Citrus Sinensis ID: 039712

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
ELLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNNHFHTVSQWPASKFSLTYAFRLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNHGDGRPFDGRGGPDGTLAHAFAPTNGRFHYDADEPWAVGAVQGAFDSLKDTYIIAPSTAVQNAPCTATVLWRSLQGDDIQGIKALYNV
cHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEcccccccEEEEEcccccccccccccccccccEEEEEcccccccEEccccccccccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcc
ccHHHHHHHHHHHHcccccccccHHHHHHHcccccccccccccEEEEccccccccccEEEEEEEEccccccEEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccEEEEEEccccccccccccccccccccEEEcccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEcccccHHHHHHHHHHHcc
ELLESTIKTCQLNfnlkstgfldantvakmrtprcgvadivngttrmrsgkkkqqqnnhfhtvsqwpaskfSLTYAFRlgtrgdaitPVARAFQTWAANTQFRFSKiedfagadikisfesrnhgdgrpfdgrggpdgtlahafaptngrfhydadepwavgaVQGAFdslkdtyiiapstavqnapcTATVLWRSLQGDDIQGIKALYNV
ellestiktcqlnfnlkstgfldantvakmrtprcgvADIVNGTTrmrsgkkkqqqnnhfhtvsqwpaskFSLTYAFRLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKIsfesrnhgdgrpfdgrggPDGTLAHAFAPTNGRFHYDADEPWAVGAVQGAFDSLKDTYIIAPSTAVQNAPCTATVLWRslqgddiqgikalynv
ELLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNNHFHTVSQWPASKFSLTYAFRLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNHgdgrpfdgrggpdgTLAHAFAPTNGRFHYDADEPWAVGAVQGAFDSLKDTYIIAPSTAVQNAPCTATVLWRSLQGDDIQGIKALYNV
******IKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNG****************FHTVSQWPASKFSLTYAFRLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISF*******************TLAHAFAPTNGRFHYDADEPWAVGAVQGAFDSLKDTYIIAPSTAVQNAPCTATVLWRSLQGDDIQGIKALY**
*LLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTT*******KQQQNNHFHTVSQWPASKFSLTYAFRLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNHGDGRPFDGRGGPDGTLAHAFAPTNGRFHYDADEPWAVGAVQGAFDSLKDTYIIAPSTAVQNAPCTATVLWRSLQGDDIQGIKALYNV
ELLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTR**************HTVSQWPASKFSLTYAFRLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNHGDGRPFDGRGGPDGTLAHAFAPTNGRFHYDADEPWAVGAVQGAFDSLKDTYIIAPSTAVQNAPCTATVLWRSLQGDDIQGIKALYNV
ELLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNNHFHTVSQWPASKFSLTYAFRLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNHGDGRPFDGRGGPDGTLAHAFAPTNGRFHYDADEPWAVGAVQGAFDSLKDTYIIAPSTAVQNAPCTATVLWRSLQGDDIQGIKALYNV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ELLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNNHFHTVSQWPASKFSLTYAFRLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNHGDGRPFDGRGGPDGTLAHAFAPTNGRFHYDADEPWAVGAVQGAFDSLKDTYIIAPSTAVQNAPCTATVLWRSLQGDDIQGIKALYNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query211 2.2.26 [Sep-21-2011]
P29136305 Metalloendoproteinase 1 O no no 0.976 0.675 0.373 2e-29
P08253 660 72 kDa type IV collagenas yes no 0.701 0.224 0.419 3e-21
P50757 662 72 kDa type IV collagenas yes no 0.701 0.223 0.413 1e-20
P91953 591 50 kDa hatching enzyme OS N/A no 0.867 0.309 0.327 2e-20
P57748 482 Matrix metalloproteinase- yes no 0.853 0.373 0.328 2e-20
Q90611 663 72 kDa type IV collagenas yes no 0.701 0.223 0.401 2e-20
P33436 662 72 kDa type IV collagenas yes no 0.701 0.223 0.407 3e-20
P22757 587 Hatching enzyme OS=Parace N/A no 0.876 0.315 0.311 3e-20
P33434 662 72 kDa type IV collagenas no no 0.701 0.223 0.407 4e-20
O60882 483 Matrix metalloproteinase- no no 0.886 0.387 0.334 7e-20
>sp|P29136|MEP1_SOYBN Metalloendoproteinase 1 OS=Glycine max PE=1 SV=2 Back     alignment and function desciption
 Score =  129 bits (323), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 113/230 (49%), Gaps = 24/230 (10%)

Query: 1   ELLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNNHF 60
           + L S IKT Q N+NL  TG  D NT+ ++ TPRCGV DI+  T +  S          F
Sbjct: 79  DTLVSAIKTYQKNYNLNVTGKFDINTLKQIMTPRCGVPDIIINTNKTTSFGMISDY-TFF 137

Query: 61  HTVSQWPASKFSLTYAFRLGTRGDAI--TPVARAFQTWAANTQFRFSKIEDFAGADIKIS 118
             + +W A    LTYAF    R D    + +ARAF  W       F +   +  A+IKI 
Sbjct: 138 KDMPRWQAGTTQLTYAFSPEPRLDDTFKSAIARAFSKWTPVVNIAFQETTSYETANIKIL 197

Query: 119 FESRNHGDGRPFDGRGGPDGTLAHAFAPTNGRFHYDADEPWAVGA------VQGAFDSLK 172
           F S+NHGD  PFD   GP G L HAFAPT+GR H+DADE W          V  AFD L+
Sbjct: 198 FASKNHGDPYPFD---GPGGILGHAFAPTDGRCHFDADEYWVASGDVTKSPVTSAFD-LE 253

Query: 173 DTYI--IAPSTAVQNAPCTATVLWRS---------LQGDDIQGIKALYNV 211
              +  I     + ++     +++ S         L  DDI GI+ LY +
Sbjct: 254 SVAVHEIGHLLGLGHSSDLRAIMYPSIPPRTRKVNLAQDDIDGIRKLYGI 303
Specificity similar to that of mammalian matrix metalloproteases. May act against cell wall components.
Glycine max (taxid: 3847)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|P08253|MMP2_HUMAN 72 kDa type IV collagenase OS=Homo sapiens GN=MMP2 PE=1 SV=2 Back     alignment and function description
>sp|P50757|MMP2_RABIT 72 kDa type IV collagenase OS=Oryctolagus cuniculus GN=MMP2 PE=2 SV=1 Back     alignment and function description
>sp|P91953|HE_HEMPU 50 kDa hatching enzyme OS=Hemicentrotus pulcherrimus PE=1 SV=1 Back     alignment and function description
>sp|P57748|MMP20_MOUSE Matrix metalloproteinase-20 OS=Mus musculus GN=Mmp20 PE=2 SV=1 Back     alignment and function description
>sp|Q90611|MMP2_CHICK 72 kDa type IV collagenase OS=Gallus gallus GN=MMP2 PE=1 SV=1 Back     alignment and function description
>sp|P33436|MMP2_RAT 72 kDa type IV collagenase OS=Rattus norvegicus GN=Mmp2 PE=2 SV=2 Back     alignment and function description
>sp|P22757|HE_PARLI Hatching enzyme OS=Paracentrotus lividus PE=1 SV=1 Back     alignment and function description
>sp|P33434|MMP2_MOUSE 72 kDa type IV collagenase OS=Mus musculus GN=Mmp2 PE=2 SV=1 Back     alignment and function description
>sp|O60882|MMP20_HUMAN Matrix metalloproteinase-20 OS=Homo sapiens GN=MMP20 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
255552736311 Metalloendoproteinase 1 precursor, putat 0.985 0.668 0.536 9e-60
449449419 319 PREDICTED: metalloendoproteinase 1-like 0.981 0.648 0.491 6e-53
449449409 313 PREDICTED: metalloendoproteinase 1-like 0.976 0.658 0.484 4e-51
225452580 319 PREDICTED: metalloendoproteinase 1 [Viti 0.976 0.645 0.487 4e-50
449449417 316 PREDICTED: metalloendoproteinase 1-like 0.976 0.651 0.471 2e-49
449492743 457 PREDICTED: metalloendoproteinase 1-like 0.976 0.450 0.471 3e-49
147790365 319 hypothetical protein VITISV_011608 [Viti 0.981 0.648 0.475 8e-49
255552738 321 Matrix metalloproteinase, putative [Rici 0.971 0.638 0.453 2e-48
225452578 321 PREDICTED: metalloendoproteinase 1-like 0.976 0.641 0.493 9e-48
296087729262 unnamed protein product [Vitis vinifera] 0.914 0.736 0.488 2e-47
>gi|255552736|ref|XP_002517411.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] gi|223543422|gb|EEF44953.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  235 bits (599), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 152/231 (65%), Gaps = 23/231 (9%)

Query: 1   ELLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNNH- 59
           +LLE  +KT Q N++L  TGFLD+ TV KM  PRCGVADI+NGTTRM+S  K    ++  
Sbjct: 84  DLLEYALKTYQFNYHLNVTGFLDSETVTKMMMPRCGVADIINGTTRMQSSNKNPHHHSST 143

Query: 60  -FHTVSQ---------WPASKFSLTYAFRLGTRGDAITPVARAFQTWAANTQFRFSKIED 109
            FHTVS          WPASK+ LTY F  GT   A+ PVA+AFQTWAANT FRF++++D
Sbjct: 144 SFHTVSHYEFFPGNPRWPASKYHLTYGFLPGTPNQAMEPVAKAFQTWAANTHFRFTRVQD 203

Query: 110 FAGADIKISFESRNHGDGRPFDGRGGPDGTLAHAFAPTNGRFHYDADEPWAVGAVQGAFD 169
           +  ADI I F   +HGDG PFDGRG   GTLAHAFAP +GRFHYD DE WAVGA QGAFD
Sbjct: 204 YRAADITIGFHRGDHGDGSPFDGRG---GTLAHAFAPQDGRFHYDGDEHWAVGATQGAFD 260

Query: 170 ----SLKDT--YIIAPSTAVQNA---PCTATVLWRSLQGDDIQGIKALYNV 211
               +L +    +    ++V+ A   P   +   + L  DDIQGI+ALYNV
Sbjct: 261 VETVALHEIGHLLGLGHSSVEGAIMHPSIQSGATKGLHSDDIQGIRALYNV 311

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449449419|ref|XP_004142462.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] gi|449492747|ref|XP_004159088.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449449409|ref|XP_004142457.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] gi|449527361|ref|XP_004170680.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225452580|ref|XP_002280833.1| PREDICTED: metalloendoproteinase 1 [Vitis vinifera] gi|147807820|emb|CAN73129.1| hypothetical protein VITISV_030257 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449449417|ref|XP_004142461.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449492743|ref|XP_004159087.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147790365|emb|CAN59960.1| hypothetical protein VITISV_011608 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255552738|ref|XP_002517412.1| Matrix metalloproteinase, putative [Ricinus communis] gi|223543423|gb|EEF44954.1| Matrix metalloproteinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225452578|ref|XP_002280805.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087729|emb|CBI34985.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
TAIR|locus:2020548378 MMP "matrix metalloproteinase" 0.796 0.444 0.360 8.2e-26
TAIR|locus:2025891360 AT1G59970 [Arabidopsis thalian 0.748 0.438 0.375 4.4e-25
TAIR|locus:2032467384 AT1G24140 [Arabidopsis thalian 0.848 0.466 0.34 3.9e-24
TAIR|locus:2130928364 AT4G16640 [Arabidopsis thalian 0.720 0.417 0.369 1.5e-17
UNIPROTKB|P08253 660 MMP2 "72 kDa type IV collagena 0.701 0.224 0.365 2.5e-15
UNIPROTKB|F1MKH8 661 MMP2 "PEX" [Bos taurus (taxid: 0.701 0.223 0.359 3.3e-15
UNIPROTKB|Q90611 663 MMP2 "72 kDa type IV collagena 0.701 0.223 0.347 6.9e-15
UNIPROTKB|F1PMK7 653 MMP2 "Uncharacterized protein" 0.701 0.226 0.359 8.2e-15
WB|WBGene00016283 579 C31B8.8 [Caenorhabditis elegan 0.687 0.250 0.314 1.5e-14
RGD|621316 662 Mmp2 "matrix metallopeptidase 0.701 0.223 0.353 1.8e-14
TAIR|locus:2020548 MMP "matrix metalloproteinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 8.2e-26, Sum P(2) = 8.2e-26
 Identities = 67/186 (36%), Positives = 97/186 (52%)

Query:     1 ELLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNN-- 58
             ++L++ ++  Q NFNL  TG LDA T+  +  PRCG  D+VNGT+ M  G++K  + N  
Sbjct:    86 DILKAAVELYQTNFNLNVTGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFS 145

Query:    59 --HFHTVSQ---------WPASKFSLTYAFR-LGTRGDAITPV-ARAFQTWAANTQFRFS 105
               H H V +         WP ++  LTYAF       + +  V +RAF  W+  T   F+
Sbjct:   146 RTHLHAVKRYTLFPGEPRWPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFT 205

Query:   106 KIEDFAGADIKISFESRNHXXXXXXXXXXXXXXTLAHAFAPTNGRFHYDADEPWAVGAVQ 165
               E F+ +DI I F + +H              TLAHAF+P +G+FH DADE W V    
Sbjct:   206 LSESFSTSDITIGFYTGDHGDGEPFDGVLG---TLAHAFSPPSGKFHLDADENWVVSGDL 262

Query:   166 GAFDSL 171
              +F S+
Sbjct:   263 DSFLSV 268
GO:0004222 "metalloendopeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0008237 "metallopeptidase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0031012 "extracellular matrix" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2025891 AT1G59970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032467 AT1G24140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130928 AT4G16640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P08253 MMP2 "72 kDa type IV collagenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MKH8 MMP2 "PEX" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q90611 MMP2 "72 kDa type IV collagenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PMK7 MMP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00016283 C31B8.8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|621316 Mmp2 "matrix metallopeptidase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.24LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
cd04278157 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, 3e-32
pfam00413159 pfam00413, Peptidase_M10, Matrixin 2e-28
smart00235139 smart00235, ZnMc, Zinc-dependent metalloprotease 1e-08
>gnl|CDD|239805 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information 
 Score =  113 bits (286), Expect = 3e-32
 Identities = 60/165 (36%), Positives = 74/165 (44%), Gaps = 35/165 (21%)

Query: 69  SKFSLTYAF----RLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNH 124
           SK +LTY          R D    +ARAF+ W+  T   F ++     ADI+ISF   NH
Sbjct: 3   SKTNLTYRILNYPPDLPRDDVRRAIARAFRVWSDVTPLTFREVTSGQEADIRISFARGNH 62

Query: 125 GDGRPFDGRGGPDGTLAHAFAP--TNGRFHYDADEPWAVGAVQGAFDSLKDTYIIAPSTA 182
           GDG PFD   GP GTLAHAF P    G  H+D DE W +G+  G  D          S A
Sbjct: 63  GDGYPFD---GPGGTLAHAFFPGGIGGDIHFDDDEQWTLGSDSGGTDLF--------SVA 111

Query: 183 V--------------QNA---PC-TATVLWRSLQGDDIQGIKALY 209
                           ++   P     V    L  DDI+GI+ALY
Sbjct: 112 AHEIGHALGLGHSSDPDSIMYPYYQGPVPKFKLSQDDIRGIQALY 156

MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases). Length = 157
>gnl|CDD|215908 pfam00413, Peptidase_M10, Matrixin Back     alignment and domain information
>gnl|CDD|214576 smart00235, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
KOG1565 469 consensus Gelatinase A and related matrix metallop 100.0
cd04278157 ZnMc_MMP Zinc-dependent metalloprotease, matrix me 99.97
PF00413154 Peptidase_M10: Matrixin This Prosite motif covers 99.95
cd04279156 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MM 99.81
cd04268165 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_ 99.64
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc 99.63
cd04277186 ZnMc_serralysin_like Zinc-dependent metalloproteas 99.61
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-fa 99.03
cd04276197 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MM 98.69
cd04327198 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MM 98.68
PF0147157 PG_binding_1: Putative peptidoglycan binding domai 98.51
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, 97.1
PF12388211 Peptidase_M57: Dual-action HEIGH metallo-peptidase 96.89
) family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01400">PF01400191 Astacin: Astacin (Peptidase family M12A) This Pros 96.52
cd04281200 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1 96.17
TIGR02869201 spore_SleB spore cortex-lytic enzyme. Members of t 96.17
PRK10594608 murein L,D-transpeptidase; Provisional 95.59
cd04282230 ZnMc_meprin Zinc-dependent metalloprotease, meprin 94.28
COG2989561 Uncharacterized protein conserved in bacteria [Fun 93.58
KOG3714 411 consensus Meprin A metalloprotease [Posttranslatio 89.64
cd04283182 ZnMc_hatching_enzyme Zinc-dependent metalloproteas 89.14
COG3409185 Putative peptidoglycan-binding domain-containing p 88.39
PF0937472 PG_binding_3: Predicted Peptidoglycan domain; Inte 86.15
COG5549236 Predicted Zn-dependent protease [Posttranslational 81.72
PF02031132 Peptidase_M7: Streptomyces extracellular neutral p 81.17
>KOG1565 consensus Gelatinase A and related matrix metalloproteases [Posttranslational modification, protein turnover, chaperones; Extracellular structures] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-51  Score=380.03  Aligned_cols=188  Identities=38%  Similarity=0.598  Sum_probs=167.8

Q ss_pred             hHHHHHHHHHHhcCCCccccCCHHHHHHHhCCCCCcccCCCCcccccCccccccccccccccCCCCCCccceeEEeecCC
Q 039712            2 LLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNNHFHTVSQWPASKFSLTYAFRLGT   81 (211)
Q Consensus         2 ~~~~Ai~~fQ~~~~L~~TG~lD~~T~~~M~~pRCG~pD~~~~~~~~~~~~~~~~~~~~~~~~~kW~~~k~~LTy~i~~~~   81 (211)
                      .+++||+.||++++|++||+||.+|+++|++|||||||.               ++.++..+.||+  |.+|||+|.+++
T Consensus        57 ~~~~al~~~q~~~~l~~tG~lD~~Tl~~m~~prCgvpd~---------------~~~~~~~~~kW~--k~~lT~ri~n~~  119 (469)
T KOG1565|consen   57 VLEDALKMMQDFFGLPVTGKLDNATLALMNKPRCGVPDG---------------RYRYFPGKPKWN--KEHLTYRIKNYT  119 (469)
T ss_pred             hhHHHHHhhhhhcCccccCCcchhhhhhccCCCcCCCCC---------------ccccCcccCccc--ccccceeccccC
Confidence            578999999999999999999999999999999999991               023456678998  999999999986


Q ss_pred             cc----hhHHHHHHHHHHHHccCCcceEeccCCCCcceEEEeeeccCCCCCCCCCCCCCCCccccccCC---CCCccccc
Q 039712           82 RG----DAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNHGDGRPFDGRGGPDGTLAHAFAP---TNGRFHYD  154 (211)
Q Consensus        82 ~~----~~~~~i~~Af~~Ws~v~~l~F~ev~~~~~aDI~I~F~~~~hgd~~~fDG~g~~~g~lAhAf~P---~~G~ihfD  154 (211)
                      +.    ++.+++++||++|++|++|+|+||.....|||+|.|..+.|||++||||+|   |+|||||+|   .+|++|||
T Consensus       120 ~~l~~~~vr~~~~~Af~~Ws~vtpl~f~e~~~~~~aDi~i~F~~~~h~d~~PFDG~~---g~laHAf~Pg~~~~G~~hfD  196 (469)
T KOG1565|consen  120 PYLPQAEVRCAKSEAFKLWSDVTPLTFQEVKEEGEADIRISFFPGDHGDGFPFDGPG---GVLAHAFFPGPGIGGDLHFD  196 (469)
T ss_pred             CCCCHHHHHHHHHHHHhhcccCCCCccccCCCCCCCceeeeeeccCCCCCCcccCCC---CceecccCCCCCCCCccccC
Confidence            43    455667999999999999999999975699999999999999999999999   999999999   67899999


Q ss_pred             CCCCcccCCCCCceeeeeEE-------eeccCCCCCCCC---CcccCCCCC-CCCHHHHHHHHHhhCC
Q 039712          155 ADEPWAVGAVQGAFDSLKDT-------YIIAPSTAVQNA---PCTATVLWR-SLQGDDIQGIKALYNV  211 (211)
Q Consensus       155 ~de~Wt~~~~~~~~~l~~Va-------LGL~HS~~~~~s---p~y~~~~~~-~L~~dDi~~Iq~LYG~  211 (211)
                      +||.|+.+ ...++||+.||       |||+|| ++++|   |+|++.... .|+.|||.|||.|||.
T Consensus       197 ~dE~Wt~~-~~~g~~l~~Va~HEiGH~LGL~HS-~~~~aiM~P~y~~~~~~~~L~~DDv~giq~lYG~  262 (469)
T KOG1565|consen  197 KDETWTYG-DSNGVDLFLVAAHEIGHALGLGHS-SDPDAIMYPFYQPDSGNFDLSQDDVRGIQHLYGG  262 (469)
T ss_pred             cccceecc-CCccchhHHHhhhhcccccccCCC-CCcccccccccccCCCCcccChhhhhhhHHHhCC
Confidence            99999997 33589999997       999999 99999   899862223 8999999999999994

>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site Back     alignment and domain information
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>PF01471 PG_binding_1: Putative peptidoglycan binding domain; InterPro: IPR002477 This entry represents peptidoglycan binding domain (PGBD), as well as related domains that share the same structure Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>PF12388 Peptidase_M57: Dual-action HEIGH metallo-peptidase; InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57 Back     alignment and domain information
>PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site Back     alignment and domain information
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information
>TIGR02869 spore_SleB spore cortex-lytic enzyme Back     alignment and domain information
>PRK10594 murein L,D-transpeptidase; Provisional Back     alignment and domain information
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>COG2989 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3714 consensus Meprin A metalloprotease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>COG3409 Putative peptidoglycan-binding domain-containing protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF09374 PG_binding_3: Predicted Peptidoglycan domain; InterPro: IPR018537 This family contains a potential peptidoglycan binding domain Back     alignment and domain information
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02031 Peptidase_M7: Streptomyces extracellular neutral proteinase (M7) family; InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
1ck7_A 631 Gelatinase A (Full-Length) Length = 631 4e-15
1eak_A 421 Catalytic Domain Of Prommp-2 E404q Mutant Length = 7e-15
1slm_A255 Crystal Structure Of Fibroblast Stromelysin-1: The 1e-12
1su3_A 450 X-Ray Structure Of Human Prommp-1: New Insights Int 2e-11
1l6j_A 425 Crystal Structure Of Human Matrix Metalloproteinase 8e-09
1qib_A161 Crystal Structure Of Gelatinase A Catalytic Domain 7e-08
3ayu_A167 Crystal Structure Of Mmp-2 Active Site Mutant In Co 8e-08
1hov_A163 Solution Structure Of A Catalytic Domain Of Mmp-2 C 6e-06
1hfs_A160 Crystal Structure Of The Catalytic Domain Of Human 3e-05
1caq_A168 X-Ray Structure Of Human Stromelysin Catalytic Doma 3e-05
1qic_A161 Crystal Structure Of Stromelysin Catalytic Domain L 3e-05
1usn_A165 Crystal Structure Of The Catalytic Domain Of Human 3e-05
2ddy_A173 Solution Structure Of Matrilysin (Mmp-7) Complexed 3e-05
2d1o_A171 Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Aci 3e-05
2jnp_A161 Solution Structure Of Matrix Metalloproteinase 3 (M 3e-05
1qia_A162 Crystal Structure Of Stromelysin Catalytic Domain L 3e-05
1b8y_A167 X-Ray Structure Of Human Stromelysin Catalytic Doma 3e-05
1biw_A173 Design And Synthesis Of Conformationally-Constraine 3e-05
2y6d_A174 The Discovery Of Mmp7 Inhibitors Exploiting A Novel 3e-05
1gkc_A163 Mmp9-inhibitor Complex Length = 163 3e-05
1ums_A174 Stromelysin-1 Catalytic Domain With Hydrophobic Inh 4e-05
3oho_A169 Catalytic Domain Of Stromelysin-1 In Complex With N 4e-05
1c8t_A167 Human Stromelysin-1 (E202q) Catalytic Domain Comple 4e-05
1gkd_A163 Mmp9 Active Site Mutant-Inhibitor Complex Length = 4e-05
1mmp_A170 Matrilysin Complexed With Carboxylate Inhibitor Len 4e-05
2ovx_A159 Mmp-9 Active Site Mutant With Barbiturate Inhibitor 4e-05
2y6c_A165 The Discovery Of Mmp7 Inhibitors Exploiting A Novel 4e-05
1jk3_A158 Crystal Structure Of Human Mmp-12 (Macrophage Elast 5e-05
2poj_A164 Nmr Solution Structure Of The Inhibitor-Free State 5e-05
2w0d_A164 Does A Fast Nuclear Magnetic Resonance Spectroscopy 5e-05
2jsd_A160 Solution Structure Of Mmp20 Complexed With Nngh Len 5e-05
4gr8_A152 Crystal Structure Of The Catalytic Domain Of Human 6e-05
2k9c_A152 Paramagnetic Shifts In Solid-State Nmr Of Proteins 6e-05
1os2_A165 Ternary Enzyme-Product-Inhibitor Complexes Of Human 7e-05
3f15_A158 Crystal Structure Of The Catalytic Domain Of Human 7e-05
1rmz_A159 Crystal Structure Of The Catalytic Domain Of Human 7e-05
2k2g_A165 Solution Structure Of The Wild-Type Catalytic Domai 7e-05
2z2d_A164 Solution Structure Of Human Macrophage Elastase (Mm 7e-05
2clt_A 367 Crystal Structure Of The Active Form (Full-Length) 8e-05
1jiz_A166 Crystal Structure Analysis Of Human Macrophage Elas 8e-05
1utt_A159 Crystal Structure Of Mmp-12 Complexed To 2- (1,3-Di 8e-05
2wo8_A164 Mmp12 Complex With A Beta Hydroxy Carboxylic Acid L 8e-05
1uea_A173 Mmp-3TIMP-1 Complex Length = 173 8e-05
1ros_A163 Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dio 8e-05
1cgf_A162 Crystal Structures Of Recombinant 19-Kda Human Fibr 8e-05
2j0t_A170 Crystal Structure Of The Catalytic Domain Of Mmp-1 9e-05
966c_A157 Crystal Structure Of Fibroblast Collagenase-1 Compl 9e-05
3shi_A156 Crystal Structure Of Human Mmp1 Catalytic Domain At 9e-05
3ayk_A169 Catalytic Fragment Of Human Fibroblast Collagenase 9e-05
1cge_A168 Crystal Structures Of Recombinant 19-Kda Human Fibr 9e-05
1cgl_A169 Structure Of The Catalytic Domain Of Fibroblast Col 1e-04
3ba0_A 365 Crystal Structure Of Full-Length Human Mmp-12 Lengt 1e-04
1fbl_A 370 Structure Of Full-Length Porcine Synovial Collagena 2e-04
1cxv_A164 Structure Of Recombinant Mouse Collagenase-3 (Mmp-1 3e-04
1hv5_A165 Crystal Structure Of The Stromelysin-3 (Mmp-11) Cat 3e-04
456c_A168 Crystal Structure Of Collagenase-3 (Mmp-13) Complex 4e-04
2d1n_A166 Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Ac 4e-04
3ljz_A164 Crystal Structure Of Human Mmp-13 Complexed With An 5e-04
3kry_A164 Crystal Structure Of Mmp-13 In Complex With Sc-7808 5e-04
1eub_A171 Solution Structure Of The Catalytic Domain Of Human 5e-04
1fls_A165 Solution Structure Of The Catalytic Fragment Of Hum 5e-04
4a7b_A169 Mmp13 In Complex With A Novel Selective Non Zinc Bi 5e-04
3kec_A167 Crystal Structure Of Human Mmp-13 Complexed With A 5e-04
2ow9_A170 Crystal Structure Analysis Of The Mmp13 Catalytic D 5e-04
1q3a_A165 Crystal Structure Of The Catalytic Domain Of Human 5e-04
3v96_B165 Complex Of Matrix Metalloproteinase-10 Catalytic Do 5e-04
>pdb|1CK7|A Chain A, Gelatinase A (Full-Length) Length = 631 Back     alignment and structure 
Iteration: 1

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/167 (36%), Positives = 74/167 (44%), Gaps = 19/167 (11%)
Query: 2   LLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNNHFH 61
           +L+ T+K  Q  F L  TG LD NT+  MR PRCG  D+ N     R  K K  +N   +
Sbjct: 40  VLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPR--KPKWDKNQITY 97
Query: 62  TVSQWPASKFSLTYAFRLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFES 121
            +          T      T  DA    ARAFQ W+  T  RFS+I D   ADI I+F  
Sbjct: 98  RI-------IGYTPDLDPETVDDAF---ARAFQVWSDVTPLRFSRIHD-GEADIMINFGR 146
Query: 122 RNHXXXXXXXXXXXXXXTLAHAFAP---TNGRFHYDADEPWAVGAVQ 165
             H               LAHAFAP     G  H+D DE W +G  Q
Sbjct: 147 WEH---GDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQ 190
>pdb|1EAK|A Chain A, Catalytic Domain Of Prommp-2 E404q Mutant Length = 421 Back     alignment and structure
>pdb|1SLM|A Chain A, Crystal Structure Of Fibroblast Stromelysin-1: The C-Truncated Human Proenzyme Length = 255 Back     alignment and structure
>pdb|1SU3|A Chain A, X-Ray Structure Of Human Prommp-1: New Insights Into Collagenase Action Length = 450 Back     alignment and structure
>pdb|1L6J|A Chain A, Crystal Structure Of Human Matrix Metalloproteinase Mmp9 (gelatinase B) Length = 425 Back     alignment and structure
>pdb|1QIB|A Chain A, Crystal Structure Of Gelatinase A Catalytic Domain Length = 161 Back     alignment and structure
>pdb|3AYU|A Chain A, Crystal Structure Of Mmp-2 Active Site Mutant In Complex With App- Drived Decapeptide Inhibitor Length = 167 Back     alignment and structure
>pdb|1HOV|A Chain A, Solution Structure Of A Catalytic Domain Of Mmp-2 Complexed With Sc-74020 Length = 163 Back     alignment and structure
>pdb|1HFS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With The N-Carboxy-Alkyl Inhibitor L-764,004 Length = 160 Back     alignment and structure
>pdb|1CAQ|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexes With Non-Peptide Inhibitors: Implication For Inhibitor Selectivity Length = 168 Back     alignment and structure
>pdb|1QIC|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 161 Back     alignment and structure
>pdb|1USN|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With Thiadiazole Inhibitor Pnu-142372 Length = 165 Back     alignment and structure
>pdb|2DDY|A Chain A, Solution Structure Of Matrilysin (Mmp-7) Complexed To Constraint Conformational Sulfonamide Inhibitor Length = 173 Back     alignment and structure
>pdb|2D1O|A Chain A, Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Acid Inhibitor Length = 171 Back     alignment and structure
>pdb|2JNP|A Chain A, Solution Structure Of Matrix Metalloproteinase 3 (Mmp-3) In The Presence Of N-Isobutyl-N-[4- Methoxyphenylsulfonyl]glycyl Hydroxamic Acid (Nngh) Length = 161 Back     alignment and structure
>pdb|1QIA|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 162 Back     alignment and structure
>pdb|1B8Y|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexed With Non-Peptide Inhibitors: Implications For Inhibitor Selectivity Length = 167 Back     alignment and structure
>pdb|1BIW|A Chain A, Design And Synthesis Of Conformationally-Constrained Mmp Inhibitors Length = 173 Back     alignment and structure
>pdb|2Y6D|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 174 Back     alignment and structure
>pdb|1GKC|A Chain A, Mmp9-inhibitor Complex Length = 163 Back     alignment and structure
>pdb|1UMS|A Chain A, Stromelysin-1 Catalytic Domain With Hydrophobic Inhibitor Bound, Ph 7.0, 32oc, 20 Mm Cacl2, 15% Acetonitrile; Nmr Ensemble Of 20 Structures Length = 174 Back     alignment and structure
>pdb|3OHO|A Chain A, Catalytic Domain Of Stromelysin-1 In Complex With N-Hydroxy-2-(4- Methylphenylsulfonamido)acetamide Length = 169 Back     alignment and structure
>pdb|1C8T|A Chain A, Human Stromelysin-1 (E202q) Catalytic Domain Complexed With Ro-26-2812 Length = 167 Back     alignment and structure
>pdb|1GKD|A Chain A, Mmp9 Active Site Mutant-Inhibitor Complex Length = 163 Back     alignment and structure
>pdb|1MMP|A Chain A, Matrilysin Complexed With Carboxylate Inhibitor Length = 170 Back     alignment and structure
>pdb|2OVX|A Chain A, Mmp-9 Active Site Mutant With Barbiturate Inhibitor Length = 159 Back     alignment and structure
>pdb|2Y6C|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 165 Back     alignment and structure
>pdb|1JK3|A Chain A, Crystal Structure Of Human Mmp-12 (Macrophage Elastase) At True Atomic Resolution Length = 158 Back     alignment and structure
>pdb|2POJ|A Chain A, Nmr Solution Structure Of The Inhibitor-Free State Of Macrophage Metalloelastase (Mmp-12) Length = 164 Back     alignment and structure
>pdb|2W0D|A Chain A, Does A Fast Nuclear Magnetic Resonance Spectroscopy- And X-Ray Crystallography Hybrid Approach Provide Reliable Structural Information Of Ligand-Protein Complexes? A Case Study Of Metalloproteinases. Length = 164 Back     alignment and structure
>pdb|2JSD|A Chain A, Solution Structure Of Mmp20 Complexed With Nngh Length = 160 Back     alignment and structure
>pdb|4GR8|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 In Complex With Selective Phosphinic Inhibitor Rxp470c Length = 152 Back     alignment and structure
>pdb|2K9C|A Chain A, Paramagnetic Shifts In Solid-State Nmr Of Proteins To Elicit Structural Information Length = 152 Back     alignment and structure
>pdb|1OS2|A Chain A, Ternary Enzyme-Product-Inhibitor Complexes Of Human Mmp12 Length = 165 Back     alignment and structure
>pdb|3F15|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor (S)-N-(2,3-Dihydroxypropyl)-4- Methoxy-N-(2-Nitroso-2-Oxoethyl)benzenesulfonamide Length = 158 Back     alignment and structure
>pdb|1RMZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor Nngh At 1.3 A Resolution Length = 159 Back     alignment and structure
>pdb|2K2G|A Chain A, Solution Structure Of The Wild-Type Catalytic Domain Of Human Matrix Metalloproteinase 12 (Mmp-12) In Complex With A Tight-Binding Inhibitor Length = 165 Back     alignment and structure
>pdb|2Z2D|A Chain A, Solution Structure Of Human Macrophage Elastase (Mmp-12) Catalytic Domain Complexed With A Gamma-Keto Butanoic Acid Inhibitor Length = 164 Back     alignment and structure
>pdb|2CLT|A Chain A, Crystal Structure Of The Active Form (Full-Length) Of Human Fibroblast Collagenase. Length = 367 Back     alignment and structure
>pdb|1JIZ|A Chain A, Crystal Structure Analysis Of Human Macrophage Elastase Mmp- 12 Length = 166 Back     alignment and structure
>pdb|1UTT|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2- (1,3-Dioxo-1,3-Dihydro-2h-Isoindol-2-Yl)ethyl-4- (4-Ethoxy[1,1-Biphenyl]-4-Yl)-4-Oxobutanoic Acid Length = 159 Back     alignment and structure
>pdb|2WO8|A Chain A, Mmp12 Complex With A Beta Hydroxy Carboxylic Acid Length = 164 Back     alignment and structure
>pdb|1UEA|A Chain A, Mmp-3TIMP-1 Complex Length = 173 Back     alignment and structure
>pdb|1ROS|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dioxo-1,3- Dihydro-2h-Isoindol-2-Yl)ethyl-4-(4-Ethoxy[1, 1-Biphenyl]-4- Yl)-4-Oxobutanoic Acid Length = 163 Back     alignment and structure
>pdb|1CGF|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 162 Back     alignment and structure
>pdb|2J0T|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-1 In Complex With The Inhibitory Domain Of Timp-1 Length = 170 Back     alignment and structure
>pdb|966C|A Chain A, Crystal Structure Of Fibroblast Collagenase-1 Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 157 Back     alignment and structure
>pdb|3SHI|A Chain A, Crystal Structure Of Human Mmp1 Catalytic Domain At 2.2 A Resolution Length = 156 Back     alignment and structure
>pdb|3AYK|A Chain A, Catalytic Fragment Of Human Fibroblast Collagenase Complexed With Cgs-27023a, Nmr, Minimized Average Structure Length = 169 Back     alignment and structure
>pdb|1CGE|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 168 Back     alignment and structure
>pdb|1CGL|A Chain A, Structure Of The Catalytic Domain Of Fibroblast Collagenase Complexed With An Inhibitor Length = 169 Back     alignment and structure
>pdb|3BA0|A Chain A, Crystal Structure Of Full-Length Human Mmp-12 Length = 365 Back     alignment and structure
>pdb|1FBL|A Chain A, Structure Of Full-Length Porcine Synovial Collagenase (Mmp1) Reveals A C-Terminal Domain Containing A Calcium-Linked, Four-Bladed Beta- Propeller Length = 370 Back     alignment and structure
>pdb|1CXV|A Chain A, Structure Of Recombinant Mouse Collagenase-3 (Mmp-13) Length = 164 Back     alignment and structure
>pdb|1HV5|A Chain A, Crystal Structure Of The Stromelysin-3 (Mmp-11) Catalytic Domain Complexed With A Phosphinic Inhibitor Length = 165 Back     alignment and structure
>pdb|456C|A Chain A, Crystal Structure Of Collagenase-3 (Mmp-13) Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 168 Back     alignment and structure
>pdb|2D1N|A Chain A, Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Acid Inhibitor Length = 166 Back     alignment and structure
>pdb|3LJZ|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With An Amino-2-Indanol Compound Length = 164 Back     alignment and structure
>pdb|3KRY|A Chain A, Crystal Structure Of Mmp-13 In Complex With Sc-78080 Length = 164 Back     alignment and structure
>pdb|1EUB|A Chain A, Solution Structure Of The Catalytic Domain Of Human Collagenase-3 (Mmp-13) Complexed To A Potent Non-Peptidic Sulfonamide Inhibitor Length = 171 Back     alignment and structure
>pdb|1FLS|A Chain A, Solution Structure Of The Catalytic Fragment Of Human Collagenase-3 (Mmp-13) Complexed With A Hydroxamic Acid Inhibitor Length = 165 Back     alignment and structure
>pdb|4A7B|A Chain A, Mmp13 In Complex With A Novel Selective Non Zinc Binding Inhibitor Cmpd22 Length = 169 Back     alignment and structure
>pdb|3KEC|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With A Phenyl-2h-Tetrazole Compound Length = 167 Back     alignment and structure
>pdb|2OW9|A Chain A, Crystal Structure Analysis Of The Mmp13 Catalytic Domain In Complex With Specific Inhibitor Length = 170 Back     alignment and structure
>pdb|1Q3A|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Matrix Metalloproteinase 10 Length = 165 Back     alignment and structure
>pdb|3V96|B Chain B, Complex Of Matrix Metalloproteinase-10 Catalytic Domain (Mmp-10cd) With Tissue Inhibitor Of Metalloproteinases-1 (Timp-1) Length = 165 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 8e-30
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 3e-28
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 9e-23
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 2e-06
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 2e-22
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet fla 2e-08
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 2e-20
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 3e-20
1eak_A421 72 kDa type IV collagenase; hydrolase-hydrolase in 2e-08
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 1e-19
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 4e-18
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 1e-17
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 2e-17
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 2e-17
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 2e-17
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 5e-17
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 1e-16
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 3e-16
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 4e-16
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 8e-16
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 9e-16
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 8e-15
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Length = 255 Back     alignment and structure
 Score =  109 bits (274), Expect = 8e-30
 Identities = 64/229 (27%), Positives = 89/229 (38%), Gaps = 43/229 (18%)

Query: 1   ELLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNNHF 60
             +   I+  Q    L+ TG LD++T+  MR PRCGV D+                   F
Sbjct: 41  GPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDV--------------GHFRTF 86

Query: 61  HTVSQWPASKFSLTYAFRLG--TRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKIS 118
             + +W  +  +           +    + V +A + W   T   FS++ +   ADI IS
Sbjct: 87  PGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYE-GEADIMIS 145

Query: 119 FESRNHGDGRPFDGRGGPDGTLAHAFAPTN---GRFHYDADEPW---------------A 160
           F  R HGD  PFDG G     LAHA+AP     G  H+D DE W                
Sbjct: 146 FAVREHGDFYPFDGPG---NVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHE 202

Query: 161 VGAVQGAFDSLKDTYIIAPSTAVQNAPCTATVLWRSLQGDDIQGIKALY 209
           +G   G F S     ++ P                 L  DDI GI++LY
Sbjct: 203 IGHSLGLFHSANTEALMYPLYHSLTDLTR-----FRLSQDDINGIQSLY 246
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Length = 450 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Length = 167 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Length = 169 Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Length = 168 Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Length = 165 Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Length = 365 Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Length = 168 Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Length = 163 Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Length = 167 Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} PDB: 1bqq_M 1buv_M Length = 181 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Length = 159 Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Length = 173 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Length = 159 Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 100.0
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 100.0
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 100.0
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 100.0
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 100.0
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 100.0
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 100.0
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 100.0
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 100.0
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 100.0
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 100.0
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 100.0
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 100.0
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 100.0
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 100.0
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 100.0
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 100.0
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 100.0
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 100.0
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 100.0
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 100.0
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 100.0
1sat_A 471 Serratia protease; parallel beta helix, parallel b 99.98
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, m 99.76
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, a 98.3
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, 98.01
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, met 97.09
3p24_A397 BFT-3; metzincins, metalloendopeptidase, hydrolase 96.93
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, 96.67
3bkh_A268 Phikz144, lytic transglycosylase; bacteriophage, e 96.03
4fet_B222 Spore cortex-lytic enzyme prepeptide; transglycosy 95.69
2ikb_A167 Hypothetical protein NMB1012; structural genomics, 89.6
2nr7_A195 Secretion activator protein, putative; APCC85792, 85.27
4gwm_A 592 Meprin A subunit beta; mulidomain structure, hydro 82.96
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Back     alignment and structure
Probab=100.00  E-value=1.1e-59  Score=426.72  Aligned_cols=142  Identities=47%  Similarity=0.768  Sum_probs=128.3

Q ss_pred             hHHHHHHHHHHhcCCCccccCCHHHHHHHhCCCCCcccCCCCcccccCccccccccccccccCCCCCCccceeEEeecCC
Q 039712            2 LLESTIKTCQLNFNLKSTGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKKQQQNNHFHTVSQWPASKFSLTYAFRLGT   81 (211)
Q Consensus         2 ~~~~Ai~~fQ~~~~L~~TG~lD~~T~~~M~~pRCG~pD~~~~~~~~~~~~~~~~~~~~~~~~~kW~~~k~~LTy~i~~~~   81 (211)
                      +|++|||+||+|+||||||+||++|+++|++|||||||+...              ..+..+.||.  |++|||+|.+++
T Consensus        38 ~~~~Ai~~~Q~f~gL~vTG~LD~~T~~~M~~PRCGvpD~~~~--------------~~~~~~~kW~--k~~LTY~i~~~~  101 (421)
T 1eak_A           38 VLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANY--------------NFFPRKPKWD--KNQITYRIIGYT  101 (421)
T ss_dssp             HHHHHHHHHHHHSSCCCCCSCCHHHHHHHTSCBCSSCSSCSS--------------CCSSCCCCCS--SSEEEEEECCCC
T ss_pred             HHHHHHHHHHHHcCCCCCCccCHHHHHHhcCCCCCCCCcccc--------------ccccCCcccc--cceEEEEEecCC
Confidence            689999999999999999999999999999999999997432              2334567997  999999999987


Q ss_pred             cc----hhHHHHHHHHHHHHccCCcceEeccCCCCcceEEEeeeccCCCCCCCCCCCCCCCccccccCCC---CCccccc
Q 039712           82 RG----DAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNHGDGRPFDGRGGPDGTLAHAFAPT---NGRFHYD  154 (211)
Q Consensus        82 ~~----~~~~~i~~Af~~Ws~v~~l~F~ev~~~~~aDI~I~F~~~~hgd~~~fDG~g~~~g~lAhAf~P~---~G~ihfD  154 (211)
                      +.    +++++|++||++|++|+||+|+||.++ .|||+|+|.+++|||++||||+|   |+|||||+|.   .|+||||
T Consensus       102 ~~l~~~~v~~~i~~AF~~Ws~vtpLtF~ev~~~-~ADI~I~F~~g~HgD~~pFDG~g---g~LAHAf~P~~g~~Gd~HFD  177 (421)
T 1eak_A          102 PDLDPETVDDAFARAFQVWSDVTPLRFSRIHDG-EADIMINFGRWEHGDGYPFDGKD---GLLAHAFAPGTGVGGDSHFD  177 (421)
T ss_dssp             TTSCHHHHHHHHHHHHHHHHTSSSCEEEECCSS-CCSEEEEEECSSCSSSCCCCSSS---SBCEEECCSSSTTTTCEEEE
T ss_pred             CCCCHHHHHHHHHHHHHHHhcccCceeEEcCCC-CCCEEEEEecCCCCCccccCCCC---CccccccCCCCCCCCceeee
Confidence            54    455678999999999999999999876 99999999999999999999999   9999999996   7999999


Q ss_pred             CCCCcccCC
Q 039712          155 ADEPWAVGA  163 (211)
Q Consensus       155 ~de~Wt~~~  163 (211)
                      ++|.|++++
T Consensus       178 ~dE~Wt~~~  186 (421)
T 1eak_A          178 DDELWTLGE  186 (421)
T ss_dssp             TTSCEESSS
T ss_pred             eccceeccC
Confidence            999999854
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} SCOP: d.92.1.11 PDB: 1bqq_M 1buv_M Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Back     alignment and structure
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A Back     alignment and structure
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} SCOP: d.92.1.0 PDB: 3edg_A 3edi_A Back     alignment and structure
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, D bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Back     alignment and structure
>3p24_A BFT-3; metzincins, metalloendopeptidase, hydrolase; HET: PG4; 1.80A {Bacteroides fragilis} Back     alignment and structure
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus} SCOP: a.20.1.1 d.65.1.1 Back     alignment and structure
>3bkh_A Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Back     alignment and structure
>4fet_B Spore cortex-lytic enzyme prepeptide; transglycosylase, cortex hydrolase domain, sodium ION, seMet hydrolase; 1.91A {Bacillus anthracis} Back     alignment and structure
>2ikb_A Hypothetical protein NMB1012; structural genomics, PSI-2, MCSG, PR structure initiative; 1.70A {Neisseria meningitidis} SCOP: d.2.1.9 PDB: 2is5_A* Back     alignment and structure
>2nr7_A Secretion activator protein, putative; APCC85792, porphyromonas gingivalis W83 structural genomics, PSI-2, protein structure initiative; 1.30A {Porphyromonas gingivalis} SCOP: d.2.1.9 Back     alignment and structure
>4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 211
d1hv5a_162 d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus 5e-16
d1mmqa_166 d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sap 2e-14
d1rm8a_169 d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16 3e-14
d1i76a_163 d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Hum 7e-14
d2ovxa1159 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human 1e-13
d1hfca_157 d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Hum 4e-13
d1xuca1169 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Huma 1e-12
d1bqqm_174 d.92.1.11 (M:) Membrane-type matrix metalloprotein 1e-12
d1hy7a_168 d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo 1e-12
d1su3a167 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) 2e-12
d1slma165 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (H 5e-12
d1l6ja177 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (H 1e-11
d1eaka176 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (H 2e-11
d1qiba_161 d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) 5e-11
d1y93a1158 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) 7e-11
d1sata2243 d.92.1.6 (A:4-246) Metalloprotease {Serratia marce 4e-10
d1k7ia2241 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrys 4e-09
d1kapp2246 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas ae 2e-08
d1g9ka2242 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp 9e-06
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Length = 162 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Stromelysin-3 (MMP-11)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 70.3 bits (171), Expect = 5e-16
 Identities = 55/166 (33%), Positives = 65/166 (39%), Gaps = 31/166 (18%)

Query: 64  SQWPASKFSLTYAFRLGT----RGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISF 119
            +W   K  LTY          R      VA A Q W+  T   F+++     ADI I F
Sbjct: 7   GRWE--KTDLTYRILRFPWQLVREQVRQTVAEALQVWSEVTPLTFTEV-HEGRADIMIDF 63

Query: 120 ESRNHGDGRPFDGRGGPDGTLAHAFAPTNGRF---HYDADEPWAVGAVQGAFDSLKDTYI 176
               HGD  PFDG G   G LAHAF P   R    H+D DE W +G  QG      D   
Sbjct: 64  ARYWHGDNLPFDGPG---GILAHAFFPKTHREGDVHFDYDETWTIGDNQG-----TDLLQ 115

Query: 177 IA----------PSTAVQNA---PCTATVLWRSLQGDDIQGIKALY 209
           +A            T    A   P        SL  DD +GI+ LY
Sbjct: 116 VAAHEFGHVLGLQHTTAAKALMSPFYTFRYPLSLSPDDRRGIQHLY 161
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Length = 158 Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Length = 243 Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Length = 241 Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Length = 246 Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d1hv5a_162 Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxI 99.96
d1mmqa_166 Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9 99.95
d1xuca1169 Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxI 99.94
d1k7ia2241 Metalloprotease {Erwinia chrysanthemi [TaxId: 556] 99.94
d1i76a_163 Neutrophil collagenase (MMP-8) {Human (Homo sapien 99.94
d1kapp2246 Metalloprotease {Pseudomonas aeruginosa [TaxId: 28 99.93
d1sata2243 Metalloprotease {Serratia marcescens [TaxId: 615]} 99.93
d1hfca_157 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.93
d1hy7a_168 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.92
d1qiba_161 Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1rm8a_169 Matrix metalloproteinase-16 (MMP-16) {Human (Homo 99.89
d2ovxa1159 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.89
d1y93a1158 Macrophage elastase (MMP-12) {Human (Homo sapiens) 99.89
d1bqqm_174 Membrane-type matrix metalloproteinase (CDMT1-MMP) 99.87
d1su3a167 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.82
d1g9ka2242 Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId 99.82
d1slma165 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.81
d1l6ja177 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.77
d1eaka176 Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 99.77
d1lbua183 Zn2+ DD-carboxypeptidase, N-terminal domain {Strep 97.66
d1asta_200 Astacin {European fresh water crayfish (Astacus as 96.02
d2bgxa181 Probable N-acetylmuramoyl-L-alanine amidase YbjR, 86.23
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Stromelysin-3 (MMP-11)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.96  E-value=4.4e-30  Score=203.27  Aligned_cols=141  Identities=37%  Similarity=0.577  Sum_probs=120.6

Q ss_pred             ccCCCCCCccceeEEeecCCcc----hhHHHHHHHHHHHHccCCcceEeccCCCCcceEEEeeeccCCCCCCCCCCCCCC
Q 039712           62 TVSQWPASKFSLTYAFRLGTRG----DAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNHGDGRPFDGRGGPD  137 (211)
Q Consensus        62 ~~~kW~~~k~~LTy~i~~~~~~----~~~~~i~~Af~~Ws~v~~l~F~ev~~~~~aDI~I~F~~~~hgd~~~fDG~g~~~  137 (211)
                      .+.||+  +++|||+|.++++.    +++++|++||+.|++|++|+|+||.+. .+||+|.|....+.++.++++.|   
T Consensus         5 ~G~kW~--~~~iTY~~~~~~~~~~~~~~~~~i~~A~~~W~~v~~i~F~ev~~~-~~di~i~~~~~~~~~~~~~~~~~---   78 (162)
T d1hv5a_           5 SGGRWE--KTDLTYRILRFPWQLVREQVRQTVAEALQVWSEVTPLTFTEVHEG-RADIMIDFARYWHGDNLPFDGPG---   78 (162)
T ss_dssp             ETTEEE--ECEEEEEECSCCTTSCHHHHHHHHHHHHHHHHTTSSCEEEECSSS-BCSEEEEEECSCSSSSCCCCSSS---
T ss_pred             cCCcCC--CCeEEEEEEecCCCCCHHHHHHHHHHHHHHHhccCCceEEEeecC-CCceEEEEeccccCCcccccCCC---
Confidence            467997  99999999876543    445678999999999999999999864 89999999999999999999999   


Q ss_pred             CccccccCCC---CCcccccCCCCcccCCCCCceeeeeEE-------eeccCCCCCCCC---CcccCCCCCCCCHHHHHH
Q 039712          138 GTLAHAFAPT---NGRFHYDADEPWAVGAVQGAFDSLKDT-------YIIAPSTAVQNA---PCTATVLWRSLQGDDIQG  204 (211)
Q Consensus       138 g~lAhAf~P~---~G~ihfD~de~Wt~~~~~~~~~l~~Va-------LGL~HS~~~~~s---p~y~~~~~~~L~~dDi~~  204 (211)
                      +++|+|++|.   .++|.|+.++.|+.+... +.+++.|+       |||.|+ ++++|   |+|.......|+.+||++
T Consensus        79 ~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~-g~~~~~v~~HEiGHaLGL~H~-~~~~svM~p~~~~~~~~~l~~~Di~~  156 (162)
T d1hv5a_          79 GILAHAFFPKTHREGDVHFDYDETWTIGDNQ-GTDLLQVAAHEFGHVLGLQHT-TAAKALMSPFYTFRYPLSLSPDDRRG  156 (162)
T ss_dssp             SCCEEEECCTTSSSEEEEEETTSCEESSCSS-SEEHHHHHHHHHHHHTTCCCC-SCTTSTTCSSCCCCSSCCCCHHHHHH
T ss_pred             ceeeeeecCCCccccceeecchhcccccccc-CcchhhhhhhhhhhhccCCCC-CCCCccccCcccCCCCCCCCHHHHHH
Confidence            9999999995   357999999999886543 67787775       999999 99999   556654445899999999


Q ss_pred             HHHhhC
Q 039712          205 IKALYN  210 (211)
Q Consensus       205 Iq~LYG  210 (211)
                      ||+|||
T Consensus       157 i~~LYG  162 (162)
T d1hv5a_         157 IQHLYG  162 (162)
T ss_dssp             HHHHCC
T ss_pred             HHHhcC
Confidence            999998
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Back     information, alignment and structure
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]} Back     information, alignment and structure
>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} Back     information, alignment and structure
>d2bgxa1 a.20.1.1 (A:180-260) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure