Citrus Sinensis ID: 039717


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MARQAQGRCSASQATTVAATLIVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLKLAVDAS
ccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccEEcccEEEEEEcccccEEEEEccccccccccccccccccccccEEEccccccEEEcccccccccccEEEEEEc
cHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEccHHHcccccccccccccccccccEEEEEccEccEcEEEEcHHHHHcccccccccEEcccEEEEEcccEEEEEEcccccccccccEEEEEEc
marqaqgrcsasqATTVAATLIVLLFLRFhsteatstftvgdtsgwtyniqswangkqfkagdtlifnydasihnvavvdgnnyqscrasptsksfssgkdqiklskgrnyficsipghceaGLKLAVDAS
marqaqgrcsasqatTVAATLIVLLFLRFHSTEatstftvgdtsGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCrasptsksfssgkdqikLSKGRNYFICSIPGHCEAGLKLAVDAS
MARQAQGRCSASQATTVAATLIVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLKLAVDAS
**************TTVAATLIVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQ*********************KGRNYFICSIPGHCEAGLKLA****
***************TVAATLIVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLKLAVDAS
*************ATTVAATLIVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQS***************QIKLSKGRNYFICSIPGHCEAGLKLAVDAS
***********SQATTVAATLIVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLKLAVDAS
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARQAQGRCSASQATTVAATLIVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEAGLKLAVDAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
Q8LG89129 Basic blue protein OS=Ara yes no 0.961 0.976 0.457 7e-29
P60496126 Chemocyanin OS=Lilium lon N/A no 0.717 0.746 0.553 8e-29
P0030396 Basic blue protein OS=Cuc N/A no 0.725 0.989 0.494 2e-27
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.679 0.824 0.436 3e-18
Q41001189 Blue copper protein OS=Pi N/A no 0.709 0.492 0.427 4e-17
P00302107 Stellacyanin OS=Toxicoden N/A no 0.732 0.897 0.365 8e-16
O80517202 Uclacyanin-2 OS=Arabidops no no 0.687 0.445 0.468 2e-14
Q39131172 Lamin-like protein OS=Ara no no 0.885 0.674 0.319 6e-12
Q07488196 Blue copper protein OS=Ar no no 0.694 0.464 0.340 1e-10
Q9SK27182 Early nodulin-like protei no no 0.786 0.565 0.345 8e-10
>sp|Q8LG89|BABL_ARATH Basic blue protein OS=Arabidopsis thaliana GN=ARPN PE=1 SV=2 Back     alignment and function desciption
 Score =  125 bits (314), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 86/129 (66%), Gaps = 3/129 (2%)

Query: 4   QAQGRCSASQATTVAATLIVL--LFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKA 61
            A+GR SAS +     TL+ +  L L+    +A +T+TVGD+  WT+N   W  GK F+A
Sbjct: 1   MAKGRGSASWSARAIVTLMAVSVLLLQADYVQA-ATYTVGDSGIWTFNAVGWPKGKHFRA 59

Query: 62  GDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCE 121
           GD L+FNY+  +HNV  VD  +Y +C+    +K ++SGKD+I LSKG+N+FIC+ P HCE
Sbjct: 60  GDVLVFNYNPRMHNVVKVDSGSYNNCKTPTGAKPYTSGKDRITLSKGQNFFICNFPNHCE 119

Query: 122 AGLKLAVDA 130
           + +K+AV A
Sbjct: 120 SDMKIAVTA 128




Forms a concentration gradient along the pollen tube growth path, with a lower level in the stigma papilla cell wall and a higher level in the transmitting tract extracellular matix of the style.
Arabidopsis thaliana (taxid: 3702)
>sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1 Back     alignment and function description
>sp|P00303|BABL_CUCSA Basic blue protein OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function description
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|O80517|BCB2_ARATH Uclacyanin-2 OS=Arabidopsis thaliana GN=At2g44790 PE=1 SV=1 Back     alignment and function description
>sp|Q39131|LAML_ARATH Lamin-like protein OS=Arabidopsis thaliana GN=At5g15350 PE=1 SV=1 Back     alignment and function description
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
400189940131 early nodulin-like protein [Citrus trifo 1.0 1.0 0.969 1e-68
224069766130 predicted protein [Populus trichocarpa] 0.977 0.984 0.613 3e-39
225465459128 PREDICTED: chemocyanin [Vitis vinifera] 0.946 0.968 0.543 3e-34
319433447127 copper binding protein 6 [Gossypium hirs 0.961 0.992 0.503 3e-32
351723331124 uncharacterized protein LOC100305588 pre 0.938 0.991 0.503 5e-32
255558452126 Basic blue protein, putative [Ricinus co 0.961 1.0 0.507 5e-32
388500008130 unknown [Lotus japonicus] 0.946 0.953 0.507 1e-31
319433451126 copper binding protein 8 [Gossypium hirs 0.954 0.992 0.511 8e-31
356509342127 PREDICTED: LOW QUALITY PROTEIN: basic bl 0.961 0.992 0.503 1e-29
224054286125 predicted protein [Populus trichocarpa] 0.954 1.0 0.492 2e-29
>gi|400189940|gb|AFP73459.1| early nodulin-like protein [Citrus trifoliata] gi|400189942|gb|AFP73460.1| early nodulin-like protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/131 (96%), Positives = 128/131 (97%)

Query: 1   MARQAQGRCSASQATTVAATLIVLLFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFK 60
           MARQAQGRCSASQATTVAATL+VLLFL FHSTEATST TVGDTSGWTYNIQSW NGKQFK
Sbjct: 1   MARQAQGRCSASQATTVAATLLVLLFLGFHSTEATSTITVGDTSGWTYNIQSWTNGKQFK 60

Query: 61  AGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHC 120
           AGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHC
Sbjct: 61  AGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHC 120

Query: 121 EAGLKLAVDAS 131
           EAGLKLAVDAS
Sbjct: 121 EAGLKLAVDAS 131




Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224069766|ref|XP_002303034.1| predicted protein [Populus trichocarpa] gi|222844760|gb|EEE82307.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225465459|ref|XP_002266922.1| PREDICTED: chemocyanin [Vitis vinifera] gi|297744353|emb|CBI37323.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|319433447|gb|ADV57641.1| copper binding protein 6 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|351723331|ref|NP_001237531.1| uncharacterized protein LOC100305588 precursor [Glycine max] gi|255625997|gb|ACU13343.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255558452|ref|XP_002520251.1| Basic blue protein, putative [Ricinus communis] gi|223540470|gb|EEF42037.1| Basic blue protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388500008|gb|AFK38070.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|319433451|gb|ADV57643.1| copper binding protein 8 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|356509342|ref|XP_003523409.1| PREDICTED: LOW QUALITY PROTEIN: basic blue protein-like [Glycine max] Back     alignment and taxonomy information
>gi|224054286|ref|XP_002298184.1| predicted protein [Populus trichocarpa] gi|222845442|gb|EEE82989.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
TAIR|locus:2056700129 ARPN "plantacyanin" [Arabidops 0.954 0.968 0.460 1.9e-28
TAIR|locus:2081952187 AT3G60270 [Arabidopsis thalian 0.862 0.604 0.444 1.7e-20
TAIR|locus:2081957 222 UCC3 "uclacyanin 3" [Arabidops 0.847 0.5 0.452 3.1e-19
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.839 0.588 0.406 2.8e-18
TAIR|locus:2043833206 AT2G26720 [Arabidopsis thalian 0.809 0.514 0.360 1.2e-17
TAIR|locus:2042426202 UCC2 "uclacyanin 2" [Arabidops 0.839 0.544 0.439 2e-17
TAIR|locus:2062525 261 UCC1 "uclacyanin 1" [Arabidops 0.740 0.371 0.405 3.2e-17
TAIR|locus:2030888140 ENODL22 "early nodulin-like pr 0.969 0.907 0.395 6.7e-17
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.824 0.54 0.362 8.6e-17
TAIR|locus:504956334192 AT5G07475 [Arabidopsis thalian 0.709 0.484 0.402 8.6e-17
TAIR|locus:2056700 ARPN "plantacyanin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 317 (116.6 bits), Expect = 1.9e-28, P = 1.9e-28
 Identities = 59/128 (46%), Positives = 86/128 (67%)

Query:     5 AQGRCSASQATTVAATLIVL--LFLRFHSTEATSTFTVGDTSGWTYNIQSWANGKQFKAG 62
             A+GR SAS +     TL+ +  L L+    +A +T+TVGD+  WT+N   W  GK F+AG
Sbjct:     2 AKGRGSASWSARAIVTLMAVSVLLLQADYVQA-ATYTVGDSGIWTFNAVGWPKGKHFRAG 60

Query:    63 DTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICSIPGHCEA 122
             D L+FNY+  +HNV  VD  +Y +C+    +K ++SGKD+I LSKG+N+FIC+ P HCE+
Sbjct:    61 DVLVFNYNPRMHNVVKVDSGSYNNCKTPTGAKPYTSGKDRITLSKGQNFFICNFPNHCES 120

Query:   123 GLKLAVDA 130
              +K+AV A
Sbjct:   121 DMKIAVTA 128




GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009856 "pollination" evidence=IMP
GO:0048196 "plant extracellular matrix" evidence=TAS
GO:0048653 "anther development" evidence=IMP
GO:0048046 "apoplast" evidence=IDA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0009845 "seed germination" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0009933 "meristem structural organization" evidence=RCA
GO:0010162 "seed dormancy process" evidence=RCA
GO:0010182 "sugar mediated signaling pathway" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0019915 "lipid storage" evidence=RCA
GO:0050826 "response to freezing" evidence=RCA
TAIR|locus:2081952 AT3G60270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081957 UCC3 "uclacyanin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043833 AT2G26720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042426 UCC2 "uclacyanin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062525 UCC1 "uclacyanin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030888 ENODL22 "early nodulin-like protein 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956334 AT5G07475 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LG89BABL_ARATHNo assigned EC number0.45730.96180.9767yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 8e-32
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 1e-14
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information
 Score =  107 bits (270), Expect = 8e-32
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 5/84 (5%)

Query: 46  WTYNI----QSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKD 101
           WT  +      WA+GK F+ GDTL+FNYD   HNV  V   +Y+SC  S   +++++G D
Sbjct: 1   WTVPLNADYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKPIRTYTTGND 60

Query: 102 QIKLSK-GRNYFICSIPGHCEAGL 124
            I L+K G++YFIC +PGHC+ G 
Sbjct: 61  IIPLTKPGQHYFICGVPGHCKGGQ 84


This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84

>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.97
PRK02710119 plastocyanin; Provisional 98.57
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.37
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.25
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 97.98
COG3794128 PetE Plastocyanin [Energy production and conversio 97.92
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 97.81
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 97.07
TIGR0265783 amicyanin amicyanin. Members of this family are am 96.99
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 96.5
KOG3858 233 consensus Ephrin, ligand for Eph receptor tyrosine 96.14
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 95.88
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 94.68
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 93.7
COG4454158 Uncharacterized copper-binding protein [Inorganic 92.55
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 90.65
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.7e-42  Score=257.86  Aligned_cols=103  Identities=34%  Similarity=0.657  Sum_probs=96.8

Q ss_pred             HhcccccceEEEecCCCCcc--cccccccCCCeeeeCCEEEEEecCCCceEEEEcCCCCCCCCCCCCCccccCCCcEEEc
Q 039717           28 RFHSTEATSTFTVGDTSGWT--YNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKL  105 (131)
Q Consensus        28 ~~~~~a~a~~~~VG~~~gW~--~~y~~Wa~~~~f~vGD~LvF~y~~~~H~V~~V~~~~y~~C~~~~~~~~~~~G~~~v~L  105 (131)
                      .+...+.|++|+|||+.||+  .+|+.|+++++|++||+|+|+|+++.|||+||++++|++|+.++|+..+++|++.|+|
T Consensus        13 ~~~~~~~a~~~~VGd~~GW~~~~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi~~~tsG~d~v~L   92 (167)
T PLN03148         13 FSASATTATDHIVGANKGWNPGINYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAAGNWTSGKDFIPL   92 (167)
T ss_pred             HhhhhccceEEEeCCCCCcCCCCChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCcceecCCCcEEEe
Confidence            34567789999999999997  5899999999999999999999999999999999999999999999999999999999


Q ss_pred             CC-CceEEEcCCCCCCcCCCEEEEEeC
Q 039717          106 SK-GRNYFICSIPGHCEAGLKLAVDAS  131 (131)
Q Consensus       106 ~~-G~~yFic~~~~HC~~GmKl~I~V~  131 (131)
                      ++ |++||||+ ++||++||||.|+|.
T Consensus        93 ~~~G~~YFIcg-~ghC~~GmKl~I~V~  118 (167)
T PLN03148         93 NKAKRYYFICG-NGQCFNGMKVTILVH  118 (167)
T ss_pred             cCCccEEEEcC-CCccccCCEEEEEEc
Confidence            87 99999999 699999999999984



>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 6e-29
1f56_A91 Spinach Plantacyanin Length = 91 1e-23
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 3e-19
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 1e-10
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 9e-09
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure

Iteration: 1

Score = 122 bits (306), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 48/95 (50%), Positives = 73/95 (76%) Query: 36 STFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKS 95 + + VG + GWT+N +SW GK+F+AGD L+FNY+ S+HNV VV+ + +C +K Sbjct: 1 AVYVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKV 60 Query: 96 FSSGKDQIKLSKGRNYFICSIPGHCEAGLKLAVDA 130 ++SG+DQIKL KG++YFIC+ PGHC++G+K+AV+A Sbjct: 61 YTSGRDQIKLPKGQSYFICNFPGHCQSGMKIAVNA 95
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
2cbp_A96 Cucumber basic protein; electron transport, phytoc 7e-38
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 2e-36
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 2e-33
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 4e-33
1jer_A138 Cucumber stellacyanin; electron transport, copper, 5e-28
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
 Score =  122 bits (308), Expect = 7e-38
 Identities = 48/95 (50%), Positives = 73/95 (76%)

Query: 36  STFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKS 95
           + + VG + GWT+N +SW  GK+F+AGD L+FNY+ S+HNV VV+   + +C     +K 
Sbjct: 1   AVYVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKV 60

Query: 96  FSSGKDQIKLSKGRNYFICSIPGHCEAGLKLAVDA 130
           ++SG+DQIKL KG++YFIC+ PGHC++G+K+AV+A
Sbjct: 61  YTSGRDQIKLPKGQSYFICNFPGHCQSGMKIAVNA 95


>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 100.0
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.25
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.14
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.1
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.9
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.83
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.81
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.79
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.78
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.78
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.75
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.74
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.7
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.7
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.68
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.68
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.67
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.46
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.08
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 97.9
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 97.88
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 97.84
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.83
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.81
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 97.71
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.62
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.53
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.52
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.43
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.36
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 96.86
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 96.45
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 96.04
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 95.79
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 95.5
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 95.31
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 94.85
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 94.28
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 93.49
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 91.21
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 90.0
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 89.83
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 87.92
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 84.36
3l6w_A491 Hemocyanin 1; cupredoxin domain, copper-binding pr 84.11
1yel_A104 AT1G16640; CESG, protein structure initiative, str 82.33
4i1k_A146 B3 domain-containing transcription factor VRN1; B3 80.65
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=4.9e-42  Score=237.13  Aligned_cols=96  Identities=50%  Similarity=1.108  Sum_probs=92.2

Q ss_pred             eEEEecCCCCcccccccccCCCeeeeCCEEEEEecCCCceEEEEcCCCCCCCCCCCCCccccCCCcEEEcCCCceEEEcC
Q 039717           36 STFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICS  115 (131)
Q Consensus        36 ~~~~VG~~~gW~~~y~~Wa~~~~f~vGD~LvF~y~~~~H~V~~V~~~~y~~C~~~~~~~~~~~G~~~v~L~~G~~yFic~  115 (131)
                      ++|+|||+.||+++|+.|+++++|++||+|+|+|.+++|+|+||++++|+.|+.++|+..+++|+++|+|++|++||||+
T Consensus         1 ~~~~VG~~~GW~~~y~~Wa~~~~f~vGD~L~F~y~~~~hsV~~v~~~~y~~C~~~~~~~~~~~G~~~v~L~~g~~yFic~   80 (96)
T 2cbp_A            1 AVYVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKVYTSGRDQIKLPKGQSYFICN   80 (96)
T ss_dssp             CEEETTGGGCSCSSCTTTTTTCCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCCTTCEEECSSEEEEECCSEEEEEECC
T ss_pred             CEEEECCcCCCccChhhhccCceEcCCCEEEEEecCCCCEEEEECHHHCCccCCCCCcccccCCCeEEEecCCCEEEEcC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999994499999999


Q ss_pred             CCCCCcCCCEEEEEeC
Q 039717          116 IPGHCEAGLKLAVDAS  131 (131)
Q Consensus       116 ~~~HC~~GmKl~I~V~  131 (131)
                      +++||++||||+|+|+
T Consensus        81 ~~~HC~~Gmkl~I~Vl   96 (96)
T 2cbp_A           81 FPGHCQSGMKIAVNAL   96 (96)
T ss_dssp             STTTGGGTCEEEEEEC
T ss_pred             CCCccccCCEEEEEEC
Confidence            9999999999999996



>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3l6w_A Hemocyanin 1; cupredoxin domain, copper-binding protein, metal-binding, oxygen binding; 4.00A {Megathura crenulata} PDB: 3qjo_A Back     alignment and structure
>1yel_A AT1G16640; CESG, protein structure initiative, structural genomics, center for eukaryotic structural genomics, unknown function; NMR {Arabidopsis thaliana} SCOP: b.142.1.2 Back     alignment and structure
>4i1k_A B3 domain-containing transcription factor VRN1; B3 domain beta-barrel, DNA binding protein; 1.60A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 2e-40
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 8e-34
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 1e-33
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 3e-27
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]
 Score =  128 bits (322), Expect = 2e-40
 Identities = 48/94 (51%), Positives = 72/94 (76%)

Query: 37  TFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSF 96
            + VG + GWT+N +SW  GK+F+AGD L+FNY+ S+HNV VV+   + +C     +K +
Sbjct: 2   VYVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKVY 61

Query: 97  SSGKDQIKLSKGRNYFICSIPGHCEAGLKLAVDA 130
           +SG+DQIKL KG++YFIC+ PGHC++G+K+AV+A
Sbjct: 62  TSGRDQIKLPKGQSYFICNFPGHCQSGMKIAVNA 95


>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 100.0
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 98.99
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 98.88
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.8
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.78
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.75
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.73
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.68
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.65
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.63
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.58
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.45
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.44
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.43
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.36
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.3
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.94
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 97.7
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.56
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.24
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 96.35
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 96.02
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 95.91
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 95.69
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 95.57
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 94.8
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 94.37
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 93.77
d1yela1102 At1g16640 {Thale cress (Arabidopsis thaliana) [Tax 89.53
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 89.25
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 86.29
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 84.56
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]
Probab=100.00  E-value=1.2e-43  Score=243.83  Aligned_cols=96  Identities=50%  Similarity=1.108  Sum_probs=93.2

Q ss_pred             eEEEecCCCCcccccccccCCCeeeeCCEEEEEecCCCceEEEEcCCCCCCCCCCCCCccccCCCcEEEcCCCceEEEcC
Q 039717           36 STFTVGDTSGWTYNIQSWANGKQFKAGDTLIFNYDASIHNVAVVDGNNYQSCRASPTSKSFSSGKDQIKLSKGRNYFICS  115 (131)
Q Consensus        36 ~~~~VG~~~gW~~~y~~Wa~~~~f~vGD~LvF~y~~~~H~V~~V~~~~y~~C~~~~~~~~~~~G~~~v~L~~G~~yFic~  115 (131)
                      +.|+|||+.||+++|+.|+++++|++||+|+|+|+++.|+|+||++++|++|+.++|+..+++|++.|+|++|++||||+
T Consensus         1 A~y~VGg~~GW~~~y~~Wa~~~~F~vGD~LvF~y~~~~h~V~~V~~~~Y~~C~~~~~~~~~~~G~~~v~L~~G~~YFic~   80 (96)
T d2cbpa_           1 AVYVVGGSGGWTFNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKVYTSGRDQIKLPKGQSYFICN   80 (96)
T ss_dssp             CEEETTGGGCSCSSCTTTTTTCCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCCTTCEEECSSEEEEECCSEEEEEECC
T ss_pred             CEEEcCCCCCCCcCHHHHhCCCcEecCCEEEEecCCCCceEEEEChHHcCccCCCCCcccccCCCeEEEeCCCCCEEEeC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999998899999999


Q ss_pred             CCCCCcCCCEEEEEeC
Q 039717          116 IPGHCEAGLKLAVDAS  131 (131)
Q Consensus       116 ~~~HC~~GmKl~I~V~  131 (131)
                      +++||++||||+|+|+
T Consensus        81 ~~~hC~~G~Kl~V~Vl   96 (96)
T d2cbpa_          81 FPGHCQSGMKIAVNAL   96 (96)
T ss_dssp             STTTGGGTCEEEEEEC
T ss_pred             CCCcCcCCCEEEEEEC
Confidence            9999999999999985



>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1yela1 b.142.1.2 (A:1-102) At1g16640 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure