----------SEEEEEC------BSEEEEEETTSTT-----------------------
T ss_pred             EEEECCCCCcEEEEEECCCC-----------CEEEEEE------CCEEEEEEccCCc-----------------------
Confidence            34555556677788888873           3577762      5689999884210                       


Q ss_pred             CCCCCCccccCCCCCCceeEEEEecCCcceeEEEEecCCCcEEEEEeCCceEEEEeCCCCcccccccccccCCCCCcccc
Q 039302          143 DSDDDSDDEEEGGSGTPILQLRKVAHQGCVNRIRAMSQNPHICASWADTGHVQVWDFRSHLNALAESETVAGHGAPQVLN  222 (479)
Q Consensus       143 ~~~~d~~~~~~~~~~~p~~~~~~~~H~~~V~~v~~~p~~~~~lat~s~dg~V~iwd~~~~~~~~~~~~~~~~~~~~~~~~  222 (479)
                                   ...+.......+|.+.|++++|+|++ .+|++|+.||.|++||+...                   .
T Consensus        84 -------------~~~~~~~~~~~~h~~~I~~v~~s~dg-~~l~s~~~dg~i~iwd~~~~-------------------~  130 (337)
T d1gxra_          84 -------------NKSPVSQLDCLNRDNYIRSCKLLPDG-CTLIVGGEASTLSIWDLAAP-------------------T  130 (337)
T ss_dssp             -------------CCSCSEEEECSCTTSBEEEEEECTTS-SEEEEEESSSEEEEEECCCC--------------------
T ss_pred             -------------ccceeEEeeecCCCCcEEEEEEcCCC-CEEEEeeccccccccccccc-------------------c
Confidence                         02445555677899999999999999 78889999999999998762                   1


Q ss_pred             CCCcEEecCCCCceEEEEeCCCCCCeEEEEeCCCeEEEEecCCCCccccCCCCcccCCCcEEEEEECCCCCcEEEEEeCC
Q 039302          223 QSPLVKFGGHKDEGYAIDWNPVAPGRLVSGDCNSCIHLWEPASDATWNVDPNPFIGHAASVEDLQWSPTESDVFASCSVD  302 (479)
Q Consensus       223 ~~~~~~~~~h~~~v~~l~~s~~~~~~l~sg~~dg~I~lwd~~~~~~~~~~~~~~~~h~~~V~~l~~sp~~~~~l~s~s~d  302 (479)
                      ......+.+|...+.+++|+|++. +|++++.++.|++|++.+....    ....+|...|.+++|++++. .+++|+.|
T Consensus       131 ~~~~~~~~~~~~~v~~~~~~~~~~-~l~s~~~d~~i~~~~~~~~~~~----~~~~~~~~~v~~l~~s~~~~-~~~~~~~d  204 (337)
T d1gxra_         131 PRIKAELTSSAPACYALAISPDSK-VCFSCCSDGNIAVWDLHNQTLV----RQFQGHTDGASCIDISNDGT-KLWTGGLD  204 (337)
T ss_dssp             -EEEEEEECSSSCEEEEEECTTSS-EEEEEETTSCEEEEETTTTEEE----EEECCCSSCEEEEEECTTSS-EEEEEETT
T ss_pred             cccccccccccccccccccccccc-cccccccccccccccccccccc----cccccccccccccccccccc-cccccccc
Confidence            344567788999999999999997 9999999999999999875432    34667899999999999998 99999999


Q ss_pred             CcEEEEEcCCCCceeeEEecCCCCEEEEEEcCCCCcEEEEEeCCCeEEEEeCCCCCCCCceEEEeecCCCCeEEEEEeCC
Q 039302          303 GNIAIWDTRVGKSALMSFKAHNADVNVISWNRLASCLLASGSDDGTFSIHDLRLLKGGDSVVAHFEYHKHPVTSIEWSPH  382 (479)
Q Consensus       303 g~I~iwD~~~~~~~~~~~~~h~~~v~~l~~~p~~~~~l~sgs~dg~i~iwDlr~~~~~~~~~~~~~~h~~~I~~v~~sp~  382 (479)
                      |.|++||+++++ .+. ...|...|++++|+|++ .+|++|+.||.|++||++...     ......|...|++++|+|+
T Consensus       205 ~~v~i~d~~~~~-~~~-~~~~~~~i~~l~~~~~~-~~l~~~~~d~~i~i~d~~~~~-----~~~~~~~~~~i~~v~~s~~  276 (337)
T d1gxra_         205 NTVRSWDLREGR-QLQ-QHDFTSQIFSLGYCPTG-EWLAVGMESSNVEVLHVNKPD-----KYQLHLHESCVLSLKFAYC  276 (337)
T ss_dssp             SEEEEEETTTTE-EEE-EEECSSCEEEEEECTTS-SEEEEEETTSCEEEEETTSSC-----EEEECCCSSCEEEEEECTT
T ss_pred             ccccccccccce-eec-ccccccceEEEEEcccc-cccceeccccccccccccccc-----cccccccccccceEEECCC
Confidence            999999999875 443 34588899999999998 899999999999999999876     3456789999999999996


Q ss_pred             CCCEEEEEeCCCcEEEEECCCCCChHHHHHHhhhcccccCCCCCCCCceEEeecCCCCeeeEEEeCCCCcEEEEEcCCC-
Q 039302          383 EGSTLAVSSADNQLTIWDLSLEKDEEEEAEFKAKTREQVNAPEDLPPQLLFIHQGQKDLKELHWHTQVPGMIVSTAADG-  461 (479)
Q Consensus       383 ~~~~las~s~Dg~I~iwdl~~~~~~~~~~~~~~~~~~~~~~~~~~p~~l~~~h~g~~~V~~v~w~p~~~~ll~s~~~dg-  461 (479)
                      + .+|++++.||.|++||+....                         .+....+...|++++|+|++. +|++++.|+ 
T Consensus       277 g-~~l~s~s~Dg~i~iwd~~~~~-------------------------~~~~~~~~~~v~~~~~s~d~~-~l~t~s~D~~  329 (337)
T d1gxra_         277 G-KWFVSTGKDNLLNAWRTPYGA-------------------------SIFQSKESSSVLSCDISVDDK-YIVTGSGDKK  329 (337)
T ss_dssp             S-SEEEEEETTSEEEEEETTTCC-------------------------EEEEEECSSCEEEEEECTTSC-EEEEEETTSC
T ss_pred             C-CEEEEEeCCCeEEEEECCCCC-------------------------EEEEccCCCCEEEEEEeCCCC-EEEEEeCCCe
Confidence            5 899999999999999998763                         233333456899999999986 677777777 


Q ss_pred             ceEEeee
Q 039302          462 FNILMPS  468 (479)
Q Consensus       462 i~iw~~~  468 (479)
                      |+||++.
T Consensus       330 I~vWdl~  336 (337)
T d1gxra_         330 ATVYEVI  336 (337)
T ss_dssp             EEEEEEE
T ss_pred             EEEEEEE
Confidence            9999873



>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure