Citrus Sinensis ID: 039619


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MEKTVRFGLVCGVGGGGGASSSRFPKRQRSSQQDLDESEYSEEVEEEEFPTVQRQARSQETRAADKGGGSKGNKTADPGKRSNNGPVSVTLKDPEVLDCPVCYEPLTIPVYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISSIENLTSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRIDCHYVIDPKAQRQLIQTGDYTIPHSSAHFFPYQLIKLISGRTTAFADEPSEQDDSGLRAPLVVTGLSLSNRIKLYYYCDPYELGKWASLSGV
ccccEEEccEEEEcccccccccccccHHHcccccccEEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccEEcccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccccccccccccccccEEEEEcccccccEEccccccccccccccccEEEEcccccccccccccccccccEEEccccccccccccccccccccEEEEcccHHHHHcccccccccccccccccEEEEccEEEEcccccccccccccEEEcccccccccccccHHHcccEEEccccccccccccccccccccccccccccEEEEEccccccccccccccc
cccEEEEEEEEEccccccccccccccHHHHHHHHcccccccHHccHcHcccccHHHHHHHEHEHHcccccccccEcccccccccccccccccEEEEcccccccccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccccccccEEEEcccccHHccccHccccccccEEEEcccccHHccccHccccccccEEEEcccccHcccccccccccHcEEEEcccHHHHcHHHHccccHcccccccEEEEEcccccccccccHHHccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHccccccccccccccccEEEEcccEccccccHHHcccccccEccHHHHHHccHHHHHHcccccccccccccccccHccccccccccccHccEEEEEEEcccccccccHHcccc
MEKTVRFGLVcgvgggggasssrfpkrqrssqqdldeseyseeveeeefptvQRQARSQEtraadkgggskgnktadpgkrsnngpvsvtlkdpevldcpvcyepltipvyqlqiipcpsltslwskselpatlENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESiaeglddntsleTMEIFICQNLKALPNGLRNLTSLQYLLiqdcptigsftancfptnlasvcIDYEKIYKplilergpglhrftSVRLLTLfggeccgvvsfppekdtgkalpaslkhlsiwnfpnlerissienltsfeslqlcccpklqkfpdnglptsLLRLEIygcplieerfekdkgqywsliadipcvridchyvidpkaqrqliqtgdytiphssahffpYQLIKLIsgrttafadepseqddsglrapLVVTGLSLsnriklyyycdpyelgkwaslsgv
mektvrfglvcgvgggggasssrfpkrqrssqqdldeseyseeveeeefptvqrqarsqetraadkgggskgnktadpgkrsnngpvsvtlkdpeVLDCPVCYEPLTIPVYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISSIENLTSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRIDCHYVIDPKAQRQLIQTGDYTIPHSSAHFFPYQLIKLISGRTTAFADepseqddsglraPLVVTGLSLSNRIKLYYYCDPyelgkwaslsgv
MEKTVRFglvcgvgggggASSSRFPKRQRSSQQDLDeseyseeveeeeFPTVQRQARSQETRAADKGGGSKGNKTADPGKRSNNGPVSVTLKDPEVLDCPVCYEPLTIPVYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISSIENLTSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRIDCHYVIDPKAQRQLIQTGDYTIPHSSAHFFPYQLIKLISGRTTAFADEPSEQDDSGLRAPLVVTGLSLSNRIKLYYYCDPYELGKWASLSGV
******************************************************************************************LKDPEVLDCPVCYEPLTIPVYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISSIENLTSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRIDCHYVIDPKAQRQLIQTGDYTIPHSSAHFFPYQLIKLISGRTTAF************RAPLVVTGLSLSNRIKLYYYCDPYELGKWA*****
****VRF*LVCGVGGGGGASSSRFPKRQRSSQQDLDESEYSEEVEEEEFPT*QRQARSQETRAADKGGG*******************VTLKDPEVLDCPVCYEPLTIPVYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISSIENLTSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRIDCHYVIDPKAQRQLIQTGDYTIPHSSAHFFPYQLIKLISGR************************LSLSNRIKLYYYCDPYELGKWASL***
MEKTVRFGLVCGVGGG*****************************************************************SNNGPVSVTLKDPEVLDCPVCYEPLTIPVYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISSIENLTSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRIDCHYVIDPKAQRQLIQTGDYTIPHSSAHFFPYQLIKLISGRTTAF*********SGLRAPLVVTGLSLSNRIKLYYYCDPYELGKWASLSGV
*EKTVRFGLVCGVGG****SSSRFPK***********SEYSEEVEEEEFPTVQRQARSQETRAADKGGGSKGNKTADPGKRSNNGPVSVTLKDPEVLDCPVCYEPLTIPVYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISSIENLTSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRIDCHYVIDPKAQRQLIQTGDYTIPHSSAHFFPYQLIKLISGRTTAFADEPSEQDDSGLRAPLVVTGLSLSNRIKLYYYCDPYELGKWASLS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKTVRFGLVCGVGGGGGASSSRFPKRQRSSQQDLDESEYSEEVEEEEFPTVQRQARSQETRAADKGGGSKGNKTADPGKRSNNGPVSVTLKDPEVLDCPVCYEPLTIPVYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISSIENLTSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRIDCHYVIDPKAQRQLIQTGDYTIPHSSAHFFPYQLIKLISGRTTAFADEPSEQDDSGLRAPLVVTGLSLSNRIKLYYYCDPYELGKWASLSGV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query459 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.540 0.174 0.316 1e-16
Q7XA39988 Putative disease resistan N/A no 0.379 0.176 0.260 5e-06
Q84K34349 E3 ubiquitin-protein liga no no 0.228 0.300 0.335 3e-05
Q7XBQ9970 Disease resistance protei N/A no 0.187 0.088 0.390 0.0001
O23530 1301 Protein SUPPRESSOR OF npr no no 0.361 0.127 0.245 0.0008
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 99/313 (31%), Positives = 142/313 (45%), Gaps = 65/313 (20%)

Query: 110  VYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFL-SLRGNLSKA-LKHLYI-ISC 166
            +++L II C SL S +  S  P TL+ +Y+  C KL F  SL+   S + L++L+I  SC
Sbjct: 1118 LHELLIIACHSLES-FPGSHPPTTLKTLYIRDCKKLNFTESLQPTRSYSQLEYLFIGSSC 1176

Query: 167  SNLE------------------------SIAEGL-DDNTSLETMEIFICQNL-------- 193
            SNL                         SI  GL DD  +LE++EI  C NL        
Sbjct: 1177 SNLVNFPLSLFPKLRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGL 1236

Query: 194  ----------------KALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYE 237
                            +ALP  L  LTSL  L I  CP I +     FP+NL ++CI   
Sbjct: 1237 PTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISLC 1296

Query: 238  KIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPN 297
                P I     GL    ++R L + GG    + SFP E      LP S+  L I  F N
Sbjct: 1297 DKLTPRI---EWGLRDLENLRNLEIDGGN-EDIESFPEE----GLLPKSVFSLRISRFEN 1348

Query: 298  LERIS--SIENLTSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQY 355
            L+ ++     +  + E++++  C KLQ   D  LP  L  L I  C L+ E F + + ++
Sbjct: 1349 LKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLP-PLSCLRISSCSLLTETFAEVETEF 1407

Query: 356  WSLIADIPCVRID 368
            + ++ +IP V ID
Sbjct: 1408 FKVL-NIPYVEID 1419




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q84K34|SIL10_ARATH E3 ubiquitin-protein ligase SINA-like 10 OS=Arabidopsis thaliana GN=At5g37930 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query459
356554923 1399 PREDICTED: putative disease resistance R 0.542 0.177 0.355 3e-38
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.557 0.179 0.385 1e-37
400131587 1388 FB_MR5 [Malus x robusta] 0.610 0.201 0.379 2e-35
297742693 731 unnamed protein product [Vitis vinifera] 0.579 0.363 0.402 7e-33
224132254552 predicted protein [Populus trichocarpa] 0.559 0.465 0.374 1e-32
45826061 739 resistance protein [Quercus suber] 0.531 0.330 0.374 7e-32
359495085 1345 PREDICTED: putative disease resistance p 0.498 0.170 0.383 2e-30
359487158 1245 PREDICTED: putative disease resistance p 0.546 0.201 0.391 3e-30
359480367 966 PREDICTED: putative disease resistance p 0.509 0.242 0.376 5e-29
225449872 1322 PREDICTED: putative disease resistance p 0.529 0.183 0.375 1e-28
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  166 bits (419), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 109/307 (35%), Positives = 158/307 (51%), Gaps = 58/307 (18%)

Query: 118  CPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEGLD 177
            CPSLT +    ELP +++++++  CS+L+ LS++G L K+++ L I SC  LESIA  L 
Sbjct: 1096 CPSLTCISRSGELPESVKHLFIWNCSELSCLSMKGQLPKSIERLEIQSCPKLESIANRLH 1155

Query: 178  DNTSLETMEIFICQNLK------------------------------------------- 194
             NTSLE+++I+ C+NLK                                           
Sbjct: 1156 RNTSLESIQIWNCENLKSLPEGLHFLVNLKEIKIIGCPNLVSFPEEGLPASSLSELSIMS 1215

Query: 195  -----ALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGP 249
                 ALPN + NL SL+ L I  CP+I  F    FP NL S+ I+     + +      
Sbjct: 1216 CEKLVALPNSMYNLDSLKELEIGYCPSIQYFPEINFPDNLTSLWINDHNACEAMF---NW 1272

Query: 250  GLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISS--IENL 307
            GL++ + +R LT+ GG       F P +  G  LP++L  L++  FP+LE +SS     L
Sbjct: 1273 GLYKLSFLRDLTIIGGNL-----FMPLEKLGTMLPSTLTSLTVQGFPHLENLSSEGFHKL 1327

Query: 308  TSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRI 367
            TS   L +  CPKL   P+ GLP+SLL L I  CP ++E+  KDKG+ W  IAD+P V I
Sbjct: 1328 TSLSKLSIYNCPKLLCLPEKGLPSSLLELYIQDCPFLKEQCRKDKGRDWLKIADVPYVEI 1387

Query: 368  DCHYVID 374
            D  ++ D
Sbjct: 1388 DGKFIYD 1394




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|297742693|emb|CBI35146.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224132254|ref|XP_002328223.1| predicted protein [Populus trichocarpa] gi|222837738|gb|EEE76103.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|45826061|gb|AAS77675.1| resistance protein [Quercus suber] Back     alignment and taxonomy information
>gi|359495085|ref|XP_003634909.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487158|ref|XP_003633523.1| PREDICTED: putative disease resistance protein RGA4-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480367|ref|XP_003632438.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449872|ref|XP_002265429.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query459
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.605 0.195 0.3 2.8e-16
TAIR|locus:2151476 1168 VICTR "VARIATION IN COMPOUND T 0.392 0.154 0.303 5.5e-10
TAIR|locus:2151466 1353 VICTL "VARIATION IN COMPOUND T 0.392 0.133 0.303 6.5e-10
TAIR|locus:2163426 1187 TAO1 "target of AVRB operation 0.479 0.185 0.265 5.2e-08
TAIR|locus:2098110 1219 AT3G44670 [Arabidopsis thalian 0.483 0.182 0.262 3.1e-07
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.459 0.106 0.267 4.3e-07
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.498 0.192 0.259 6.4e-07
TAIR|locus:20107381007 WRR4 "WHITE RUST RESISTANCE 4" 0.446 0.203 0.264 1.8e-06
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.477 0.180 0.263 2.3e-06
UNIPROTKB|O486471802 O48647 "XA1" [Oryza sativa (ta 0.440 0.112 0.278 4.7e-06
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 236 (88.1 bits), Expect = 2.8e-16, P = 2.8e-16
 Identities = 90/300 (30%), Positives = 140/300 (46%)

Query:    78 PGKRSNNGPVSVTLKDPEVLDCPVCYEPLTIPVYQLQII----PCPSLTSLWSKSELPAT 133
             PG        ++ ++D + L+     +P T    QL+ +     C +L + +  S  P  
Sbjct:  1133 PGSHPPTTLKTLYIRDCKKLNFTESLQP-TRSYSQLEYLFIGSSCSNLVN-FPLSLFPK- 1189

Query:   134 LENIYVDRCSKLAFLSLRGNLSK---ALKHLYIISCSNLESIAEGLDDNTSLETMEIFIC 190
             L ++ +  C      S+   L     AL+ L I  C NLE+  +G      L +M +  C
Sbjct:  1190 LRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNC 1249

Query:   191 QNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPG 250
             + L+ALP  L  LTSL  L I  CP I +     FP+NL ++CI       P I E G  
Sbjct:  1250 KKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISLCDKLTPRI-EWG-- 1306

Query:   251 LHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERIS--SIENLT 308
             L    ++R L + GG    + SFP E   G  LP S+  L I  F NL+ ++     +  
Sbjct:  1307 LRDLENLRNLEIDGGNE-DIESFPEE---G-LLPKSVFSLRISRFENLKTLNRKGFHDTK 1361

Query:   309 SFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRID 368
             + E++++  C KLQ   D  LP  L  L I  C L+ E F + + +++ ++ +IP V ID
Sbjct:  1362 AIETMEISGCDKLQISIDEDLPP-LSCLRISSCSLLTETFAEVETEFFKVL-NIPYVEID 1419


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2151476 VICTR "VARIATION IN COMPOUND TRIGGERED ROOT growth response" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151466 VICTL "VARIATION IN COMPOUND TRIGGERED ROOT growth response-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010738 WRR4 "WHITE RUST RESISTANCE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00660113
hypothetical protein (552 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-09
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 60.7 bits (147), Expect = 1e-09
 Identities = 67/231 (29%), Positives = 95/231 (41%), Gaps = 59/231 (25%)

Query: 153 NLSKA--LKHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLL 210
           +LS A  L+ L +  CS+L  +   +     LE +++  C+NL+ LP G+ NL SL  L 
Sbjct: 652 DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLN 710

Query: 211 IQDCPTIGSF---------------TANCFPTNLASVCIDY--------EKIYK------ 241
           +  C  + SF                   FP+NL    +D         EK+++      
Sbjct: 711 LSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLT 770

Query: 242 PLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPAS------LKHLSIWNF 295
           PL+    P L R     + +L                    LP+S      L+HL I N 
Sbjct: 771 PLMTMLSPSLTRLFLSDIPSLV------------------ELPSSIQNLHKLEHLEIENC 812

Query: 296 PNLERISSIENLTSFESLQLCCCPKLQKFPDNGLPTSLLRLEIYGCPLIEE 346
            NLE + +  NL S ESL L  C +L+ FPD     S L L   G   IEE
Sbjct: 813 INLETLPTGINLESLESLDLSGCSRLRTFPDISTNISDLNLSRTG---IEE 860


syringae 6; Provisional. Length = 1153

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 459
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.85
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.8
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.78
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.7
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.64
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.58
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.57
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.56
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.44
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.41
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.31
KOG0617264 consensus Ras suppressor protein (contains leucine 99.28
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.27
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.19
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.19
KOG0617264 consensus Ras suppressor protein (contains leucine 99.14
PRK15386426 type III secretion protein GogB; Provisional 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.86
KOG4341483 consensus F-box protein containing LRR [General fu 98.83
KOG4341483 consensus F-box protein containing LRR [General fu 98.8
PRK15386426 type III secretion protein GogB; Provisional 98.75
KOG4237498 consensus Extracellular matrix protein slit, conta 98.65
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.54
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.51
KOG4237498 consensus Extracellular matrix protein slit, conta 98.49
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.45
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.42
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.41
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.4
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.31
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.11
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.07
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.03
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.88
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.72
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.69
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.67
PLN03150623 hypothetical protein; Provisional 97.58
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.58
PLN03150623 hypothetical protein; Provisional 97.48
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.16
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.01
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.98
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.92
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.73
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.7
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.7
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.41
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.05
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.88
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 94.51
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.3
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.85
KOG2982418 consensus Uncharacterized conserved protein [Funct 92.44
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.18
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.77
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 90.79
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.06
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.84
KOG2982418 consensus Uncharacterized conserved protein [Funct 89.56
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.43
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 88.59
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 83.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 83.02
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.97  E-value=2.3e-30  Score=289.74  Aligned_cols=342  Identities=20%  Similarity=0.287  Sum_probs=245.4

Q ss_pred             CCCCCcCceEEeCCCCCCCCCccc-------eeEEEEecCCCCccccCCccccccCcEEEeecCCCceeecccccccccc
Q 039619           86 PVSVTLKDPEVLDCPVCYEPLTIP-------VYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKAL  158 (459)
Q Consensus        86 ~lp~~L~~L~l~~c~~l~~l~~lp-------L~~L~l~~c~~l~~lp~~~~~~~~L~~L~l~~c~~l~~l~~~~~lp~~L  158 (459)
                      .+|.+|+.|++.+    +.++.+|       |++|++.+ +.++.+|.....+++|+.|+++++..++.+|....+ ++|
T Consensus       586 ~lp~~Lr~L~~~~----~~l~~lP~~f~~~~L~~L~L~~-s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l-~~L  659 (1153)
T PLN03210        586 YLPPKLRLLRWDK----YPLRCMPSNFRPENLVKLQMQG-SKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMA-TNL  659 (1153)
T ss_pred             hcCcccEEEEecC----CCCCCCCCcCCccCCcEEECcC-ccccccccccccCCCCCEEECCCCCCcCcCCccccC-Ccc
Confidence            5677899999988    4566666       88888877 567788766666778899999888888888866667 888


Q ss_pred             ceEEeecccCCccccccCCCCCcccEEeeccccCcccCcccCCCCCCccEEeeccCCCCccccCCCCCCCccEE------
Q 039619          159 KHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASV------  232 (459)
Q Consensus       159 ~~L~l~~c~~l~~lp~~l~~l~~L~~L~l~~c~~l~~lp~~l~~l~~L~~L~l~~c~~l~~lp~~~~~~~L~~L------  232 (459)
                      ++|++++|..+..+|..+..+++|+.|++++|..++.+|..+ ++++|+.|++++|..++.+|.  .+++|++|      
T Consensus       660 e~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~--~~~nL~~L~L~~n~  736 (1153)
T PLN03210        660 ETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPD--ISTNISWLDLDETA  736 (1153)
T ss_pred             cEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCcccccc--ccCCcCeeecCCCc
Confidence            999998888888888888888889999998888888888765 688888888888877666553  12333333      


Q ss_pred             -----------------------------------------------EEecCcccccccccCCCCCCCCCccCEEEEeCC
Q 039619          233 -----------------------------------------------CIDYEKIYKPLILERGPGLHRFTSVRLLTLFGG  265 (459)
Q Consensus       233 -----------------------------------------------~l~~~~l~~~~~~~~~~~l~~l~~L~~L~l~~~  265 (459)
                                                                     +++++...... |.   .++++++|+.|++++ 
T Consensus       737 i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~l-P~---si~~L~~L~~L~Ls~-  811 (1153)
T PLN03210        737 IEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVEL-PS---SIQNLHKLEHLEIEN-  811 (1153)
T ss_pred             cccccccccccccccccccccchhhccccccccchhhhhccccchheeCCCCCCcccc-Ch---hhhCCCCCCEEECCC-
Confidence                                                           33332111111 22   456778888888888 


Q ss_pred             cCCCceecCCCCCCCccCCCCcceEEeecCCCCC--------------------ccC-CCCCCCCCCEEeccCCCCCCcC
Q 039619          266 ECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLE--------------------RIS-SIENLTSFESLQLCCCPKLQKF  324 (459)
Q Consensus       266 ~c~~l~~l~~~~~~~~~~~~~L~~L~l~~c~~l~--------------------~l~-~l~~l~~L~~L~l~~c~~l~~l  324 (459)
                       |..++.+|...     .+++|+.|++++|..++                    .+| ++..+++|+.|++++|++++.+
T Consensus       812 -C~~L~~LP~~~-----~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l  885 (1153)
T PLN03210        812 -CINLETLPTGI-----NLESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRV  885 (1153)
T ss_pred             -CCCcCeeCCCC-----CccccCEEECCCCCccccccccccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCcc
Confidence             77787777654     45666666666665443                    444 5566788888999999888888


Q ss_pred             CCC-CCCCCcceEEeeCCchhHHhhhcCcCCc--------cccccCCCeEEeCceeeeCHHHHhhhhhcC---cEEecCC
Q 039619          325 PDN-GLPTSLLRLEIYGCPLIEERFEKDKGQY--------WSLIADIPCVRIDCHYVIDPKAQRQLIQTG---DYTIPHS  392 (459)
Q Consensus       325 p~~-~l~~sL~~L~i~~c~~L~~~~~~~~~~~--------~~~i~~i~~l~~~~~~~l~~~~~~~~~~~~---~~~~p~~  392 (459)
                      |.. .-+++|+.+++.+|+.|+..........        ...+.....+.+.+|+++++.+.  +.++.   .+.+||.
T Consensus       886 ~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~~~a~--l~~~~~~~~~~l~g~  963 (1153)
T PLN03210        886 SLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEAL--LQQQSIFKQLILSGE  963 (1153)
T ss_pred             CcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCCCchhh--hcccccceEEECCCc
Confidence            763 2257888889999988875422110000        00111223467889999998774  23222   4789999


Q ss_pred             Cc-eecccccccccCCcEEE-EeCCCCcc--cccCceeeeEEeecccc---cceeEEEEeccc-ccccc
Q 039619          393 SA-HFFPYQLIKLISGRTTA-FADEPSEQ--DDSGLRAPLVVTGLSLS---NRIKLYYYCDPY-ELGKW  453 (459)
Q Consensus       393 ~~-~~~~~~~~~~~~g~~~~-~~~~~~~~--~~~gf~~~~~~~~~~~~---~~~~~~~~~~~~-~~~~~  453 (459)
                      ++ .||.|+..    |.+++ |.+++.|.  .|.||++|+|+++....   ..+.+.|.|+++ ..|.+
T Consensus       964 evp~~f~hr~~----g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~~~ 1028 (1153)
T PLN03210        964 EVPSYFTHRTT----GASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVSFDIQVCCRFIDRLGNH 1028 (1153)
T ss_pred             cCchhccCCcc----cceeeeeccCCcccCCCccceEEEEEEecCccccCCCceeEEEEEEEECCCCCc
Confidence            99 99999999    99998 99999887  69999999999886542   366788888887 44544



syringae 6; Provisional

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 65.4 bits (160), Expect = 8e-12
 Identities = 53/244 (21%), Positives = 85/244 (34%), Gaps = 44/244 (18%)

Query: 119 PSLTSLW----SKSELPATLENIYVDRCSKLAFLSLRGN-LS---------KALKHLYII 164
            +  +      +   L AT + +          L LR   L            L+H+ I 
Sbjct: 53  ANSNNPQIETRTGRALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTI- 111

Query: 165 SCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANC 224
             + L  + + +     LET+ +     L+ALP  + +L  L+ L I+ CP +       
Sbjct: 112 DAAGLMELPDTMQQFAGLETLTLARNP-LRALPASIASLNRLRELSIRACPELTE----- 165

Query: 225 FPTNLASVCIDYEKIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALP 284
            P  LAS              +         +++ L L   E  G+ S P          
Sbjct: 166 LPEPLAS-------------TDASGEHQGLVNLQSLRL---EWTGIRSLPAS--IANL-- 205

Query: 285 ASLKHLSIWNFPNLERI-SSIENLTSFESLQLCCCPKLQKFPDN-GLPTSLLRLEIYGCP 342
            +LK L I N   L  +  +I +L   E L L  C  L+ +P   G    L RL +  C 
Sbjct: 206 QNLKSLKIRNS-PLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCS 264

Query: 343 LIEE 346
            +  
Sbjct: 265 NLLT 268


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query459
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.86
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.82
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.81
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.81
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.81
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.81
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.8
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.8
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.8
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.79
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.79
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.79
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.79
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.79
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.78
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.78
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.78
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.78
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.77
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.77
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.77
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.77
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.75
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.75
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.75
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.74
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.74
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.73
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.73
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.73
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.72
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.72
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.72
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.72
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.72
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.71
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.71
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.71
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.71
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.68
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.65
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.64
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.64
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.62
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.62
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.61
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.6
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.6
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.59
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.59
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.59
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.58
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.54
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.5
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.5
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.49
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.49
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.48
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.48
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.47
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.46
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.46
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.45
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.45
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.44
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.41
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.4
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.4
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.4
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.39
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.39
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.37
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.37
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.31
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.29
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.29
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.27
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.27
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.21
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.19
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.16
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.1
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.01
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.99
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.93
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.93
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.92
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.89
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.87
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.85
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.82
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.82
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.82
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.78
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.77
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.74
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.39
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.18
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.91
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.55
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.52
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.44
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.99
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.97
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.86
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.12
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.2
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.0
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.96
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.12
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.04
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.87  E-value=5.4e-21  Score=186.99  Aligned_cols=293  Identities=15%  Similarity=0.112  Sum_probs=198.4

Q ss_pred             CCCCCCeEeccCCCccCcccccCCccCCccceeeccccccccccCCCCCCCcccCCCCCCCCCCCCCCcCceEEeCCCCC
Q 039619           23 RFPKRQRSSQQDLDESEYSEEVEEEEFPTVQRQARSQETRAADKGGGSKGNKTADPGKRSNNGPVSVTLKDPEVLDCPVC  102 (459)
Q Consensus        23 ~f~~L~~L~l~~~~~~~~~~~~~~~~~p~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lp~~L~~L~l~~c~~l  102 (459)
                      .+++|++|++.+...... .  ....+++|++|.+.++....           +     .....+ ++|++|++++|   
T Consensus        42 ~l~~L~~L~l~~~~i~~~-~--~~~~~~~L~~L~l~~n~i~~-----------~-----~~~~~l-~~L~~L~L~~n---   98 (347)
T 4fmz_A           42 ELESITKLVVAGEKVASI-Q--GIEYLTNLEYLNLNGNQITD-----------I-----SPLSNL-VKLTNLYIGTN---   98 (347)
T ss_dssp             HHTTCSEEECCSSCCCCC-T--TGGGCTTCCEEECCSSCCCC-----------C-----GGGTTC-TTCCEEECCSS---
T ss_pred             hcccccEEEEeCCccccc-h--hhhhcCCccEEEccCCcccc-----------c-----hhhhcC-CcCCEEEccCC---
Confidence            578899999887654322 1  24468889999998774220           0     011233 48889998886   


Q ss_pred             CCCCccc-------eeEEEEecCCCCccccCCccccccCcEEEeecCCCceeeccccccccccceEEeecccCCcccccc
Q 039619          103 YEPLTIP-------VYQLQIIPCPSLTSLWSKSELPATLENIYVDRCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEG  175 (459)
Q Consensus       103 ~~l~~lp-------L~~L~l~~c~~l~~lp~~~~~~~~L~~L~l~~c~~l~~l~~~~~lp~~L~~L~l~~c~~l~~lp~~  175 (459)
                       .+..+|       |++|++++ +.++.++. ...+++|++|++++|..+..++....+ ++|++|++++| .+..++. 
T Consensus        99 -~i~~~~~~~~l~~L~~L~l~~-n~i~~~~~-~~~l~~L~~L~l~~n~~~~~~~~~~~l-~~L~~L~l~~~-~~~~~~~-  172 (347)
T 4fmz_A           99 -KITDISALQNLTNLRELYLNE-DNISDISP-LANLTKMYSLNLGANHNLSDLSPLSNM-TGLNYLTVTES-KVKDVTP-  172 (347)
T ss_dssp             -CCCCCGGGTTCTTCSEEECTT-SCCCCCGG-GTTCTTCCEEECTTCTTCCCCGGGTTC-TTCCEEECCSS-CCCCCGG-
T ss_pred             -cccCchHHcCCCcCCEEECcC-CcccCchh-hccCCceeEEECCCCCCcccccchhhC-CCCcEEEecCC-CcCCchh-
Confidence             333333       88999977 45667764 555668999999888777777766677 88899998886 4555544 


Q ss_pred             CCCCCcccEEeeccccCcccCcccCCCCCCccEEeeccCCCCccccCCCCCCCccEEEEecCcccccccccCCCCCCCCC
Q 039619          176 LDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPGLHRFT  255 (459)
Q Consensus       176 l~~l~~L~~L~l~~c~~l~~lp~~l~~l~~L~~L~l~~c~~l~~lp~~~~~~~L~~L~l~~~~l~~~~~~~~~~~l~~l~  255 (459)
                      +..+++|++|++++| .+..++. +..+++|+.|+++++ .+..++....+++|++|+++++.++...      .+..++
T Consensus       173 ~~~l~~L~~L~l~~n-~l~~~~~-~~~l~~L~~L~l~~n-~l~~~~~~~~~~~L~~L~l~~n~l~~~~------~~~~l~  243 (347)
T 4fmz_A          173 IANLTDLYSLSLNYN-QIEDISP-LASLTSLHYFTAYVN-QITDITPVANMTRLNSLKIGNNKITDLS------PLANLS  243 (347)
T ss_dssp             GGGCTTCSEEECTTS-CCCCCGG-GGGCTTCCEEECCSS-CCCCCGGGGGCTTCCEEECCSSCCCCCG------GGTTCT
T ss_pred             hccCCCCCEEEccCC-ccccccc-ccCCCccceeecccC-CCCCCchhhcCCcCCEEEccCCccCCCc------chhcCC
Confidence            777888999998887 5556654 677888888888775 4445444445778888888887776544      467888


Q ss_pred             ccCEEEEeCCcCCCceecCCCCCCCccCCCCcceEEeecCCCCCccCCCCCCCCCCEEeccCCCCCCcCCCCC--CCCCc
Q 039619          256 SVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISSIENLTSFESLQLCCCPKLQKFPDNG--LPTSL  333 (459)
Q Consensus       256 ~L~~L~l~~~~c~~l~~l~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~l~~l~~L~~L~l~~c~~l~~lp~~~--l~~sL  333 (459)
                      +|++|++++   +.+..++..     ..+++|++|++++ +.++.++.+..+++|++|++++|. +...+...  -+++|
T Consensus       244 ~L~~L~l~~---n~l~~~~~~-----~~l~~L~~L~l~~-n~l~~~~~~~~l~~L~~L~L~~n~-l~~~~~~~l~~l~~L  313 (347)
T 4fmz_A          244 QLTWLEIGT---NQISDINAV-----KDLTKLKMLNVGS-NQISDISVLNNLSQLNSLFLNNNQ-LGNEDMEVIGGLTNL  313 (347)
T ss_dssp             TCCEEECCS---SCCCCCGGG-----TTCTTCCEEECCS-SCCCCCGGGGGCTTCSEEECCSSC-CCGGGHHHHHTCTTC
T ss_pred             CCCEEECCC---CccCCChhH-----hcCCCcCEEEccC-CccCCChhhcCCCCCCEEECcCCc-CCCcChhHhhccccC
Confidence            888888888   355555432     2667888888888 577777766778888888888864 44333211  25788


Q ss_pred             ceEEeeCCchhHHhhhcCcCCccccccCCCeEEeCce
Q 039619          334 LRLEIYGCPLIEERFEKDKGQYWSLIADIPCVRIDCH  370 (459)
Q Consensus       334 ~~L~i~~c~~L~~~~~~~~~~~~~~i~~i~~l~~~~~  370 (459)
                      ++|++++|+- ....      ....+.++..+.+.++
T Consensus       314 ~~L~L~~n~l-~~~~------~~~~l~~L~~L~l~~N  343 (347)
T 4fmz_A          314 TTLFLSQNHI-TDIR------PLASLSKMDSADFANQ  343 (347)
T ss_dssp             SEEECCSSSC-CCCG------GGGGCTTCSEESSSCC
T ss_pred             CEEEccCCcc-cccc------Chhhhhccceeehhhh
Confidence            8888888862 2211      1233445666666554



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 459
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 36.9 bits (84), Expect = 0.004
 Identities = 25/196 (12%), Positives = 55/196 (28%), Gaps = 15/196 (7%)

Query: 141 RCSKLAFLSLRGNLSKALKHLYIISCSNLESIAEG-LDDNTSLETMEIFICQNLKALPNG 199
           +CS L    +  +L      L +   + +  I +G   +  +L T+ +   +  K  P  
Sbjct: 16  QCSDLGLEKVPKDLPPDTALLDL-QNNKITEIKDGDFKNLKNLHTLILINNKISKISPGA 74

Query: 200 LRNLTSLQYLLIQDCPTIGSFTANCFPTNLASVCIDYEKIYKPLILERGPGLHRFTSVRL 259
              L  L+ L +              P  +     +       +   R    +    + +
Sbjct: 75  FAPLVKLERLYLSKNQL------KELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIV 128

Query: 260 LTLFGGECCGVVSFPPEKDTGKALPA------SLKHLSIWNFPNLERIS-SIENLTSFES 312
           + L                  K L        ++  +     P+L  +      +T  ++
Sbjct: 129 VELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDA 188

Query: 313 LQLCCCPKLQKFPDNG 328
             L     L K   + 
Sbjct: 189 ASLKGLNNLAKLGLSF 204


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query459
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.65
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.65
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.63
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.6
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.55
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.53
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.52
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.52
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.43
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.38
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.27
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.91
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.89
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.88
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.82
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.79
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.77
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.53
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.39
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.28
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.81
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.65
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.6
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.35
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 94.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 90.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 86.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 81.98
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 80.31
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.65  E-value=3.9e-15  Score=144.57  Aligned_cols=169  Identities=20%  Similarity=0.192  Sum_probs=106.1

Q ss_pred             cccccccceEEeecccCCccccccCCCCCcccEEeeccccCcccCcccCCCCCCccEEeeccCCCCccccCCCCCCCccE
Q 039619          152 GNLSKALKHLYIISCSNLESIAEGLDDNTSLETMEIFICQNLKALPNGLRNLTSLQYLLIQDCPTIGSFTANCFPTNLAS  231 (459)
Q Consensus       152 ~~lp~~L~~L~l~~c~~l~~lp~~l~~l~~L~~L~l~~c~~l~~lp~~l~~l~~L~~L~l~~c~~l~~lp~~~~~~~L~~  231 (459)
                      ..+ ++++.++++++ .+..++. ...+++|++|+++++ .++.++ .+..+++|+.|++++|. +..++....+++|++
T Consensus       194 ~~l-~~~~~l~l~~n-~i~~~~~-~~~~~~L~~L~l~~n-~l~~~~-~l~~l~~L~~L~l~~n~-l~~~~~~~~~~~L~~  267 (384)
T d2omza2         194 AKL-TNLESLIATNN-QISDITP-LGILTNLDELSLNGN-QLKDIG-TLASLTNLTDLDLANNQ-ISNLAPLSGLTKLTE  267 (384)
T ss_dssp             GGC-TTCSEEECCSS-CCCCCGG-GGGCTTCCEEECCSS-CCCCCG-GGGGCTTCSEEECCSSC-CCCCGGGTTCTTCSE
T ss_pred             ccc-cccceeeccCC-ccCCCCc-ccccCCCCEEECCCC-CCCCcc-hhhcccccchhccccCc-cCCCCcccccccCCE
Confidence            445 67777777764 4444432 345677778887776 455553 45677777888777753 555555555677788


Q ss_pred             EEEecCcccccccccCCCCCCCCCccCEEEEeCCcCCCceecCCCCCCCccCCCCcceEEeecCCCCCccCCCCCCCCCC
Q 039619          232 VCIDYEKIYKPLILERGPGLHRFTSVRLLTLFGGECCGVVSFPPEKDTGKALPASLKHLSIWNFPNLERISSIENLTSFE  311 (459)
Q Consensus       232 L~l~~~~l~~~~~~~~~~~l~~l~~L~~L~l~~~~c~~l~~l~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~l~~l~~L~  311 (459)
                      |+++++.+....      .+..++.++.+.+..   +.+..++..     ..+++++.|++++ ++++.++.+..+++|+
T Consensus       268 L~l~~~~l~~~~------~~~~~~~l~~l~~~~---n~l~~~~~~-----~~~~~l~~L~ls~-n~l~~l~~l~~l~~L~  332 (384)
T d2omza2         268 LKLGANQISNIS------PLAGLTALTNLELNE---NQLEDISPI-----SNLKNLTYLTLYF-NNISDISPVSSLTKLQ  332 (384)
T ss_dssp             EECCSSCCCCCG------GGTTCTTCSEEECCS---SCCSCCGGG-----GGCTTCSEEECCS-SCCSCCGGGGGCTTCC
T ss_pred             eeccCcccCCCC------ccccccccccccccc---ccccccccc-----chhcccCeEECCC-CCCCCCcccccCCCCC
Confidence            887776665433      446677777777766   234333322     1556777777776 5666665566677777


Q ss_pred             EEeccCCCCCCcCCCCCCCCCcceEEeeCCc
Q 039619          312 SLQLCCCPKLQKFPDNGLPTSLLRLEIYGCP  342 (459)
Q Consensus       312 ~L~l~~c~~l~~lp~~~l~~sL~~L~i~~c~  342 (459)
                      +|++++| +++.++.-.-+++|++|++++|.
T Consensus       333 ~L~L~~n-~l~~l~~l~~l~~L~~L~l~~N~  362 (384)
T d2omza2         333 RLFFANN-KVSDVSSLANLTNINWLSAGHNQ  362 (384)
T ss_dssp             EEECCSS-CCCCCGGGGGCTTCCEEECCSSC
T ss_pred             EEECCCC-CCCCChhHcCCCCCCEEECCCCc
Confidence            7777776 56666542225677777777663



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure