Citrus Sinensis ID: 039695


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-----
MKKSLTRNLIFTLAASSLTRQNKRSSCHTKAHFIQQLQECKHLISLASVHSEILKSGFLSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVDGARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRDRPNQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSWVEIRDQTYAFYAGNALFERGSEVLSLLRELERKMKERGYVGGKTGLVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVNRFHHFRNGSCSCGDFW
ccccHHccccHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHcccccccEEEHHHHHHHHHcccccHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccEEHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHccccHHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHcHHccccccccccHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHccEEEEcccccccccccccccccccc
ccHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHcHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEccccccEcccccEcccccc
MKKSLTRNLIFTLAASSLtrqnkrsschtKAHFIQQLQECKHLISLASVHSEIlksgflsntfTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKMLgnlvwpneFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMygkcndvdgARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFnyqsrdrpnqHMLASVINACASLGrlvsgkvahgVVVRSGCEFNDVVASALVDMYAkcgsvnysdkvfnrisnpsvvtYTSMIVGAAKYGLGRFSLDLFNEMIsrgikpndvtFVGVLHacshsglvdeGIQHLDSMYRkygiipdakhYTCVVDMLGRTGRLDEAYKLAKSiqvdpdggpllwGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMkrtgihkepgcswveirDQTYAFYAGNALFERGSEVLSLLRELERKMKergyvggktglVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIverdfvvrdvnrfhhfrngscscgdfw
MKKSLTRNLIFTlaassltrqnkRSSCHTKAHFIQQLQECKHLISLASVHSEILKSGFLSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVDGARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRDRPNQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKsiqvdpdggpLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSWVEIRDQTYAFYAGNALFERGSEVLSLLRELERKmkergyvggktglvfVDVEDEAREEIVGLHserlalafglisipkGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVNRfhhfrngscscgdfw
MKKSLTRNLIFTLAASSLTRQNKRSSCHTKAHFIQQLQECKHLISLASVHSEILKSGFLSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVDGARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRDRPNQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSWVEIRDQTYAFYAGNALFergsevlsllrelerKMKERGYVGGKTGLVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVNRFHHFRNGSCSCGDFW
*******NLIFTLAA***********CHTKAHFIQQLQECKHLISLASVHSEILKSGFLSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVDGARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQS****NQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSWVEIRDQTYAFYAGNALFERGSEVLSLLRELERKMKERGYVGGKTGLVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVNRFHHFRNGSCSCG***
MKKSLT*NLIFTLAASSLTRQNKRSSCHTKAHFIQQLQECKHLISLASVHSEILKSGFLSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVDGARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRDRPNQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSWVEIRDQTYAFYAGNALFERGSEVLSLLRELERKMKERGYVGGKTGLVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVNRFHHFRNGSCSCGDFW
MKKSLTRNLIFTLAASS************KAHFIQQLQECKHLISLASVHSEILKSGFLSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVDGARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRDRPNQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSWVEIRDQTYAFYAGNALFERGSEVLSLLRELERKMKERGYVGGKTGLVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVNRFHHFRNGSCSCGDFW
MKKSLTRNLIFTLAASSLTRQNKRSSCHTKAHFIQQLQECKHLISLASVHSEILKSGFLSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVDGARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRDRPNQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSWVEIRDQTYAFYAGNALFERGSEVLSLLRELERKMKERGYVGGKTGLVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVNRFHHFRNGSCSCGDFW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKSLTRNLIFTLAASSLTRQNKRSSCHTKAHFIQQLQECKHLISLASVHSEILKSGFLSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVDGARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRDRPNQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSWVEIRDQTYAFYAGNALFERGSEVLSLLRELERKMKERGYVGGKTGLVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVNRFHHFRNGSCSCGDFW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query605 2.2.26 [Sep-21-2011]
Q8VYH0616 Pentatricopeptide repeat- yes no 1.0 0.982 0.579 0.0
Q9STF3657 Pentatricopeptide repeat- no no 0.930 0.856 0.398 1e-122
Q9LW63715 Putative pentatricopeptid no no 0.990 0.837 0.359 1e-121
O82380738 Pentatricopeptide repeat- no no 0.952 0.780 0.371 1e-119
Q9LIC3628 Putative pentatricopeptid no no 0.914 0.880 0.404 1e-118
Q9LTV8694 Pentatricopeptide repeat- no no 0.945 0.824 0.388 1e-117
Q9LIQ7633 Pentatricopeptide repeat- no no 0.928 0.887 0.388 1e-117
Q3E6Q1809 Pentatricopeptide repeat- no no 0.922 0.689 0.400 1e-117
O23169691 Pentatricopeptide repeat- no no 0.932 0.816 0.382 1e-116
Q9SY02781 Pentatricopeptide repeat- no no 0.877 0.679 0.378 1e-115
>sp|Q8VYH0|PP313_ARATH Pentatricopeptide repeat-containing protein At4g15720 OS=Arabidopsis thaliana GN=PCMP-H1 PE=2 SV=1 Back     alignment and function desciption
 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/616 (57%), Positives = 460/616 (74%), Gaps = 11/616 (1%)

Query: 1   MKKSLTRNLIFTLAASSLTRQNKRSSCH--TKAHFIQQLQECKHLISLASVHSEILKSGF 58
           MKK   +N+    A S    Q K    H  TKA  + +L E  +      +H+  LK GF
Sbjct: 1   MKKGFIQNVHLAPATSLFVPQYKNDFFHLKTKAFLVHKLSESTNAAFTNLLHTLTLKLGF 60

Query: 59  LSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQK 118
            S+TFT+NHL+  YV+LK+   AR+LFDEM EPNVVS+TS+++GY +MG+PQ AL +FQK
Sbjct: 61  ASDTFTVNHLVISYVKLKEINTARKLFDEMCEPNVVSWTSVISGYNDMGKPQNALSMFQK 120

Query: 119 MLGNL-VWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCN 177
           M  +  V PNE+TFA+V KACS LA+   GK IH  +E  G + N+VV SSLVDMYGKCN
Sbjct: 121 MHEDRPVPPNEYTFASVFKACSALAESRIGKNIHARLEISGLRRNIVVSSSLVDMYGKCN 180

Query: 178 DVDGARRVFDLM--GCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQ-SRDRPNQHMLA 234
           DV+ ARRVFD M    RNVVSWTS+I A+AQNA+GHEA+E+FR FN   + DR NQ MLA
Sbjct: 181 DVETARRVFDSMIGYGRNVVSWTSMITAYAQNARGHEAIELFRSFNAALTSDRANQFMLA 240

Query: 235 SVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNP 294
           SVI+AC+SLGRL  GKVAHG+V R G E N VVA++L+DMYAKCGS++ ++K+F RI   
Sbjct: 241 SVISACSSLGRLQWGKVAHGLVTRGGYESNTVVATSLLDMYAKCGSLSCAEKIFLRIRCH 300

Query: 295 SVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHL 354
           SV++YTSMI+  AK+GLG  ++ LF+EM++  I PN VT +GVLHACSHSGLV+EG+++L
Sbjct: 301 SVISYTSMIMAKAKHGLGEAAVKLFDEMVAGRINPNYVTLLGVLHACSHSGLVNEGLEYL 360

Query: 355 DSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGTLLSASRLH 414
             M  KYG++PD++HYTCVVDMLGR GR+DEAY+LAK+I+V  + G LLWG LLSA RLH
Sbjct: 361 SLMAEKYGVVPDSRHYTCVVDMLGRFGRVDEAYELAKTIEVGAEQGALLWGALLSAGRLH 420

Query: 415 GRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSW 474
           GRV+I  EAS +LI+SNQQV +AY+ LSN YA++G WE+  SLR EMKR+G  KE  CSW
Sbjct: 421 GRVEIVSEASKRLIQSNQQVTSAYIALSNAYAVSGGWEDSESLRLEMKRSGNVKERACSW 480

Query: 475 VEIRDQTYAFYAGNALFERGSEVLSLLRELERKMKERGYVG-----GKTGLVFVDVEDEA 529
           +E +D  Y F+AG+   +   E+   L++LE++MKERG+ G       +  VFVDV++EA
Sbjct: 481 IENKDSVYVFHAGDLSCDESGEIERFLKDLEKRMKERGHRGSSSMITTSSSVFVDVDEEA 540

Query: 530 REEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVN 589
           ++E+V LH ERLALA+GL+ +P G TIRIM NLRMCRDCH+ FKLIS+IVER+ VVRDVN
Sbjct: 541 KDEMVSLHCERLALAYGLLHLPAGSTIRIMNNLRMCRDCHEAFKLISEIVEREIVVRDVN 600

Query: 590 RFHHFRNGSCSCGDFW 605
           RFH F+NGSC+C D+W
Sbjct: 601 RFHCFKNGSCTCRDYW 616





Arabidopsis thaliana (taxid: 3702)
>sp|Q9STF3|PP265_ARATH Pentatricopeptide repeat-containing protein At3g46790, chloroplastic OS=Arabidopsis thaliana GN=CRR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32 PE=3 SV=1 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H85 PE=3 SV=1 Back     alignment and function description
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein At3g24000, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H87 PE=2 SV=1 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|O23169|PP353_ARATH Pentatricopeptide repeat-containing protein At4g37170 OS=Arabidopsis thaliana GN=PCMP-H5 PE=3 SV=1 Back     alignment and function description
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query605
225432322606 PREDICTED: pentatricopeptide repeat-cont 1.0 0.998 0.729 0.0
224123200584 predicted protein [Populus trichocarpa] 0.957 0.991 0.711 0.0
356521885603 PREDICTED: pentatricopeptide repeat-cont 0.985 0.988 0.680 0.0
297736881568 unnamed protein product [Vitis vinifera] 0.937 0.998 0.681 0.0
449450898603 PREDICTED: pentatricopeptide repeat-cont 0.993 0.996 0.659 0.0
449517497603 PREDICTED: pentatricopeptide repeat-cont 0.993 0.996 0.659 0.0
357478705589 Pentatricopeptide repeat-containing prot 0.952 0.977 0.654 0.0
297804658608 pentatricopeptide repeat-containing prot 0.966 0.962 0.603 0.0
22328675616 pentatricopeptide repeat-containing prot 1.0 0.982 0.579 0.0
2244928602 hypothetical protein [Arabidopsis thalia 0.976 0.981 0.566 0.0
>gi|225432322|ref|XP_002276230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/606 (72%), Positives = 517/606 (85%), Gaps = 1/606 (0%)

Query: 1   MKKSLTRNLIFTLAASSLTRQNKRSSCHTKAHFIQQLQECKHLISLASVHSEILKSGFLS 60
           M K L +NLIF + ++ ++RQNK S  HTK   IQ+LQ+C  + S++  H+ +LKSGFL+
Sbjct: 1   MVKPLNQNLIFRVPSTCISRQNKLSHFHTKTQLIQRLQDCNDITSVSFSHTNVLKSGFLN 60

Query: 61  NTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKML 120
           +TFT NHLIN YVR+++T  A QLF+EM EPNV+S+TSLMAG+I +G+P+ ALL+F KML
Sbjct: 61  DTFTTNHLINSYVRIRRTNDASQLFEEMREPNVISFTSLMAGFIKVGRPKSALLIFCKML 120

Query: 121 GNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVD 180
            + V PN FTFATV+ ACSMLADL TG++IH+H+E FG Q NLVVCSSL+DMYGKCN+VD
Sbjct: 121 ESWVLPNAFTFATVVNACSMLADLRTGQKIHSHVEMFGVQCNLVVCSSLIDMYGKCNNVD 180

Query: 181 GARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRDRPNQHMLASVINAC 240
            ARRVFD M  RNVVSWTS+I A+ QNA G  AL++FREFN      PN  MLASVINAC
Sbjct: 181 DARRVFDGMDYRNVVSWTSMITAYGQNALGECALQLFREFNGLPLSSPNHFMLASVINAC 240

Query: 241 ASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYT 300
           ASLGRLVSGKVAH  V+R G E NDVVASALVDMYAKCG + YSDKVF RI +PSV+ YT
Sbjct: 241 ASLGRLVSGKVAHAAVIRRGHESNDVVASALVDMYAKCGCIGYSDKVFRRIPDPSVIPYT 300

Query: 301 SMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRK 360
           SMIVGAAKYGLG+FSLD+F EM+ R IKPNDVTFVGVLHACSHSGLVD+G+++L SM++K
Sbjct: 301 SMIVGAAKYGLGKFSLDIFKEMLDRRIKPNDVTFVGVLHACSHSGLVDDGLEYLHSMHKK 360

Query: 361 YGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGTLLSASRLHGRVDIA 420
           +G++PD KHYTCVVDMLGRTGRLDEA++LAKSIQV+PD G LLWGTLLSASRL+GRVDIA
Sbjct: 361 HGVVPDTKHYTCVVDMLGRTGRLDEAHQLAKSIQVEPDQGALLWGTLLSASRLYGRVDIA 420

Query: 421 VEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSWVEIRDQ 480
           VEAS  LIESNQQVA AYVT+SNTYA+AG+WENVHS+R EMK  G++KEPGCSWVEIRD 
Sbjct: 421 VEASKWLIESNQQVAAAYVTMSNTYAMAGKWENVHSIRYEMKHYGVYKEPGCSWVEIRDS 480

Query: 481 TYAFYAGN-ALFERGSEVLSLLRELERKMKERGYVGGKTGLVFVDVEDEAREEIVGLHSE 539
            Y FYAG+ +L  RGSEV SLLRELER+MKERGYVGG  GLV +DVE+EA+EEIVGLHSE
Sbjct: 481 AYVFYAGDVSLCARGSEVASLLRELERRMKERGYVGGSRGLVSIDVEEEAKEEIVGLHSE 540

Query: 540 RLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVNRFHHFRNGSC 599
           RLALAFGLISIPKG+TIR+MKNLRMCRDCH+ FKLIS+IVERDFVVRDVNRFHHF NGSC
Sbjct: 541 RLALAFGLISIPKGVTIRVMKNLRMCRDCHEAFKLISEIVERDFVVRDVNRFHHFENGSC 600

Query: 600 SCGDFW 605
           +C DFW
Sbjct: 601 TCRDFW 606




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224123200|ref|XP_002330363.1| predicted protein [Populus trichocarpa] gi|222871567|gb|EEF08698.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356521885|ref|XP_003529581.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Glycine max] Back     alignment and taxonomy information
>gi|297736881|emb|CBI26082.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449450898|ref|XP_004143199.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449517497|ref|XP_004165782.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357478705|ref|XP_003609638.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510693|gb|AES91835.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297804658|ref|XP_002870213.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316049|gb|EFH46472.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22328675|ref|NP_193307.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75161477|sp|Q8VYH0.1|PP313_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g15720 gi|18175616|gb|AAL59897.1| unknown protein [Arabidopsis thaliana] gi|20465541|gb|AAM20253.1| unknown protein [Arabidopsis thaliana] gi|332658240|gb|AEE83640.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|2244928|emb|CAB10350.1| hypothetical protein [Arabidopsis thaliana] gi|7268320|emb|CAB78614.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query605
TAIR|locus:2130644616 AT4G15720 "AT4G15720" [Arabido 1.0 0.982 0.574 9.7e-183
TAIR|locus:2102852657 CRR2 "AT3G46790" [Arabidopsis 0.930 0.856 0.395 7.8e-110
TAIR|locus:2202074809 CRR22 "CHLORORESPIRATORY REDUC 0.961 0.719 0.389 2.7e-107
TAIR|locus:2091546628 AT3G13770 [Arabidopsis thalian 0.914 0.880 0.393 2.2e-105
TAIR|locus:2115130691 AT4G37170 "AT4G37170" [Arabido 0.930 0.814 0.376 9.5e-105
TAIR|locus:2056740603 OTP85 "ORGANELLE TRANSCRIPT PR 0.966 0.970 0.364 5.3e-104
TAIR|locus:2118964823 EMB2758 "embryo defective 2758 0.917 0.674 0.391 1.4e-103
TAIR|locus:2124137871 DOT4 "DEFECTIVELY ORGANIZED TR 0.923 0.641 0.373 2.9e-103
TAIR|locus:2155740738 AT5G65570 [Arabidopsis thalian 0.887 0.727 0.397 2e-102
TAIR|locus:2140235781 AT4G02750 [Arabidopsis thalian 0.869 0.673 0.374 6.9e-102
TAIR|locus:2130644 AT4G15720 "AT4G15720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1773 (629.2 bits), Expect = 9.7e-183, P = 9.7e-183
 Identities = 354/616 (57%), Positives = 453/616 (73%)

Query:     1 MKKSLTRNLIFTLAASSLTRQNKRSSCH--TKAHFIQQLQECKHLISLASVHSEILKSGF 58
             MKK   +N+    A S    Q K    H  TKA  + +L E  +      +H+  LK GF
Sbjct:     1 MKKGFIQNVHLAPATSLFVPQYKNDFFHLKTKAFLVHKLSESTNAAFTNLLHTLTLKLGF 60

Query:    59 LSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQK 118
              S+TFT+NHL+  YV+LK+   AR+LFDEM EPNVVS+TS+++GY +MG+PQ AL +FQK
Sbjct:    61 ASDTFTVNHLVISYVKLKEINTARKLFDEMCEPNVVSWTSVISGYNDMGKPQNALSMFQK 120

Query:   119 MLGNL-VWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCN 177
             M  +  V PNE+TFA+V KACS LA+   GK IH  +E  G + N+VV SSLVDMYGKCN
Sbjct:   121 MHEDRPVPPNEYTFASVFKACSALAESRIGKNIHARLEISGLRRNIVVSSSLVDMYGKCN 180

Query:   178 DVDGARRVFDLM-GC-RNVVSWTSIIVAHAQNAQGHEALEMFREFNYQ-SRDRPNQHMLA 234
             DV+ ARRVFD M G  RNVVSWTS+I A+AQNA+GHEA+E+FR FN   + DR NQ MLA
Sbjct:   181 DVETARRVFDSMIGYGRNVVSWTSMITAYAQNARGHEAIELFRSFNAALTSDRANQFMLA 240

Query:   235 SVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNP 294
             SVI+AC+SLGRL  GKVAHG+V R G E N VVA++L+DMYAKCGS++ ++K+F RI   
Sbjct:   241 SVISACSSLGRLQWGKVAHGLVTRGGYESNTVVATSLLDMYAKCGSLSCAEKIFLRIRCH 300

Query:   295 SVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHL 354
             SV++YTSMI+  AK+GLG  ++ LF+EM++  I PN VT +GVLHACSHSGLV+EG+++L
Sbjct:   301 SVISYTSMIMAKAKHGLGEAAVKLFDEMVAGRINPNYVTLLGVLHACSHSGLVNEGLEYL 360

Query:   355 DSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGTLLSASRLH 414
               M  KYG++PD++HYTCVVDMLGR GR+DEAY+LAK+I+V  + G LLWG LLSA RLH
Sbjct:   361 SLMAEKYGVVPDSRHYTCVVDMLGRFGRVDEAYELAKTIEVGAEQGALLWGALLSAGRLH 420

Query:   415 GRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSW 474
             GRV+I  EAS +LI+SNQQV +AY+ LSN YA++G WE+  SLR EMKR+G  KE  CSW
Sbjct:   421 GRVEIVSEASKRLIQSNQQVTSAYIALSNAYAVSGGWEDSESLRLEMKRSGNVKERACSW 480

Query:   475 VEIRDQTYAFYAGNALFXXXXXXXXXXXXXXXKMKERGYVGGKTGL-----VFVDVEDEA 529
             +E +D  Y F+AG+                  +MKERG+ G  + +     VFVDV++EA
Sbjct:   481 IENKDSVYVFHAGDLSCDESGEIERFLKDLEKRMKERGHRGSSSMITTSSSVFVDVDEEA 540

Query:   530 REEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVVRDVN 589
             ++E+V LH ERLALA+GL+ +P G TIRIM NLRMCRDCH+ FKLIS+IVER+ VVRDVN
Sbjct:   541 KDEMVSLHCERLALAYGLLHLPAGSTIRIMNNLRMCRDCHEAFKLISEIVEREIVVRDVN 600

Query:   590 RFHHFRNGSCSCGDFW 605
             RFH F+NGSC+C D+W
Sbjct:   601 RFHCFKNGSCTCRDYW 616




GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2102852 CRR2 "AT3G46790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202074 CRR22 "CHLORORESPIRATORY REDUCTION22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091546 AT3G13770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115130 AT4G37170 "AT4G37170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056740 OTP85 "ORGANELLE TRANSCRIPT PROCESSING 85" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118964 EMB2758 "embryo defective 2758" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124137 DOT4 "DEFECTIVELY ORGANIZED TRIBUTARIES 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155740 AT5G65570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VYH0PP313_ARATHNo assigned EC number0.57951.00.9821yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00019786001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (594 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query605
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-144
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-143
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-58
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-55
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-35
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-22
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 5e-16
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-13
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-05
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-05
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 7e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.003
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score =  433 bits (1115), Expect = e-144
 Identities = 189/560 (33%), Positives = 320/560 (57%), Gaps = 6/560 (1%)

Query: 47  ASVHSEILKSGFLSNTFTLNHLINCYVRLKKTQVARQLFDEMLEPNVVSYTSLMAGYINM 106
            +V+  +  SGF  + + +N ++  +V+      AR+LFDEM E N+ S+ +++ G ++ 
Sbjct: 143 KAVYWHVESSGFEPDQYMMNRVLLMHVKCGMLIDARRLFDEMPERNLASWGTIIGGLVDA 202

Query: 107 GQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVC 166
           G  + A  LF++M  +       TF  +++A + L     G+Q+H  +   G   +  V 
Sbjct: 203 GNYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTGVVGDTFVS 262

Query: 167 SSLVDMYGKCNDVDGARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRD 226
            +L+DMY KC D++ AR VFD M  +  V+W S++  +A +    EAL ++ E    S  
Sbjct: 263 CALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMR-DSGV 321

Query: 227 RPNQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDK 286
             +Q   + +I   + L  L   K AH  ++R+G   + V  +ALVD+Y+K G +  +  
Sbjct: 322 SIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARN 381

Query: 287 VFNRISNPSVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGL 346
           VF+R+   +++++ ++I G   +G G  ++++F  MI+ G+ PN VTF+ VL AC +SGL
Sbjct: 382 VFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGL 441

Query: 347 VDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDPDGGPLLWGT 406
            ++G +   SM   + I P A HY C++++LGR G LDEAY + +     P     +W  
Sbjct: 442 SEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVN--MWAA 499

Query: 407 LLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGI 466
           LL+A R+H  +++   A+ +L     +  N YV L N Y  +G       +   +KR G+
Sbjct: 500 LLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGL 559

Query: 467 HKEPGCSWVEIRDQTYAFYAGNALFERGSEVLSLLRELERKMKERGYVGGKTGLVFVDVE 526
              P C+W+E++ Q ++F++G+ L  +  E+   L EL +++ E GYV  +  L+  DV 
Sbjct: 560 SMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQKLDELMKEISEYGYVAEENELL-PDV- 617

Query: 527 DEAREEIVGL-HSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIVERDFVV 585
           DE  E++ G  HSE+LA+AFGLI+  +   ++I ++ R+C+DCH V K I+ + +R+ VV
Sbjct: 618 DEDEEKVSGRYHSEKLAIAFGLINTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIVV 677

Query: 586 RDVNRFHHFRNGSCSCGDFW 605
           RD +RFHHF+ G CSCGD+W
Sbjct: 678 RDASRFHHFKLGKCSCGDYW 697


Length = 697

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 605
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.83
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.81
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.78
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.77
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.76
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.75
PRK14574 822 hmsH outer membrane protein; Provisional 99.75
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.66
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.59
KOG2076 895 consensus RNA polymerase III transcription factor 99.58
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.58
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.57
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.52
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.5
KOG2003840 consensus TPR repeat-containing protein [General f 99.5
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.49
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.48
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.48
KOG1126638 consensus DNA-binding cell division cycle control 99.46
KOG2003840 consensus TPR repeat-containing protein [General f 99.46
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.46
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.46
KOG0547606 consensus Translocase of outer mitochondrial membr 99.45
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.45
KOG2076 895 consensus RNA polymerase III transcription factor 99.44
KOG1915677 consensus Cell cycle control protein (crooked neck 99.39
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.38
PF1304150 PPR_2: PPR repeat family 99.36
KOG1126638 consensus DNA-binding cell division cycle control 99.34
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.34
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.34
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.33
PF1304150 PPR_2: PPR repeat family 99.33
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.33
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.32
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.32
KOG1915677 consensus Cell cycle control protein (crooked neck 99.32
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.31
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.21
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.2
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.2
PRK12370553 invasion protein regulator; Provisional 99.19
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.19
KOG0547606 consensus Translocase of outer mitochondrial membr 99.16
KOG2376652 consensus Signal recognition particle, subunit Srp 99.16
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.12
PRK12370553 invasion protein regulator; Provisional 99.1
KOG1129478 consensus TPR repeat-containing protein [General f 99.07
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.07
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.05
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.04
PRK11189296 lipoprotein NlpI; Provisional 99.02
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.99
KOG1129478 consensus TPR repeat-containing protein [General f 98.98
PRK11189296 lipoprotein NlpI; Provisional 98.91
KOG1125579 consensus TPR repeat-containing protein [General f 98.9
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.87
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.86
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.85
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.79
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.78
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.78
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.76
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.76
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.76
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.76
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.76
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.75
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.74
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.72
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.71
PRK04841903 transcriptional regulator MalT; Provisional 98.7
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.67
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.67
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.67
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.66
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.64
PF1285434 PPR_1: PPR repeat 98.63
PF1285434 PPR_1: PPR repeat 98.62
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.6
KOG2376652 consensus Signal recognition particle, subunit Srp 98.6
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.59
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.57
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.55
PRK10370198 formate-dependent nitrite reductase complex subuni 98.49
PRK15359144 type III secretion system chaperone protein SscB; 98.47
PLN02789320 farnesyltranstransferase 98.46
PRK15359144 type III secretion system chaperone protein SscB; 98.46
KOG1128777 consensus Uncharacterized conserved protein, conta 98.41
KOG1128777 consensus Uncharacterized conserved protein, conta 98.41
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.4
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.39
PRK10370198 formate-dependent nitrite reductase complex subuni 98.38
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.38
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.34
PRK04841903 transcriptional regulator MalT; Provisional 98.32
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.32
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.28
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.27
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.26
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.26
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.25
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.24
KOG1125579 consensus TPR repeat-containing protein [General f 98.23
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.22
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.18
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.16
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.14
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.14
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.1
PLN02789320 farnesyltranstransferase 98.09
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.08
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.07
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.07
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.05
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.04
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.0
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.99
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.9
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.87
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.86
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.86
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.85
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.85
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.79
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.79
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.76
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.76
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.75
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.7
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.66
PRK15331165 chaperone protein SicA; Provisional 97.65
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.63
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.61
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.56
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.52
KOG0553304 consensus TPR repeat-containing protein [General f 97.49
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.47
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.47
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.47
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.42
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.36
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.36
PF1337173 TPR_9: Tetratricopeptide repeat 97.33
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.32
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.32
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.28
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.28
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.27
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.21
KOG0553304 consensus TPR repeat-containing protein [General f 97.21
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.2
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.19
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.19
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.17
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.16
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.15
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.13
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.12
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.1
PF1343134 TPR_17: Tetratricopeptide repeat 97.05
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.03
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.02
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.02
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.01
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.0
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.97
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.96
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.96
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.92
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.9
PF12688120 TPR_5: Tetratrico peptide repeat 96.85
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.79
PRK10803263 tol-pal system protein YbgF; Provisional 96.78
PF1342844 TPR_14: Tetratricopeptide repeat 96.77
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.76
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.75
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.72
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.71
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.67
PF12688120 TPR_5: Tetratrico peptide repeat 96.63
KOG20411189 consensus WD40 repeat protein [General function pr 96.63
KOG1914656 consensus mRNA cleavage and polyadenylation factor 96.59
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.55
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.53
COG3898531 Uncharacterized membrane-bound protein [Function u 96.46
COG4700251 Uncharacterized protein conserved in bacteria cont 96.44
COG4700251 Uncharacterized protein conserved in bacteria cont 96.41
PF1337173 TPR_9: Tetratricopeptide repeat 96.34
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.1
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.05
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.01
PRK10803263 tol-pal system protein YbgF; Provisional 95.92
KOG3941406 consensus Intermediate in Toll signal transduction 95.88
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.84
KOG4555175 consensus TPR repeat-containing protein [Function 95.84
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.84
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.79
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.65
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.64
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.59
COG3898531 Uncharacterized membrane-bound protein [Function u 95.59
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.45
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.32
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.26
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.19
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.18
PF13512142 TPR_18: Tetratricopeptide repeat 95.16
PRK11619644 lytic murein transglycosylase; Provisional 95.14
PRK11906458 transcriptional regulator; Provisional 94.99
KOG20411189 consensus WD40 repeat protein [General function pr 94.93
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.81
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.79
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.64
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.56
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.51
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.4
KOG1585308 consensus Protein required for fusion of vesicles 94.27
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.23
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.22
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.16
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.09
KOG3941406 consensus Intermediate in Toll signal transduction 93.97
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.89
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.88
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.73
PRK11906458 transcriptional regulator; Provisional 93.73
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.5
smart00299140 CLH Clathrin heavy chain repeat homology. 93.45
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.45
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 93.42
PF13512142 TPR_18: Tetratricopeptide repeat 93.4
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.38
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 93.24
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.14
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.73
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.52
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.48
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 92.11
COG3629280 DnrI DNA-binding transcriptional activator of the 91.94
PRK15331165 chaperone protein SicA; Provisional 91.54
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 91.48
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.21
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.08
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.06
COG0457291 NrfG FOG: TPR repeat [General function prediction 90.97
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.97
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.89
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.65
smart00299140 CLH Clathrin heavy chain repeat homology. 90.41
KOG1585308 consensus Protein required for fusion of vesicles 90.33
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.03
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.02
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.98
KOG4234271 consensus TPR repeat-containing protein [General f 89.86
KOG4555175 consensus TPR repeat-containing protein [Function 89.77
PF1342844 TPR_14: Tetratricopeptide repeat 89.59
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 89.42
COG3629280 DnrI DNA-binding transcriptional activator of the 89.1
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.76
KOG4570418 consensus Uncharacterized conserved protein [Funct 88.73
PRK11619644 lytic murein transglycosylase; Provisional 88.68
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.35
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 88.35
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 88.32
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.26
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 88.13
PRK09687280 putative lyase; Provisional 88.05
KOG1258577 consensus mRNA processing protein [RNA processing 87.48
COG4105254 ComL DNA uptake lipoprotein [General function pred 87.38
PRK09687280 putative lyase; Provisional 87.33
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 86.58
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.55
KOG2610491 consensus Uncharacterized conserved protein [Funct 86.04
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 86.01
PF06552186 TOM20_plant: Plant specific mitochondrial import r 85.69
COG1747 711 Uncharacterized N-terminal domain of the transcrip 85.3
PF1343134 TPR_17: Tetratricopeptide repeat 85.28
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 85.26
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 85.23
KOG4648 536 consensus Uncharacterized conserved protein, conta 84.8
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 84.79
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 84.12
COG4649221 Uncharacterized protein conserved in bacteria [Fun 83.86
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 83.5
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.35
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.24
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 83.17
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 82.69
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 82.46
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.43
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 82.26
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 82.19
KOG4648 536 consensus Uncharacterized conserved protein, conta 81.87
PRK10941269 hypothetical protein; Provisional 81.81
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 81.74
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 81.72
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 81.38
PF13929292 mRNA_stabil: mRNA stabilisation 81.21
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 80.85
COG2976207 Uncharacterized protein conserved in bacteria [Fun 80.6
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 80.53
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 80.5
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 80.35
KOG4570418 consensus Uncharacterized conserved protein [Funct 80.34
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 80.17
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.8e-123  Score=1009.92  Aligned_cols=600  Identities=31%  Similarity=0.576  Sum_probs=590.2

Q ss_pred             chhhhhccchHHHHHHHHHhhhCC-CCCChhhHHHHHHHhhChhHH---HHHHHHHHHhCCCCchHHHHHHHHHHHcCCC
Q 039695            2 KKSLTRNLIFTLAASSLTRQNKRS-SCHTKAHFIQQLQECKHLISL---ASVHSEILKSGFLSNTFTLNHLINCYVRLKK   77 (605)
Q Consensus         2 ~~~l~~~~~~~~a~~~l~~m~~~g-~~~~~~~~~~~l~~~~~~~~~---~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~   77 (605)
                      ++.+.+.|++++|+++|.+|...+ ..|+..||..++.+|.+.+..   .++|..|.+.|+.||+.+||.|+++|+++|+
T Consensus        94 i~~l~~~g~~~~Al~~f~~m~~~~~~~~~~~t~~~ll~a~~~~~~~~~a~~l~~~m~~~g~~~~~~~~n~Li~~y~k~g~  173 (697)
T PLN03081         94 IEKLVACGRHREALELFEILEAGCPFTLPASTYDALVEACIALKSIRCVKAVYWHVESSGFEPDQYMMNRVLLMHVKCGM  173 (697)
T ss_pred             HHHHHcCCCHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCcchHHHHHHHHHHhcCCC
Confidence            456788999999999999998764 789999999999999988766   8999999999999999999999999999999


Q ss_pred             hhHHHHHHhcCCCCChhhHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCChhhHHHHHHHHhccCChHHHHHHHHHHHHh
Q 039695           78 TQVARQLFDEMLEPNVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLITGKQIHTHIETF  157 (605)
Q Consensus        78 ~~~A~~~f~~m~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~pd~~t~~~ll~a~~~~~~~~~a~~~~~~~~~~  157 (605)
                      +++|.++|++|++||+++||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|+..|..+.+.++|..+.+.
T Consensus       174 ~~~A~~lf~~m~~~~~~t~n~li~~~~~~g~~~~A~~lf~~M~~~g~~p~~~t~~~ll~a~~~~~~~~~~~~l~~~~~~~  253 (697)
T PLN03081        174 LIDARRLFDEMPERNLASWGTIIGGLVDAGNYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKT  253 (697)
T ss_pred             HHHHHHHHhcCCCCCeeeHHHHHHHHHHCcCHHHHHHHHHHHHHhCCCCChhhHHHHHHHHhcCCcHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCchhHHHHHHHHHHhCCCHHHHHHHHhhcCCCChhhHHHHHHHHHHcCChhHHHHHHHHHHHcCCCCCChhHHHhHH
Q 039695          158 GFQYNLVVCSSLVDMYGKCNDVDGARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRDRPNQHMLASVI  237 (605)
Q Consensus       158 g~~~~~~~~~~Li~~y~~~g~~~~A~~~~~~m~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~p~~~t~~~ll  237 (605)
                      |+.||..++|+|+++|+++|++++|.++|++|+.+|+++||+||.+|++.|++++|+++|++|...| +.||..||++++
T Consensus       254 g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g-~~pd~~t~~~ll  332 (697)
T PLN03081        254 GVVGDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSG-VSIDQFTFSIMI  332 (697)
T ss_pred             CCCccceeHHHHHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcC-CCCCHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999 999999999999


Q ss_pred             HhhcccCchhhHHHHHHHHHHhCCCCcHhHHHHHHHHHHhcCCHHHHHHHHhccCCCCcchHHHHHHHHHHcCChhHHHH
Q 039695          238 NACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYTSMIVGAAKYGLGRFSLD  317 (605)
Q Consensus       238 ~a~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~  317 (605)
                      .+|++.|.+++|.++|..|.+.|++||..++++|+++|+++|++++|.++|++|.+||+++||+||.+|+++|+.++|++
T Consensus       333 ~a~~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~  412 (697)
T PLN03081        333 RIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVE  412 (697)
T ss_pred             HHHHhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCCCHHHHHHHHHHHhccCcHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHhhcCCHHHHHHHHHhCCCCC
Q 039695          318 LFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYKLAKSIQVDP  397 (605)
Q Consensus       318 l~~~m~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~p  397 (605)
                      +|++|.+.|+.||..||+.++.+|++.|.+++|.++|+.|.+++|+.|+..+|++++++|++.|++++|.+++++|+..|
T Consensus       413 lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p  492 (697)
T PLN03081        413 MFERMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKP  492 (697)
T ss_pred             HHHHHHHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCC
Confidence            99999999999999999999999999999999999999998888999999999999999999999999999999999999


Q ss_pred             CchhhHHHHHHHHHHHcCChHHHHHHHHHHHhcCCCCCchHHHHHHHHHhcCChhHHHHHHHHHHhCCCccCCceeEEEe
Q 039695          398 DGGPLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMKRTGIHKEPGCSWVEI  477 (605)
Q Consensus       398 ~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~y~~~g~~~~a~~~~~~m~~~~~~~~~~~s~~~~  477 (605)
                      +  ..+|++|+.+|+.+|+++.|..+++++++++|++..+|..|+++|++.|+|++|.++++.|+++|+++.||+||+++
T Consensus       493 ~--~~~~~~Ll~a~~~~g~~~~a~~~~~~l~~~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~  570 (697)
T PLN03081        493 T--VNMWAALLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEV  570 (697)
T ss_pred             C--HHHHHHHHHHHHHcCCcHHHHHHHHHHhCCCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCCccCCCeeEEEE
Confidence            9  99999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEeeeeccccCccchHHHHHHHHHHHHHHHHCCccCCCccccccccchhhhhhhhhhhhHHHHHHHcccCCCCCCcEE
Q 039695          478 RDQTYAFYAGNALFERGSEVLSLLRELERKMKERGYVGGKTGLVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIR  557 (605)
Q Consensus       478 ~~~~~~f~~~~~~~~~~~~~~~~l~~l~~~m~~~g~~pd~~~~~~~~~~~~~~~~~~~~h~e~~a~~~~~~~~~~~~~~~  557 (605)
                      ++.+|.|++||..||+.+++++.++++..+|++.||.|| +++++|++++++|+..+.+||||||++|||+++|+|.|||
T Consensus       571 ~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~gy~~~-~~~~~~~~~~~~~~~~~~~hsekla~a~~l~~~~~~~~i~  649 (697)
T PLN03081        571 KKQDHSFFSGDRLHPQSREIYQKLDELMKEISEYGYVAE-ENELLPDVDEDEEKVSGRYHSEKLAIAFGLINTSEWTPLQ  649 (697)
T ss_pred             CCeEEEEccCCCCCccHHHHHHHHHHHHHHHHHcCCCCC-cchhhccccHHHHHHHHHhccHHHHHHhhCccCCCCCeEE
Confidence            999999999999999999999999999999999999999 8999999999999999999999999999999999999999


Q ss_pred             EEecccccCCchhhhHhhhhhccceEEEecCCcccccccccccCCCCC
Q 039695          558 IMKNLRMCRDCHDVFKLISDIVERDFVVRDVNRFHHFRNGSCSCGDFW  605 (605)
Q Consensus       558 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~g~~~~~~~w  605 (605)
                      |+||||+|+|||+|+|+||++.+|+|||||++|||||+||+|||+|||
T Consensus       650 i~knlr~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d~w  697 (697)
T PLN03081        650 ITQSHRICKDCHKVIKFIALVTKREIVVRDASRFHHFKLGKCSCGDYW  697 (697)
T ss_pred             EecCCEECCCchhhHHHHhhhcceEEEEecCCccccCCCCcccccccC
Confidence            999999999999999999999999999999999999999999999999



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query605
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 66.0 bits (160), Expect = 2e-11
 Identities = 91/640 (14%), Positives = 200/640 (31%), Gaps = 165/640 (25%)

Query: 33  FIQQLQECKHLI-SLASVHS-----EILKSGFLSNTFTLNHLINCYVRLKKTQVARQLFD 86
           F+    +CK +     S+ S      I+ S           L    +  K+ ++ ++  +
Sbjct: 29  FVDNF-DCKDVQDMPKSILSKEEIDHIIMSK--DAVSGTLRLFWT-LLSKQEEMVQKFVE 84

Query: 87  EMLEPNVVSYTSLMAGY-INMGQPQIALLLFQKMLGNLVWPNE-FTFATVIKACSMLADL 144
           E+L  N   Y  LM+       QP +   ++ +    L   N+ F    V +        
Sbjct: 85  EVLRIN---YKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRL-----QP 136

Query: 145 ITGKQIHTHIETFGFQYNLVVCSSLVDM--YGK-------CNDVDGARRVFDLMGCRNVV 195
               ++   +       N+++      +   GK       C       +V   M  +  +
Sbjct: 137 YL--KLRQALLELRPAKNVLIDG----VLGSGKTWVALDVCLS----YKVQCKMDFK--I 184

Query: 196 SWTSIIVAHAQNAQGHEALEMFREF------NYQSRDRPNQHMLASVINACASLGRLVSG 249
            W ++             LEM ++       N+ SR   + ++   + +  A L RL+  
Sbjct: 185 FWLNL----KNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKS 240

Query: 250 KV-AHGVVVRSGCEFNDVVASALVDMYA-KCGS-VNYSDK-VFNRISNPSVVTYTSMIVG 305
           K   + ++V       +V  +   + +   C   +    K V + +S     T T + + 
Sbjct: 241 KPYENCLLV-----LLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSA---ATTTHISLD 292

Query: 306 AAKYGLGRF-SLDLFNEMISRGIKPNDVTFVGVL--HACSHS----GLVDEGIQHLDSMY 358
                L       L  + +    +P D      L     + +     ++ E I+   + +
Sbjct: 293 HHSMTLTPDEVKSLLLKYL--DCRPQD------LPREVLTTNPRRLSIIAESIRDGLATW 344

Query: 359 RKYGIIPDAKHYTCVVDMLGRTGRL-------DEAYKLAKSIQVDPDGGP-------LLW 404
             +      KH  C  D L              E  K+   + V P           L+W
Sbjct: 345 DNW------KHVNC--DKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIW 396

Query: 405 GTLLSASRLHGRVDIAVEASNQ-LIESNQQVANAYVTLSNTYALAGEWENVHSLRSEMK- 462
             ++ +  +     +  +     L+E   +         +T ++        S+  E+K 
Sbjct: 397 FDVIKSDVM----VVVNKLHKYSLVEKQPK--------ESTISI-------PSIYLELKV 437

Query: 463 ----RTGIHK---------EPGCSW---VEIRDQTYAFYAGNALFERG-SEVLSLLRE-- 503
                  +H+         +   S        DQ +  + G+ L      E ++L R   
Sbjct: 438 KLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVF 497

Query: 504 -----LERKMKERGYVGGKTGLVFVDVED--EAREEIVGLHSERLALAFGLISIPKGITI 556
                LE+K++        +G +   ++     +  I     +   L   ++        
Sbjct: 498 LDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILD----FLP 553

Query: 557 RIMKNLRMCRDCHDVFKLISDIV------ERDFVVRDVNR 590
           +I +NL   +          D++      E + +  + ++
Sbjct: 554 KIEENLICSKYT--------DLLRIALMAEDEAIFEEAHK 585


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query605
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.84
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.83
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.81
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.8
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.77
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.73
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.72
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.71
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.71
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.7
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.7
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.69
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.68
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.67
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.67
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.58
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.58
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.54
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.53
3u4t_A272 TPR repeat-containing protein; structural genomics 99.5
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.5
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.5
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.49
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.49
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.47
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.47
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.46
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.45
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.45
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.45
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.44
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.42
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.42
3u4t_A272 TPR repeat-containing protein; structural genomics 99.41
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.41
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.4
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.39
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.38
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.35
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.33
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.33
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.3
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.29
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.29
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.28
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.28
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.26
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.26
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.23
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.22
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.21
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.17
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.17
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.17
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.16
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.15
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.1
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.07
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.05
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.0
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.97
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.95
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.91
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.91
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.9
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.9
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.88
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.87
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.84
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.83
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.81
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.78
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.77
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.73
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.73
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.73
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.72
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.7
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.7
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.68
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.68
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.67
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.66
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.64
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.64
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.62
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.59
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.59
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.58
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.57
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.56
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.54
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.53
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.53
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.52
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.52
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.52
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.5
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.48
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.48
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.47
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.45
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.43
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.43
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.42
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.41
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.41
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.38
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.37
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.37
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.35
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.34
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.34
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.32
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.32
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.31
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.3
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.29
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.28
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.26
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.24
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.23
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.22
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.22
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.21
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.2
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.19
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.19
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.18
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.18
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.18
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.16
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.15
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.12
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.12
3k9i_A117 BH0479 protein; putative protein binding protein, 98.11
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.11
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.09
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.09
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.09
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.08
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.04
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.99
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.99
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.97
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.97
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.94
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.91
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.9
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.9
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.89
3k9i_A117 BH0479 protein; putative protein binding protein, 97.89
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.87
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.87
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.87
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.85
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.83
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.81
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.81
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.78
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.77
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.77
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.77
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.74
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.73
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.73
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.71
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.58
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.56
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.48
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.39
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.39
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.38
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.33
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.29
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.23
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.16
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.09
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.07
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.83
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.76
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.63
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.62
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.61
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 96.59
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.59
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.58
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.49
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.45
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.25
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.02
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.55
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.51
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.34
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.25
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.98
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.0
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.98
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.94
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.64
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.38
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.33
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.32
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.17
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.83
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 91.98
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 91.06
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 90.8
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 89.37
2p58_C116 Putative type III secretion protein YSCG; type III 88.9
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.41
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.26
2uwj_G115 Type III export protein PSCG; virulence, chaperone 87.95
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 87.37
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 86.99
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 86.03
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 85.53
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 84.41
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 84.31
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 83.91
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 83.83
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 83.07
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 82.87
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 82.5
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 82.38
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 80.72
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=5.2e-39  Score=347.14  Aligned_cols=451  Identities=11%  Similarity=-0.045  Sum_probs=331.4

Q ss_pred             hhhhccchHHHHHHHHHhhhCCCCCChhhHHHHHHHhhChhHH---HHHHHHHHHhCCCCchHHHHHHHHHHHcCCChhH
Q 039695            4 SLTRNLIFTLAASSLTRQNKRSSCHTKAHFIQQLQECKHLISL---ASVHSEILKSGFLSNTFTLNHLINCYVRLKKTQV   80 (605)
Q Consensus         4 ~l~~~~~~~~a~~~l~~m~~~g~~~~~~~~~~~l~~~~~~~~~---~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~   80 (605)
                      .+.+.|++++|+.++++|..  ..|+..++..+...+.+.++.   ..++..+.  ..++++.+++.++.+|.++|++++
T Consensus        93 ~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~--~~~~~~~~~~~l~~~~~~~g~~~~  168 (597)
T 2xpi_A           93 DALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLLTKED--LYNRSSACRYLAAFCLVKLYDWQG  168 (597)
T ss_dssp             HHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTC--GGGTCHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHHHHHh--ccccchhHHHHHHHHHHHHhhHHH
Confidence            34445555555555555542  233444444444444444333   22222221  124455555555555555555555


Q ss_pred             HHHHHhcC-CCC------------------ChhhHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCC-hhhHHHHHHHHhc
Q 039695           81 ARQLFDEM-LEP------------------NVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPN-EFTFATVIKACSM  140 (605)
Q Consensus        81 A~~~f~~m-~~~------------------~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~pd-~~t~~~ll~a~~~  140 (605)
                      |.++|+++ +..                  ++.+|+.++.+|.+.|++++|+++|++|.+.+  |+ ...+..+...+..
T Consensus       169 A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~--p~~~~~~~~l~~~~~~  246 (597)
T 2xpi_A          169 ALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVD--AKCYEAFDQLVSNHLL  246 (597)
T ss_dssp             HHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHTTCS
T ss_pred             HHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC--chhhHHHHHHHHhhcc
Confidence            55555533 221                  24555555555555555555555555555432  22 2222222222211


Q ss_pred             cCChHH--HHHH-HHHHHHhCCCCchhHHHHHHHHHHhCCCHHHHHHHHhhcCC--CChhhHHHHHHHHHHcCChhHHHH
Q 039695          141 LADLIT--GKQI-HTHIETFGFQYNLVVCSSLVDMYGKCNDVDGARRVFDLMGC--RNVVSWTSIIVAHAQNAQGHEALE  215 (605)
Q Consensus       141 ~~~~~~--a~~~-~~~~~~~g~~~~~~~~~~Li~~y~~~g~~~~A~~~~~~m~~--~~~~~~~~li~~~~~~g~~~~A~~  215 (605)
                      .+..+.  +..+ +..+...+..+...+|+.++.+|.+.|++++|.++|+++..  ++..+|+.++.+|.+.|++++|++
T Consensus       247 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~  326 (597)
T 2xpi_A          247 TADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLA  326 (597)
T ss_dssp             CHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHH
T ss_pred             cchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHH
Confidence            111111  0011 22222222233344566667888899999999999999988  899999999999999999999999


Q ss_pred             HHHHHHHcCCCCCChhHHHhHHHhhcccCchhhHHHHHHHHHHhCCCCcHhHHHHHHHHHHhcCCHHHHHHHHhccCC--
Q 039695          216 MFREFNYQSRDRPNQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISN--  293 (605)
Q Consensus       216 ~~~~m~~~~~~~p~~~t~~~ll~a~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~~~~--  293 (605)
                      +|+++...+  +.+..++..++.++.+.|++++|..++..+.+.. +.+..+++.++.+|.++|++++|.++|+++.+  
T Consensus       327 ~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~  403 (597)
T 2xpi_A          327 ITTKILEID--PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD  403 (597)
T ss_dssp             HHHHHHHHC--TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHcC--cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC
Confidence            999999865  4578889999999999999999999999999765 66789999999999999999999999998753  


Q ss_pred             -CCcchHHHHHHHHHHcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccCcHHHHHHHHHHHHHhcCCCCcHHHHHH
Q 039695          294 -PSVVTYTSMIVGAAKYGLGRFSLDLFNEMISRGIKPNDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTC  372 (605)
Q Consensus       294 -~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~~~~~p~~~~~~~  372 (605)
                       .+..+|+.++.+|.+.|++++|+++|++|.+.+ +.+..++..++.+|.+.|++++|.++|+.+.+.  .+.+..+|+.
T Consensus       404 ~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~~  480 (597)
T 2xpi_A          404 PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYAL--FQYDPLLLNE  480 (597)
T ss_dssp             TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHH--CCCCHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCChHHHHH
Confidence             567799999999999999999999999999863 347889999999999999999999999999643  2335889999


Q ss_pred             HHHHHhhcCCHHHHHHHHHhCC-------CCCCchhhHHHHHHHHHHHcCChHHHHHHHHHHHhcCCCCCchHHHHHHHH
Q 039695          373 VVDMLGRTGRLDEAYKLAKSIQ-------VDPDGGPLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTY  445 (605)
Q Consensus       373 li~~~~~~g~~~~A~~~~~~m~-------~~p~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~y  445 (605)
                      ++.+|.+.|++++|.++|+++.       ..|+....+|..++.+|...|++++|++.++++++.+|+++.+|..++.+|
T Consensus       481 l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~  560 (597)
T 2xpi_A          481 LGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVY  560 (597)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHH
T ss_pred             HHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHH
Confidence            9999999999999999999863       345422579999999999999999999999999999999999999999999


Q ss_pred             HhcCChhHHHHHHHHHHhCCC
Q 039695          446 ALAGEWENVHSLRSEMKRTGI  466 (605)
Q Consensus       446 ~~~g~~~~a~~~~~~m~~~~~  466 (605)
                      .+.|++++|.+.++++.+...
T Consensus       561 ~~~g~~~~A~~~~~~~l~~~p  581 (597)
T 2xpi_A          561 LHKKIPGLAITHLHESLAISP  581 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHCT
T ss_pred             HHhCCHHHHHHHHHHHHhcCC
Confidence            999999999999999988543



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 605
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-06
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 48.9 bits (115), Expect = 1e-06
 Identities = 52/390 (13%), Positives = 110/390 (28%), Gaps = 23/390 (5%)

Query: 68  LINCYVRLKKTQVARQLFDEMLE--P-NVVSYTSLMAGYINMGQPQIALLLFQKMLGNLV 124
           L +   +    + A +   ++    P N      L + +    +   +       +    
Sbjct: 5   LAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAI--KQ 62

Query: 125 WPNE----FTFATVIKACSMLADLITGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVD 180
            P           V K    L + I   +    ++       + + ++LV        V 
Sbjct: 63  NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQ 122

Query: 181 GARRVFDLMGCRNVVSWTSIIVAHAQNAQGHEALEMFREFNYQSRDRPNQHMLASVINAC 240
                         V      +  A            +    Q         L       
Sbjct: 123 AYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLG---CVF 179

Query: 241 ASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISNPSVVTYT 300
            + G +          V     F D     L ++  +    + +   + R  + S     
Sbjct: 180 NAQGEIWLAIHHFEKAVTLDPNFLDA-YINLGNVLKEARIFDRAVAAYLRALSLSPNHAV 238

Query: 301 SMI-VGAAKYGLGRF--SLDLFNEMISRGIKPNDVTFVGVL-HACSHSGLVDEGIQHLDS 356
               +    Y  G    ++D +   I   ++P+       L +A    G V E     ++
Sbjct: 239 VHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALKEKGSVAEAEDCYNT 296

Query: 357 MYRKYGIIPDAKHYTCVVDMLGRTGRLDEAYK-LAKSIQVDPDGGPLLWGTLLSASRLHG 415
             R      D      + ++    G ++EA +   K+++V P+        L S  +  G
Sbjct: 297 ALRLCPTHAD--SLNNLANIKREQGNIEEAVRLYRKALEVFPEF-AAAHSNLASVLQQQG 353

Query: 416 RVDIAVEASNQLIESNQQVANAYVTLSNTY 445
           ++  A+    + I  +   A+AY  + NT 
Sbjct: 354 KLQEALMHYKEAIRISPTFADAYSNMGNTL 383


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query605
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.52
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.52
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.07
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.97
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.94
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.89
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.88
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.88
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.81
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.8
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.63
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.51
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.5
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.41
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.4
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.36
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.32
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.3
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.3
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.3
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.23
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.2
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.12
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.99
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.98
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.92
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.91
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.91
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.9
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.83
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.81
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.78
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.74
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.73
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.7
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.65
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.64
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.55
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.29
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.26
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.25
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.17
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.12
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.95
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.73
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.72
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.64
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.62
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.56
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.64
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.22
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.09
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.9
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.7
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.25
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 80.58
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=2.1e-20  Score=186.55  Aligned_cols=372  Identities=12%  Similarity=0.053  Sum_probs=289.5

Q ss_pred             HHHHHcCCChhHHHHHHhcCC--CC-ChhhHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCChhhHHHHHHHHhccCChH
Q 039695           69 INCYVRLKKTQVARQLFDEML--EP-NVVSYTSLMAGYINMGQPQIALLLFQKMLGNLVWPNEFTFATVIKACSMLADLI  145 (605)
Q Consensus        69 i~~~~~~g~~~~A~~~f~~m~--~~-~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~pd~~t~~~ll~a~~~~~~~~  145 (605)
                      ...+-+.|++++|.+.|+++.  .| ++.+|..+...|.+.|++++|+..|++..+.... +..++..+...+...|+++
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~-~~~a~~~l~~~~~~~g~~~   84 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYKERGQLQ   84 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHTCHH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHhhhhcccc
Confidence            345667899999999998873  23 5778888888999999999999999988875322 4567888888889999999


Q ss_pred             HHHHHHHHHHHhCCCCchhHHHHHHHHHHhCCCHHHHHHHHhhc---CCCChhhHHHHHHHHHHcCChhHHHHHHHHHHH
Q 039695          146 TGKQIHTHIETFGFQYNLVVCSSLVDMYGKCNDVDGARRVFDLM---GCRNVVSWTSIIVAHAQNAQGHEALEMFREFNY  222 (605)
Q Consensus       146 ~a~~~~~~~~~~g~~~~~~~~~~Li~~y~~~g~~~~A~~~~~~m---~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~  222 (605)
                      +|...+....+.. +.+..........+...+....+.......   .......+..........+....+...+.....
T Consensus        85 ~A~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (388)
T d1w3ba_          85 EAIEHYRHALRLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIE  163 (388)
T ss_dssp             HHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHH
T ss_pred             ccccccccccccc-cccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhc
Confidence            9999999888875 334444444444444444444443333322   234455566666777778888888888887776


Q ss_pred             cCCCCCChhHHHhHHHhhcccCchhhHHHHHHHHHHhCCCCcHhHHHHHHHHHHhcCCHHHHHHHHhccCC---CCcchH
Q 039695          223 QSRDRPNQHMLASVINACASLGRLVSGKVAHGVVVRSGCEFNDVVASALVDMYAKCGSVNYSDKVFNRISN---PSVVTY  299 (605)
Q Consensus       223 ~~~~~p~~~t~~~ll~a~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~~~~---~~~~~~  299 (605)
                      ..  +.+...+..+...+...+..+.|...+...++.. +.+...+..+...|...|++++|...|+....   .+...|
T Consensus       164 ~~--~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~  240 (388)
T d1w3ba_         164 TQ--PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVH  240 (388)
T ss_dssp             HC--TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHH
T ss_pred             cC--cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHH
Confidence            53  3456667777788888899999999998888765 45677888899999999999999999887653   455677


Q ss_pred             HHHHHHHHHcCChhHHHHHHHHHHHcCCCC-CHHHHHHHHHHHhccCcHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHh
Q 039695          300 TSMIVGAAKYGLGRFSLDLFNEMISRGIKP-NDVTFVGVLHACSHSGLVDEGIQHLDSMYRKYGIIPDAKHYTCVVDMLG  378 (605)
Q Consensus       300 ~~li~~~~~~g~~~~A~~l~~~m~~~g~~p-d~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~~~~~p~~~~~~~li~~~~  378 (605)
                      ..+...+.+.|++++|+..|++..+.  .| +..++..+..++...|++++|.+.++.....  .+.+...+..+...+.
T Consensus       241 ~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~  316 (388)
T d1w3ba_         241 GNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL--CPTHADSLNNLANIKR  316 (388)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc--CCccchhhhHHHHHHH
Confidence            88888999999999999999998874  34 4667888888999999999999999988543  3445778888999999


Q ss_pred             hcCCHHHHHHHHHhC-CCCCCchhhHHHHHHHHHHHcCChHHHHHHHHHHHhcCCCCCchHHHHHHHHHhcCC
Q 039695          379 RTGRLDEAYKLAKSI-QVDPDGGPLLWGTLLSASRLHGRVDIAVEASNQLIESNQQVANAYVTLSNTYALAGE  450 (605)
Q Consensus       379 ~~g~~~~A~~~~~~m-~~~p~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~y~~~g~  450 (605)
                      +.|++++|++.+++. ...|+ ++.+|..+..++...|++++|+..++++++++|+++.+|..|+.+|.+.|+
T Consensus       317 ~~~~~~~A~~~~~~al~~~p~-~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         317 EQGNIEEAVRLYRKALEVFPE-FAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TTTCHHHHHHHHHHHTTSCTT-CHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HCCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            999999999999884 45565 367888999999999999999999999999999999999999999988875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure