Citrus Sinensis ID: 039650

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
LLSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNELSGQLSPELGSLIQLEY
cEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccEEEEccccccccccccccEEccccccEEcccHHHHccccccccccccccccccEEEEEccccccccccccEEEccccccEEcccccccccccccEEEccccccEEEccHHccccccccEEEcccccccccccccccccccccEEEccccEEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHcccccccccEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHHHccccEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccc
ccccccccccccccHHHcccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHcccccccEEEEcEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccHccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccc
llsfsknqlsglipheigrlssfnglsLYSNflkgsippslgnltslSYIGisnnllsgsipneveSLKSLSDLRLYNNtlkgsipsslgnltnLVNLHLHINALsglipdeirNLEFLSDLIYNYLIYWINALSDlipneignlkslsdlrldyntlsgsipysfgnLTKLVTLYLDtnalsgsipDEIRNLKSLFNLqldnntlsgsiplslgnltnlTTLYFSMNalsgsipneitnlrslsdlqlsentlngsiplalGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILdlssnklnGSILLSLANLTNSLKVLYLSSnhivgeiplghgkfSSLIQLILTnnelsgqlspelgsliqley
LLSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNelsgqlspelgsliqley
LLSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGnltnlttlYFSMNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNELSGQLSPELGSLIQLEY
***********LIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNE*****************
LLSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNELSGQLSPELGSLIQLEY
LLSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNELSGQLSPELGSLIQLEY
LLSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNELSGQLSPELGSLIQL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LLSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNELSGQLSPELGSLIQLEY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query391 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep yes no 0.884 0.308 0.42 7e-63
Q9SHI2 1101 Leucine-rich repeat recep no no 0.982 0.348 0.404 6e-59
Q8VZG8 1045 Probable LRR receptor-lik no no 0.979 0.366 0.383 1e-57
Q9LHP4 1141 Receptor-like protein kin no no 0.982 0.336 0.397 2e-57
C0LGV1 1135 LRR receptor-like serine/ no no 0.943 0.325 0.422 2e-57
C0LGQ5 1249 LRR receptor-like serine/ no no 0.961 0.301 0.412 5e-57
Q9LVP0 1102 Probable leucine-rich rep no no 0.951 0.337 0.423 1e-56
C0LGF5 1072 Probable LRR receptor-lik no no 0.946 0.345 0.376 2e-54
C0LGR3 1091 Probable LRR receptor-lik no no 0.982 0.351 0.402 4e-54
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.953 0.297 0.389 8e-54
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score =  241 bits (615), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 168/400 (42%), Positives = 223/400 (55%), Gaps = 54/400 (13%)

Query: 2   LSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSI 61
           +  S N LSG IP + G LS      L +N L G I PSLGNL +L+ + +  N L+  I
Sbjct: 107 VDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEISPSLGNLKNLTVLYLHQNYLTSVI 166

Query: 62  PNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSD 121
           P+E+ +++S++DL L  N L GSIPSSLGNL NL+ L+L+ N L+G+IP E+        
Sbjct: 167 PSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVLYLYENYLTGVIPPEL-------- 218

Query: 122 LIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNA 181
                                GN++S++DL L  N L+GSIP + GNL  L+ LYL  N 
Sbjct: 219 ---------------------GNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENY 257

Query: 182 LSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEITNL 241
           L+G IP EI N++S+ NL L  N L+GSIP SLGNL NLT L    N L+G IP ++ N+
Sbjct: 258 LTGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNI 317

Query: 242 RSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENS 301
            S+ DL+LS N L GSIP +LGNL  L +LYL  N L+G I     ++ S+ +L L  N 
Sbjct: 318 ESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNK 377

Query: 302 LCDS------------------------IQKEIGDMKSLSILDLSSNKLNGSILLSLANL 337
           L  S                        I +E+G+M+S+  LDLS NKL GS+  S  N 
Sbjct: 378 LTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNF 437

Query: 338 TNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNELSG 377
           T  L+ LYL  NH+ G IP G    S L  LIL  N  +G
Sbjct: 438 T-KLESLYLRVNHLSGAIPPGVANSSHLTTLILDTNNFTG 476

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query391
3894393 1016 Hcr2-5D [Solanum lycopersicum var. ceras 0.979 0.376 0.506 2e-74
60327200 991 Hcr2-p1.1 [Solanum pimpinellifolium] 0.976 0.385 0.497 8e-72
60327198 991 Hcr2-p1.2 [Solanum pimpinellifolium] 0.976 0.385 0.497 9e-72
3894383 968 disease resistance protein [Solanum lyco 0.979 0.395 0.496 1e-71
297739603 980 unnamed protein product [Vitis vinifera] 0.994 0.396 0.461 5e-71
3894387 944 Hcr2-0B [Solanum lycopersicum] 0.976 0.404 0.492 2e-70
359487164 1378 PREDICTED: probable leucine-rich repeat 0.964 0.273 0.507 5e-70
60327228487 Hcr2-p7.8 [Solanum pimpinellifolium] 0.969 0.778 0.498 9e-70
60327226487 Hcr2-p7.7 [Solanum pimpinellifolium] 0.969 0.778 0.498 9e-70
60327220487 Hcr2-p7.4 [Solanum pimpinellifolium] gi| 0.969 0.778 0.498 9e-70
>gi|3894393|gb|AAC78596.1| Hcr2-5D [Solanum lycopersicum var. cerasiforme] Back     alignment and taxonomy information
 Score =  285 bits (730), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 205/405 (50%), Positives = 255/405 (62%), Gaps = 22/405 (5%)

Query: 6   KNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEV 65
           +NQLSG IP EIG L S   LSL  NFL GSIP SLGNL +LS++ + NN LSGSIP E+
Sbjct: 200 ENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEI 259

Query: 66  ESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEI---RNLEFLSDL 122
             L+SL+ L L  N L GSIP+SLGNL NL  L L+ N LSG IP+EI   R+L +L DL
Sbjct: 260 GYLRSLTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYL-DL 318

Query: 123 IYN----------------YLIY-WINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYS 165
             N                +++Y + N LS  IP EIG L+SL+ L L  N L+GSIP S
Sbjct: 319 GENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLRSLTYLDLGENALNGSIPAS 378

Query: 166 FGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYF 225
            GNL  L  L L  N LSGSIP+EI  L+SL  L L  N L+GSIP SLGNL NL  LY 
Sbjct: 379 LGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYL 438

Query: 226 SMNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLS 285
             N LSGSIP EI  L SL++L L  N+LNGSIP +LGNL  L +LYL  N+LSGSI   
Sbjct: 439 YNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEE 498

Query: 286 YASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLY 345
              L+SLT L+L  NSL  SI   +G++ +LS L L +N+L+GSI  S  N+ N L+ L+
Sbjct: 499 IGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRN-LQTLF 557

Query: 346 LSSNHIVGEIPLGHGKFSSLIQLILTNNELSGQLSPELGSLIQLE 390
           LS N ++GEIP      +SL  L ++ N L G++   LG++  L 
Sbjct: 558 LSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCLGNISDLH 602

Source: Solanum lycopersicum var. cerasiforme

Species: Solanum lycopersicum

Genus: Solanum

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|60327200|gb|AAX19023.1| Hcr2-p1.1 [Solanum pimpinellifolium] Back     alignment and taxonomy information
>gi|60327198|gb|AAX19022.1| Hcr2-p1.2 [Solanum pimpinellifolium] Back     alignment and taxonomy information
>gi|3894383|gb|AAC78591.1| disease resistance protein [Solanum lycopersicum var. cerasiforme] Back     alignment and taxonomy information
>gi|297739603|emb|CBI29785.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|3894387|gb|AAC78593.1| Hcr2-0B [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|359487164|ref|XP_003633525.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|60327228|gb|AAX19037.1| Hcr2-p7.8 [Solanum pimpinellifolium] Back     alignment and taxonomy information
>gi|60327226|gb|AAX19036.1| Hcr2-p7.7 [Solanum pimpinellifolium] Back     alignment and taxonomy information
>gi|60327220|gb|AAX19033.1| Hcr2-p7.4 [Solanum pimpinellifolium] gi|60327222|gb|AAX19034.1| Hcr2-p7.5 [Solanum pimpinellifolium] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query391
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.956 0.333 0.448 7.5e-71
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.966 0.333 0.407 7.9e-60
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.982 0.336 0.384 1.7e-59
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.961 0.341 0.416 4e-59
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.969 0.337 0.411 1.9e-58
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.976 0.365 0.381 2.3e-58
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.976 0.305 0.402 4.5e-58
TAIR|locus:2020417 1101 AT1G17230 [Arabidopsis thalian 0.979 0.347 0.387 6.2e-58
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.969 0.347 0.371 4.3e-57
TAIR|locus:2131518 1091 AT4G26540 [Arabidopsis thalian 0.984 0.352 0.387 4.4e-57
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 723 (259.6 bits), Expect = 7.5e-71, P = 7.5e-71
 Identities = 171/381 (44%), Positives = 230/381 (60%)

Query:     2 LSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSI 61
             +  S N LSG IP + G LS      L +N L G I PSLGNL +L+ + +  N L+  I
Sbjct:   107 VDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEISPSLGNLKNLTVLYLHQNYLTSVI 166

Query:    62 PNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSD 121
             P+E+ +++S++DL L  N L GSIPSSLGNL NL+ L+L+ N L+G+IP E+ N+E ++D
Sbjct:   167 PSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVLYLYENYLTGVIPPELGNMESMTD 226

Query:   122 LIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNA 181
             L  +      N L+  IP+ +GNLK+L  L L  N L+G IP   GN+  +  L L  N 
Sbjct:   227 LALSQ-----NKLTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNK 281

Query:   182 LSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGXXXXXXXXYFSMNALSGSIPNEITNL 241
             L+GSIP  + NLK+L  L L  N L+G IP  LG          S N L+GSIP+ + NL
Sbjct:   282 LTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNL 341

Query:   242 RSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENS 301
             ++L+ L L EN L G IP  LGN+  ++ L L+ NKL+GSI  S+ +L +LT LYLY N 
Sbjct:   342 KNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNY 401

Query:   302 LCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGK 361
             L   I +E+G+M+S+  LDLS NKL GS+  S  N T  L+ LYL  NH+ G IP G   
Sbjct:   402 LTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTK-LESLYLRVNHLSGAIPPGVAN 460

Query:   362 FSSLIQLILTNNELSGQLSPE 382
              S L  LIL  N  +G   PE
Sbjct:   461 SSHLTTLILDTNNFTG-FFPE 480
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131518 AT4G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00017153001
SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (1389 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-64
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-57
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-55
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-35
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  221 bits (564), Expect = 2e-64
 Identities = 174/431 (40%), Positives = 223/431 (51%), Gaps = 54/431 (12%)

Query: 2   LSFSKNQLSGLIPHEIGRLS-SFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGS 60
           ++ S NQLSG IP +I   S S   L+L +N   GSIP   G++ +L  + +SNN+LSG 
Sbjct: 98  INLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGE 155

Query: 61  IPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLS 120
           IPN++ S  SL  L L  N L G IP+SL NLT+L  L L  N L G IP E+  ++   
Sbjct: 156 IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMK--- 212

Query: 121 DLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTN 180
            L + YL Y  N LS  IP EIG L SL+ L L YN L+G IP S GNL  L  L+L  N
Sbjct: 213 SLKWIYLGY--NNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQN 270

Query: 181 ALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEITN 240
            LSG IP  I +L+ L +L L +N+LSG IP  +  L NL  L+   N  +G IP  +T+
Sbjct: 271 KLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTS 330

Query: 241 LRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYEN 300
           L  L  LQL  N  +G IP  LG    L VL LS N L+G I     S  +L  L L+ N
Sbjct: 331 LPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSN 390

Query: 301 SLCDSIQKEIGDMKSLS------------------------ILDLSSNKLNGSI------ 330
           SL   I K +G  +SL                          LD+S+N L G I      
Sbjct: 391 SLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWD 450

Query: 331 -----LLSLA------NLTNS-----LKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNE 374
                +LSLA       L +S     L+ L LS N   G +P   G  S L+QL L+ N+
Sbjct: 451 MPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENK 510

Query: 375 LSGQLSPELGS 385
           LSG++  EL S
Sbjct: 511 LSGEIPDELSS 521

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 391
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.34
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.28
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.24
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.22
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.97
PLN03150623 hypothetical protein; Provisional 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.84
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.83
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.83
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.71
PLN03150623 hypothetical protein; Provisional 98.69
KOG4341483 consensus F-box protein containing LRR [General fu 98.67
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.53
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.48
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.27
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.26
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.22
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.22
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.21
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.03
KOG4341483 consensus F-box protein containing LRR [General fu 97.97
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.96
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.83
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.79
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.76
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.74
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.7
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.52
PRK15386 426 type III secretion protein GogB; Provisional 97.48
PRK15386 426 type III secretion protein GogB; Provisional 97.42
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.35
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.29
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.92
KOG1947 482 consensus Leucine rich repeat proteins, some prote 96.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.73
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.8
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.62
KOG4308 478 consensus LRR-containing protein [Function unknown 95.27
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.63
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.38
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.37
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.61
KOG4308 478 consensus LRR-containing protein [Function unknown 92.56
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.59
smart0037026 LRR Leucine-rich repeats, outliers. 88.59
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.23
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 87.58
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 86.01
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.6
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.6e-41  Score=338.93  Aligned_cols=382  Identities=39%  Similarity=0.544  Sum_probs=251.8

Q ss_pred             cccccCccCCCchhhhhcCCcccEEeecCCcCCCCCCCCCCCCCCccEEecCCcccccCChhhhhcCCCCCEEEeeCCcc
Q 039650            2 LSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVESLKSLSDLRLYNNTL   81 (391)
Q Consensus         2 l~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~   81 (391)
                      |++++|.+.+..+..+.++++|++|++++|.+.+..|..+.++++|++|++++|.+.+..|..+.++++|++|++++|.+
T Consensus       145 L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l  224 (968)
T PLN00113        145 LDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNL  224 (968)
T ss_pred             EECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCcc
Confidence            56666777666677777777777777777777667777777777777777777777666777777777777777777777


Q ss_pred             CCCCcccccCCCCCceEEecccccccccchhhcccccchhhhhceeeeccccccccccccccCCCCCCEEECCCCCCCCC
Q 039650           82 KGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLSDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGS  161 (391)
Q Consensus        82 ~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~l~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~  161 (391)
                      .+..|..+..+++|++|++++|.+.+..|..+.++.+|+.|.+     ..+.+....+..+.++++|+.|++++|.+...
T Consensus       225 ~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L-----~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~  299 (968)
T PLN00113        225 SGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFL-----YQNKLSGPIPPSIFSLQKLISLDLSDNSLSGE  299 (968)
T ss_pred             CCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEEC-----cCCeeeccCchhHhhccCcCEEECcCCeeccC
Confidence            7667777777777777777777777666777777777774433     33444444555566666666666666666555


Q ss_pred             CCCCcCCCCCccEEEcCCCcCCCCCCccccCCCcccEEEccCCCCCCCccccccCCCcccEEEccCcccccccchh----
Q 039650          162 IPYSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNE----  237 (391)
Q Consensus       162 ~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~----  237 (391)
                      .|..+..+++|+.|++.+|.+....+..+..+++|+.|++++|.+....+..+..+++|+.+++++|.+....+..    
T Consensus       300 ~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~  379 (968)
T PLN00113        300 IPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSS  379 (968)
T ss_pred             CChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCc
Confidence            5555666666666666666665555555556666666666666555444555555555555555555544333443    


Q ss_pred             --------------------hccCCCCCEEEcCCCcccCccCccccCCCCccEEEccCCccccccccccccCCcccEEEc
Q 039650          238 --------------------ITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYL  297 (391)
Q Consensus       238 --------------------~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~L~~L~l  297 (391)
                                          +..+++|+.|++++|.+.+..+..+..++.|+.+++++|.+.+..+..+..+++|+.|++
T Consensus       380 ~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L  459 (968)
T PLN00113        380 GNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSL  459 (968)
T ss_pred             CCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEEC
Confidence                                444444555555555444444444445555555555555554444444445556666666


Q ss_pred             CCCccCchhhHhhhCCCCccEEEcCCCcccchhHHHHHHhhccccEEEcCCCcccCCCcccccCCccccEEEcccccccc
Q 039650          298 YENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNELSG  377 (391)
Q Consensus       298 ~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  377 (391)
                      ++|.+....+..+ ..++|+.|++++|++++..+..+..+. +|+.|++++|.+.+.+|..+.++++|+.|++++|.+++
T Consensus       460 ~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~-~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~  537 (968)
T PLN00113        460 ARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLS-ELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSG  537 (968)
T ss_pred             cCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhh-ccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccc
Confidence            6665543333322 346777777777777777777776665 88888888888887888888888889999999998888


Q ss_pred             CCCccccccCCCc
Q 039650          378 QLSPELGSLIQLE  390 (391)
Q Consensus       378 ~~~~~~~~~~~L~  390 (391)
                      .+|..+..+++|+
T Consensus       538 ~~p~~~~~l~~L~  550 (968)
T PLN00113        538 QIPASFSEMPVLS  550 (968)
T ss_pred             cCChhHhCcccCC
Confidence            8888888888776

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-35
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-35
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 7e-20
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-09
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-08
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-08
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 7e-08
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-07
2omz_A 466 Crystal Structure Of Inla Y369a/hec1 Complex Length 9e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-07
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 4e-07
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 6e-06
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 6e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-04
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 1e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 3e-04
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 5e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  128 bits (322), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 199/412 (48%), Gaps = 33/412 (8%)
Query: 2   LSFSKNQLSGLIPHEI-GRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGS 60
           LS ++N+ +G IP  + G   +  GL L  N   G++PP  G+ + L  + +S+N  SG 
Sbjct: 274 LSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGE 333
Query: 61  IP-NEVESLKSLSDLRLYNNTLKGSIPSSLGNLT-NLVNLHLHINALSG-LIPDEIRNLE 117
           +P + +  ++ L  L L  N   G +P SL NL+ +L+ L L  N  SG ++P+  +N +
Sbjct: 334 LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 393
Query: 118 FLSDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYL 177
                +Y       N  +  IP  + N   L  L L +N LSG+IP S G+L+KL  L L
Sbjct: 394 NTLQELY----LQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL 449
Query: 178 DTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGXXXXXXXXYFSMNALSGSIPNE 237
             N L G IP E+  +K+L  L LD N L+G IP  L           S N L+G IP  
Sbjct: 450 WLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKW 509
Query: 238 ITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTS------ 291
           I  L +L+ L+LS N+ +G+IP  LG+   L+ L L+ N  +G+I  +    +       
Sbjct: 510 IGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANF 569
Query: 292 -LTNLYLYENSLCDSIQKEI-GDMKSLSILDLSSNKLNGSILLSLANLTN---------- 339
                Y+Y  +  D ++KE  G    L    + S +LN     +  N+T+          
Sbjct: 570 IAGKRYVYIKN--DGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPT 627
Query: 340 -----SLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNELSGQLSPELGSL 386
                S+  L +S N + G IP   G    L  L L +N++SG +  E+G L
Sbjct: 628 FDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDL 679
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-85
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-84
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-83
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-81
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-81
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-79
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-77
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-64
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-64
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-66
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-64
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-54
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-23
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-53
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-47
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-38
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-48
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-47
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-45
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-45
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-28
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-42
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-40
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-40
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-39
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-39
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-39
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-33
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-33
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-31
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-29
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-26
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-26
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-26
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-21
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-20
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-20
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 7e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-21
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  272 bits (699), Expect = 6e-85
 Identities = 125/415 (30%), Positives = 184/415 (44%), Gaps = 31/415 (7%)

Query: 2   LSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSI 61
           L  S N+LSG     I   +    L++ SN   G IPP    L SL Y+ ++ N  +G I
Sbjct: 228 LDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEI 285

Query: 62  PNEVE-SLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFLS 120
           P+ +  +  +L+ L L  N   G++P   G+ + L +L L  N  SG +P +   L  + 
Sbjct: 286 PDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDT--LLKMR 343

Query: 121 DLIYNYLIYWINALSDLIPNEIGNLK-SLSDLRLDYNTLSGSIPYSFGN--LTKLVTLYL 177
            L    L    N  S  +P  + NL  SL  L L  N  SG I  +        L  LYL
Sbjct: 344 GLKVLDL--SFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 401

Query: 178 DTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNE 237
             N  +G IP  + N   L +L L  N LSG+IP SLG+L+ L  L   +N L G IP E
Sbjct: 402 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 461

Query: 238 ITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYL 297
           +  +++L  L L  N L G IP  L N T L  + LS N+L+G I      L +L  L L
Sbjct: 462 LMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKL 521

Query: 298 YENSLCDSIQKEIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLS---------- 347
             NS   +I  E+GD +SL  LDL++N  NG+I  ++   +  +   +++          
Sbjct: 522 SNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKND 581

Query: 348 -----------SNHIVGEIPLGHGKFSSLIQLILTNNELSGQLSPELGSLIQLEY 391
                           G       + S+     +T+    G  SP   +   + +
Sbjct: 582 GMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMF 636
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query391
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.5
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.49
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.47
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.46
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.44
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.35
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.32
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.32
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.17
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.15
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.02
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.87
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.84
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.64
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.17
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.79
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.39
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.18
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 86.11
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-43  Score=345.69  Aligned_cols=387  Identities=33%  Similarity=0.468  Sum_probs=257.5

Q ss_pred             cccccCccCCCchhhhhcCCcccEEeecCCcCCCCCCCCCCCCCCccEEecCCcccccCChhhhhc-CCCCCEEEeeCCc
Q 039650            2 LSFSKNQLSGLIPHEIGRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVES-LKSLSDLRLYNNT   80 (391)
Q Consensus         2 l~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~-~~~L~~L~l~~~~   80 (391)
                      |++++|++++..+..+.++++|++|++++|.+.+..|..  .+++|++|++++|.+.+.+|..+.. +++|++|++++|.
T Consensus       228 L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~  305 (768)
T 3rgz_A          228 LDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNH  305 (768)
T ss_dssp             EECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSE
T ss_pred             EECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCc
Confidence            455555555555555566666666666655554333322  4444555555554444444444433 2556666666555


Q ss_pred             cCCCCcccccCCCCCceEEecccccccccch-hhcccccchhhhhc--------------------eeeecccccccccc
Q 039650           81 LKGSIPSSLGNLTNLVNLHLHINALSGLIPD-EIRNLEFLSDLIYN--------------------YLIYWINALSDLIP  139 (391)
Q Consensus        81 ~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~-~~~~l~~L~~l~l~--------------------~~~~~~~~~~~~~~  139 (391)
                      +.+..|..+..+++|++|++++|.+.+..+. .+.++++|+.|.+.                    .+.+..+.+....+
T Consensus       306 l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~  385 (768)
T 3rgz_A          306 FYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPIL  385 (768)
T ss_dssp             EEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECC
T ss_pred             CCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcC
Confidence            5555555555566666666666555533332 25555555533222                    12222222222223


Q ss_pred             ccccC--CCCCCEEECCCCCCCCCCCCCcCCCCCccEEEcCCCcCCCCCCccccCCCcccEEEccCCCCCCCccccccCC
Q 039650          140 NEIGN--LKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNL  217 (391)
Q Consensus       140 ~~~~~--~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~  217 (391)
                      ..+..  +++|+.|++++|.+.+..+..+..+++|+.|++.+|.+....+..+..+++|+.|++++|.+....+..+..+
T Consensus       386 ~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l  465 (768)
T 3rgz_A          386 PNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV  465 (768)
T ss_dssp             TTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGC
T ss_pred             hhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCC
Confidence            33332  4556666666666655566667777777777777777766666777777788888888777776667777777


Q ss_pred             CcccEEEccCcccccccchhhccCCCCCEEEcCCCcccCccCccccCCCCccEEEccCCccccccccccccCCcccEEEc
Q 039650          218 TNLTTLYFSMNALSGSIPNEITNLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYL  297 (391)
Q Consensus       218 ~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~L~~L~l  297 (391)
                      ++|+.|++++|.+....+..+..+++|+.|++++|.+.+..+..+..+++|++|++++|.+.+..+..+..+++|+.|++
T Consensus       466 ~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L  545 (768)
T 3rgz_A          466 KTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDL  545 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEEC
T ss_pred             CCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEEC
Confidence            88888888888777677777788888888888888887777777788888888888888887777777778888888888


Q ss_pred             CCCccCchhhH---------------------------------------------------------------------
Q 039650          298 YENSLCDSIQK---------------------------------------------------------------------  308 (391)
Q Consensus       298 ~~~~~~~~~~~---------------------------------------------------------------------  308 (391)
                      ++|.+....+.                                                                     
T Consensus       546 s~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~  625 (768)
T 3rgz_A          546 NTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTS  625 (768)
T ss_dssp             CSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECC
T ss_pred             CCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCc
Confidence            88876432221                                                                     


Q ss_pred             -hhhCCCCccEEEcCCCcccchhHHHHHHhhccccEEEcCCCcccCCCcccccCCccccEEEccccccccCCCccccccC
Q 039650          309 -EIGDMKSLSILDLSSNKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNNELSGQLSPELGSLI  387 (391)
Q Consensus       309 -~~~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~  387 (391)
                       .+..+++|+.|++++|++++.+|..+..+. +|+.|++++|.+++.+|..++++++|+.|++++|++++.+|..+++++
T Consensus       626 ~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~-~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~  704 (768)
T 3rgz_A          626 PTFDNNGSMMFLDMSYNMLSGYIPKEIGSMP-YLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALT  704 (768)
T ss_dssp             CSCSSSBCCCEEECCSSCCBSCCCGGGGGCT-TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCC
T ss_pred             hhhhccccccEEECcCCcccccCCHHHhccc-cCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCC
Confidence             122346788888888888888888887776 888889988888888888888888899999999988888888888888


Q ss_pred             CCcC
Q 039650          388 QLEY  391 (391)
Q Consensus       388 ~L~~  391 (391)
                      .|++
T Consensus       705 ~L~~  708 (768)
T 3rgz_A          705 MLTE  708 (768)
T ss_dssp             CCSE
T ss_pred             CCCE
Confidence            7763
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 391
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-05
d1ozna_ 284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.004
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 9e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 82.2 bits (201), Expect = 3e-18
 Identities = 61/269 (22%), Positives = 94/269 (34%), Gaps = 10/269 (3%)

Query: 60  SIPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVNLHLHINALSGLIPDEIRNLEFL 119
           ++P  + +  +   + L+ N +     +S     NL  L LH N     +          
Sbjct: 25  AVPVGIPA--ASQRIFLHGNRISHVPAASFRACRNLTILWLHSNV----LARIDAAAFTG 78

Query: 120 SDLIYNYLIYWINALSDLIPNEIGNLKSLSDLRLDYNTLSGSIPYSFGNLTKLVTLYLDT 179
             L+    +     L  + P     L  L  L LD   L    P  F  L  L  LYL  
Sbjct: 79  LALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQD 138

Query: 180 NALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEIT 239
           NAL     D  R+L +L +L L  N +S     +   L +L  L    N ++   P+   
Sbjct: 139 NALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFR 198

Query: 240 NLRSLSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYE 299
           +L  L  L L  N L+     AL  L  L  L L+ N               L       
Sbjct: 199 DLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWVCDCRARP-LWAWLQKFRGSS 257

Query: 300 NSLCDSIQKEIGDMKSLSILDLSSNKLNG 328
           + +  S+ +    +    +  L++N L G
Sbjct: 258 SEVPCSLPQR---LAGRDLKRLAANDLQG 283
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query391
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.57
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.1
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.07
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.82
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.54
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.95  E-value=5.7e-25  Score=195.85  Aligned_cols=329  Identities=29%  Similarity=0.341  Sum_probs=211.8

Q ss_pred             hcCCcccEEeecCCcCCCCCCCCCCCCCCccEEecCCcccccCChhhhhcCCCCCEEEeeCCccCCCCcccccCCCCCce
Q 039650           18 GRLSSFNGLSLYSNFLKGSIPPSLGNLTSLSYIGISNNLLSGSIPNEVESLKSLSDLRLYNNTLKGSIPSSLGNLTNLVN   97 (391)
Q Consensus        18 ~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~   97 (391)
                      +++.+|++|+++++.+.+ + +.++.+++|++|++++|.++ .++ .+.++++|++|++++|.+.+. + .+..+++|+.
T Consensus        41 ~~l~~l~~L~l~~~~I~~-l-~gl~~L~nL~~L~Ls~N~l~-~l~-~l~~L~~L~~L~L~~n~i~~i-~-~l~~l~~L~~  114 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKS-I-DGVEYLNNLTQINFSNNQLT-DIT-PLKNLTKLVDILMNNNQIADI-T-PLANLTNLTG  114 (384)
T ss_dssp             HHHTTCCEEECCSSCCCC-C-TTGGGCTTCCEEECCSSCCC-CCG-GGTTCTTCCEEECCSSCCCCC-G-GGTTCTTCCE
T ss_pred             HHhCCCCEEECCCCCCCC-c-cccccCCCCCEEeCcCCcCC-CCc-cccCCcccccccccccccccc-c-cccccccccc
Confidence            467789999999998874 3 46888999999999999987 444 378899999999999988843 2 4788999999


Q ss_pred             EEecccccccccchhhcccccchhhhhceeeec--------------cccccccccccccCCCCCCEEECCCCCCCCCCC
Q 039650           98 LHLHINALSGLIPDEIRNLEFLSDLIYNYLIYW--------------INALSDLIPNEIGNLKSLSDLRLDYNTLSGSIP  163 (391)
Q Consensus        98 L~l~~~~~~~~~~~~~~~l~~L~~l~l~~~~~~--------------~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~  163 (391)
                      +++.++.+.+......  ...+...........              ...........+.............+...  ..
T Consensus       115 L~~~~~~~~~~~~~~~--~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~  190 (384)
T d2omza2         115 LTLFNNQITDIDPLKN--LTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVS--DI  190 (384)
T ss_dssp             EECCSSCCCCCGGGTT--CTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCC--CC
T ss_pred             cccccccccccccccc--cccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccc--cc
Confidence            9998887765433221  111111100000000              00000011112222333333333333222  23


Q ss_pred             CCcCCCCCccEEEcCCCcCCCCCCccccCCCcccEEEccCCCCCCCccccccCCCcccEEEccCcccccccchhhccCCC
Q 039650          164 YSFGNLTKLVTLYLDTNALSGSIPDEIRNLKSLFNLQLDNNTLSGSIPLSLGNLTNLTTLYFSMNALSGSIPNEITNLRS  243 (391)
Q Consensus       164 ~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~  243 (391)
                      .....+++++.+.+.++.+....+  ...+++|+.+++++|.+.+.  ..+..+++|+.+++.+|.+....  .+..+++
T Consensus       191 ~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~--~~l~~l~~L~~L~l~~n~l~~~~--~~~~~~~  264 (384)
T d2omza2         191 SVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNLA--PLSGLTK  264 (384)
T ss_dssp             GGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCC--GGGGGCTTCSEEECCSSCCCCCG--GGTTCTT
T ss_pred             cccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCc--chhhcccccchhccccCccCCCC--ccccccc
Confidence            345566777888887777664322  45567788888888776632  34667778888888877765332  3566778


Q ss_pred             CCEEEcCCCcccCccCccccCCCCccEEEccCCccccccccccccCCcccEEEcCCCccCchhhHhhhCCCCccEEEcCC
Q 039650          244 LSDLQLSENTLNGSIPLALGNLTKLVVLYLSINKLSGSISLSYASLTSLTNLYLYENSLCDSIQKEIGDMKSLSILDLSS  323 (391)
Q Consensus       244 L~~L~l~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~  323 (391)
                      |+.|+++++.+.+..  .+..++.++.+.+..|.+.+.  ..+..+++++.+++++|.+.+..  .+..+++|++|++++
T Consensus       265 L~~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~--~~~~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~  338 (384)
T d2omza2         265 LTELKLGANQISNIS--PLAGLTALTNLELNENQLEDI--SPISNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFAN  338 (384)
T ss_dssp             CSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCC--GGGGGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCS
T ss_pred             CCEeeccCcccCCCC--ccccccccccccccccccccc--cccchhcccCeEECCCCCCCCCc--ccccCCCCCEEECCC
Confidence            888888877775332  356777778888887777643  23566777888888888776542  366778888888888


Q ss_pred             CcccchhHHHHHHhhccccEEEcCCCcccCCCcccccCCccccEEEcccc
Q 039650          324 NKLNGSILLSLANLTNSLKVLYLSSNHIVGEIPLGHGKFSSLIQLILTNN  373 (391)
Q Consensus       324 ~~i~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~  373 (391)
                      |++++ . ..+..++ +|++|++++|++++..+  +.++++|+.|++++|
T Consensus       339 n~l~~-l-~~l~~l~-~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         339 NKVSD-V-SSLANLT-NINWLSAGHNQISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             SCCCC-C-GGGGGCT-TCCEEECCSSCCCBCGG--GTTCTTCSEEECCCE
T ss_pred             CCCCC-C-hhHcCCC-CCCEEECCCCcCCCChh--hccCCCCCEeeCCCC
Confidence            87764 2 2455544 78888888887774332  677788888888776
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure