Citrus Sinensis ID: 039739


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MGSFPSLNTLYLSSNNFTDIATATQELHNFTNLEYLTLDSSSLHISLLQSIASIFPSLKNLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCLDNTTLHESYNNSSSLDKQFEISFSIEGPQGD
ccccccccEEEcccccccccccccccccccccccEEEccccccccccHHHHHHccccccEEEccccccccccccccccccccccEEEcccccccccccccHHHHcccccccEEccccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEccccccEEEcccccccccccccEEEccccccEEEcccccccccccccEEEccccEEEEEcccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEEcccEEEEEccccccccccccEEEcccccccccccccHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEccccEEEEcccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccEEEEEcccccccccccccEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHHHHHHHHHHccccccccccccccccccccc
cccccccEEEEcccccccccccccHHHccccccEEEEcccccccccccHHHHHHHHHccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccHccHHHHHHHHHHccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHcccccccEEEEccccccccccHHHHcccccccEEEEccccccccccHHHcccccccccEEEEEccccccccccHHHHcccccccEEEcccccccccccHHHHHccHcccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccEEEEcccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccHHHHHHcccccccccccccccccccccc
mgsfpslntlylssnnfTDIATATQELhnftnleyltldSSSLHISLLQSIASIFpslknlsmigcevnglvrgqgfphfkslehLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSilgtnssrildrGLCSLVHLQVLNIAYNdlrgslpwclanmtslrildvssnqltgsisssplvhlTSIEElylsnnhfqipislepffnhsrlksfyadnneinaeitqshsltapnfqlsrlslssgygdgfifpkflyhqhdleyvdlshikmngefptwllenntkLRQLSLvndslggpfqlpihshkrlgmldisnnnfrghipveigdvlpsLFSLNISmnaldgsipssfgnmkFLQILDlsnnhltgeipehlVVGCVNLESLalsnnsleghmfsrnfnltnLRWLQLEgnhfvgeipqslskCFVLEglflnnnslsgkiprwlgNLTRLQhimmpknhlegpipvefcqldwlqildisdnnisgslpscfhplsvEQVHLSKNmlhgqlkrgtffnsySLVTLDLsynrlngnisdWVDGLSQLSHLILghnnlegevpVQLCklnqlqlldlsnnslhgsiplcldnttlhesynnsssldkqfeisfsiegpqgd
MGSFPSLNTLYLSSNNFTDIATATQELHNFTNLEYLTLDSSSLHISLLQSIASIFPSLKNLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCLDNTTLHESYNnsssldkqfeisfsiegpqgd
MGSFPSLNTLYLSSNNFTDIATATQELHNFTNLEYltldssslhisllqsiasiFPSLKNLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVnleslalsnnsleGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVqlcklnqlqlldlsnnslHGSIPLCLDNTTLHESYNNSSSLDKQFEISFSIEGPQGD
*******NTLYLSSNNFTDIATATQELHNFTNLEYLTLDSSSLHISLLQSIASIFPSLKNLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCLDNTTLH*************************
MGSFPSLNTLYLSSNNFTDIATATQELHNFTNLEYLTLDSSSLHISLLQSIASIFPSLKNLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCLDNTTLHESYNNSSSLDKQFEISF*IE*P***
MGSFPSLNTLYLSSNNFTDIATATQELHNFTNLEYLTLDSSSLHISLLQSIASIFPSLKNLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCLDNTTLHESYNNSSSLDKQFEISFSIEGPQGD
*GSFPSLNTLYLSSNNFTDIATATQELHNFTNLEYLTLDSSSLHISLLQSIASIFPSLKNLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCLDNTTLHESYNNSSSLDKQFEISF********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSFPSLNTLYLSSNNFTDIATATQELHNFTNLEYLTLDSSSLHISLLQSIASIFPSLKNLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCLDNTTLHESYNNSSSLDKQFEISFSIEGPQGD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query628 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.727 0.365 0.344 4e-50
Q9FZ59 1088 Leucine-rich repeat recep no no 0.705 0.407 0.333 4e-46
Q9FL28 1173 LRR receptor-like serine/ no no 0.738 0.395 0.330 6e-46
Q9M0G7 1013 Leucine-rich repeat recep no no 0.662 0.410 0.334 2e-43
C0LGS2 1136 Probable LRR receptor-lik no no 0.831 0.459 0.303 7e-43
Q9ZPS9 1143 Serine/threonine-protein no no 0.724 0.398 0.306 3e-42
Q9LYN8 1192 Leucine-rich repeat recep no no 0.722 0.380 0.309 3e-42
Q9LHP4 1141 Receptor-like protein kin no no 0.729 0.401 0.313 2e-41
P93194 1109 Receptor-like protein kin N/A no 0.751 0.425 0.300 3e-41
O22476 1196 Protein BRASSINOSTEROID I no no 0.880 0.462 0.286 8e-41
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  200 bits (508), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 177/514 (34%), Positives = 251/514 (48%), Gaps = 57/514 (11%)

Query: 132 LCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELY 191
           L SLV+++ L I  N+L G +P  L N+ +L++L ++S +LTG I S  L  L  ++ L 
Sbjct: 139 LGSLVNIRSLRIGDNELVGDIPETLGNLVNLQMLALASCRLTGPIPSQ-LGRLVRVQSLI 197

Query: 192 LSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDG 251
           L +N+ + PI  E   N S L  F A  N +N  I         N ++  L+ +S  G+ 
Sbjct: 198 LQDNYLEGPIPAE-LGNCSDLTVFTAAENMLNGTIPAELG-RLENLEILNLANNSLTGE- 254

Query: 252 FIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHK 311
              P  L     L+Y+ L   ++ G  P  L +    L+ L L  ++L G       +  
Sbjct: 255 --IPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGN-LQTLDLSANNLTGEIPEEFWNMS 311

Query: 312 RLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNH 371
           +L  L ++NN+  G +P  I     +L  L +S   L G IP      + L+ LDLSNN 
Sbjct: 312 QLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNS 371

Query: 372 LTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSK 431
           L G IPE L    V L  L L NN+LEG +     NLTNL+WL L  N+  G++P+ +S 
Sbjct: 372 LAGSIPEALFE-LVELTDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISA 430

Query: 432 CFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLD---------- 481
              LE LFL  N  SG+IP+ +GN T L+ I M  NH EG IP    +L           
Sbjct: 431 LRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQN 490

Query: 482 --------------WLQILDISDNNISGSLPSCFHPLS-VEQVHLSKNMLHGQLKRGTFF 526
                          L ILD++DN +SGS+PS F  L  +EQ+ L  N L G L   +  
Sbjct: 491 ELVGGLPASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPD-SLI 549

Query: 527 NSYSLVTLDLSYNRLNGNISDWVDGLSQLS-----------------------HLILGHN 563
           +  +L  ++LS+NRLNG I       S LS                        L LG N
Sbjct: 550 SLRNLTRINLSHNRLNGTIHPLCGSSSYLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKN 609

Query: 564 NLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCL 597
            L G++P  L K+ +L LLD+S+N+L G+IPL L
Sbjct: 610 QLTGKIPWTLGKIRELSLLDMSSNALTGTIPLQL 643




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query628
255581263 912 serine-threonine protein kinase, plant-t 0.820 0.564 0.539 1e-142
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.944 0.405 0.436 1e-114
224142481 781 predicted protein [Populus trichocarpa] 0.816 0.656 0.473 1e-107
224123984 1016 predicted protein [Populus trichocarpa] 0.896 0.554 0.446 1e-106
224134891 953 predicted protein [Populus trichocarpa] 0.864 0.569 0.447 1e-105
224102049577 predicted protein [Populus trichocarpa] 0.75 0.816 0.483 1e-105
224124000 920 predicted protein [Populus trichocarpa] 0.939 0.641 0.426 1e-103
224073436 1014 predicted protein [Populus trichocarpa] 0.939 0.581 0.423 1e-102
224098008 1097 predicted protein [Populus trichocarpa] 0.890 0.509 0.431 2e-99
224124490 981 predicted protein [Populus trichocarpa] 0.944 0.604 0.414 5e-99
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  513 bits (1322), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 284/526 (53%), Positives = 367/526 (69%), Gaps = 11/526 (2%)

Query: 72  VRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSILGTNSSRILDRG 131
           ++ Q  P+F++LE L ++   I L  SFLQ +G  M SLK LSL G  L      +  +G
Sbjct: 168 IQAQDLPNFENLEELYLDK--IELENSFLQTVG-VMTSLKVLSLSGCGLTGALPNV--QG 222

Query: 132 LCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELY 191
           LC L+HL+VL+++ N+  G LPWCL+N+TSL++LD+SSNQ  G IS+SPL  L S+ +L 
Sbjct: 223 LCELIHLRVLDVSSNEFHGILPWCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLD 282

Query: 192 LSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDG 251
           +SNNHFQ+P SL PFFNHS LK     NN I  E  + HS  AP FQL  + + SGYG  
Sbjct: 283 VSNNHFQVPFSLGPFFNHSNLKHIRGQNNAIYLE-AELHS--APRFQLISI-IFSGYGIC 338

Query: 252 FIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHK 311
             FP FLYHQ++L++VDLSH+ + GEFP WLL NNT+L  L LVN+SL G  QLP+H H 
Sbjct: 339 GTFPNFLYHQNNLQFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHV 398

Query: 312 RLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNH 371
            L  LDISNN+   HIP+EIG  LP L  LN+S N  DGSIPSSFGNM  L+ILDLSNN 
Sbjct: 399 NLLALDISNNHVHDHIPLEIGTFLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQ 458

Query: 372 LTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSK 431
           L+G IPEHL  GC +L +L LSNNSL+G MFS+ FNLTNL WL+L+ NHF G IP+SLSK
Sbjct: 459 LSGSIPEHLATGCFSLNTLILSNNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSK 518

Query: 432 CFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDN 491
              L  + L++N LSG IP W+GNL+ LQ++++  N L+GPIPVEFCQL +L++LD+++N
Sbjct: 519 S-ALSIMDLSDNHLSGMIPGWIGNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANN 577

Query: 492 NISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDG 551
           ++SG LPSC  P S+  VHLS+NM+ G      F  S+ LVTLDLS NR+ G I   + G
Sbjct: 578 SVSGILPSCLSPSSIIHVHLSQNMIEGPWTNA-FSGSHFLVTLDLSSNRITGRIPTLIGG 636

Query: 552 LSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCL 597
           ++ L  L L  N  +GE+P Q+C L QL L+ L++N+L GSIP CL
Sbjct: 637 INALRILNLKSNRFDGEIPAQICGLYQLSLIVLADNNLSGSIPSCL 682




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102049|ref|XP_002334215.1| predicted protein [Populus trichocarpa] gi|222870030|gb|EEF07161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124000|ref|XP_002330262.1| predicted protein [Populus trichocarpa] gi|222871718|gb|EEF08849.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098008|ref|XP_002334579.1| predicted protein [Populus trichocarpa] gi|222873205|gb|EEF10336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124490|ref|XP_002330036.1| predicted protein [Populus trichocarpa] gi|222871461|gb|EEF08592.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query628
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.808 0.469 0.362 3.2e-72
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.767 0.499 0.359 1.4e-69
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.843 0.53 0.336 1.7e-68
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.847 0.597 0.325 2.6e-63
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.791 0.547 0.340 1.8e-62
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.880 0.566 0.333 4.7e-61
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.920 0.618 0.303 3.7e-53
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.778 0.391 0.317 3.7e-47
TAIR|locus:2137296 811 RLP46 "receptor like protein 4 0.670 0.519 0.299 2.5e-45
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.740 0.409 0.315 2.6e-45
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 734 (263.4 bits), Expect = 3.2e-72, P = 3.2e-72
 Identities = 189/521 (36%), Positives = 278/521 (53%)

Query:   103 IGESMP-SLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTS 161
             +G  +P SL+ L    + L       L  G+C L+ L+ L+++ N L  SLP+CL N+T 
Sbjct:   326 LGLEIPTSLQVLDFKRNQLSLTHEGYL--GICRLMKLRELDLSSNALT-SLPYCLGNLTH 382

Query:   162 LRILDVSSNQLTGSISSSPLVHLTSI-EELYLSNNHFQIPISLEPFFNHSRLKSFYADNN 220
             LR LD+S+NQL G++SS  +  L S+ E L L +N+F          N +RL  F   ++
Sbjct:   383 LRTLDLSNNQLNGNLSSF-VSGLPSVLEYLSLLDNNFDGSFLFNSLVNQTRLTVFKL-SS 440

Query:   221 EINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPT 280
             ++     Q+ S  AP FQL  L LS+    G     FL HQ DL +VDLSH K+ G FPT
Sbjct:   441 KVGVIQVQTESSWAPLFQLKMLYLSN-CSLGSTMLGFLVHQRDLCFVDLSHNKLTGTFPT 499

Query:   281 WLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFS 340
             WL++NNT+L+ + L  +SL    QLPI  H  L +LDIS+N     I  +IG V P+L  
Sbjct:   500 WLVKNNTRLQTILLSGNSLT-KLQLPILVHG-LQVLDISSNMIYDSIQEDIGMVFPNLRF 557

Query:   341 LNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVXXXXXXXXXXXXXGH 400
             +N S N   G+IPSS G MK LQ+LD+S+N L G++P   + GC              G 
Sbjct:   558 MNFSSNHFQGTIPSSIGEMKSLQVLDMSSNGLYGQLPIMFLSGCYSLRVLKLSNNQLQGK 617

Query:   401 MFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQ 460
             +FS++ NLT L  L L+GN+F G + + L K   L  L +++N  SG +P W+G ++RL 
Sbjct:   618 IFSKHANLTGLVGLFLDGNNFTGSLEEGLLKSKNLTLLDISDNRFSGMLPLWIGRISRLS 677

Query:   461 HIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQL 520
             ++ M  N L+GP P    Q  W++++DIS N+ SGS+P   +  S+ ++ L  N   G L
Sbjct:   678 YLYMSGNQLKGPFPF-LRQSPWVEVMDISHNSFSGSIPRNVNFPSLRELRLQNNEFTG-L 735

Query:   521 KRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVXXXXXXXXX 580
               G  F +  L  LDL  N  +G I + +D  S+L  L+L +N+ +  +P          
Sbjct:   736 VPGNLFKAAGLEVLDLRNNNFSGKILNTIDQTSKLRILLLRNNSFQTYIPGKICQLSEVG 795

Query:   581 XXXXXXXXXHGSIPLCLDNTTLHESYNNSS-SLDKQFEISF 620
                       G IP C    +     N+ + SL   F+ S+
Sbjct:   796 LLDLSHNQFRGPIPSCFSKMSFGAEQNDRTMSLVADFDFSY 836


GO:0005575 "cellular_component" evidence=ND
GO:0007165 "signal transduction" evidence=IC
GO:0006457 "protein folding" evidence=RCA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query628
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-51
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-48
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-34
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  191 bits (487), Expect = 1e-51
 Identities = 170/496 (34%), Positives = 263/496 (53%), Gaps = 24/496 (4%)

Query: 103 IGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSL 162
           I  +  SL+YL+L  +    N +  + RG  S+ +L+ L+++ N L G +P  + + +SL
Sbjct: 113 IFTTSSSLRYLNLSNN----NFTGSIPRG--SIPNLETLDLSNNMLSGEIPNDIGSFSSL 166

Query: 163 RILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHF--QIPISLEPFFNHSRLKSFYADNN 220
           ++LD+  N L G I +S L +LTS+E L L++N    QIP  L    +   LK  Y   N
Sbjct: 167 KVLDLGGNVLVGKIPNS-LTNLTSLEFLTLASNQLVGQIPRELGQMKS---LKWIYLGYN 222

Query: 221 EINAEI-TQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFP 279
            ++ EI  +   LT+    L+ L L      G I P  L +  +L+Y+ L   K++G  P
Sbjct: 223 NLSGEIPYEIGGLTS----LNHLDLVYNNLTGPI-PSSLGNLKNLQYLFLYQNKLSGPIP 277

Query: 280 TWLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLF 339
             +  +  KL  L L ++SL G     +   + L +L + +NNF G IPV +   LP L 
Sbjct: 278 PSIF-SLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTS-LPRLQ 335

Query: 340 SLNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEG 399
            L +  N   G IP + G    L +LDLS N+LTGEIPE L     NL  L L +NSLEG
Sbjct: 336 VLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLC-SSGNLFKLILFSNSLEG 394

Query: 400 HMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRL 459
            +        +LR ++L+ N F GE+P   +K  ++  L ++NN+L G+I     ++  L
Sbjct: 395 EIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSL 454

Query: 460 QHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLS-VEQVHLSKNMLHG 518
           Q + + +N   G +P +      L+ LD+S N  SG++P     LS + Q+ LS+N L G
Sbjct: 455 QMLSLARNKFFGGLP-DSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSG 513

Query: 519 QLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQ 578
           ++      +   LV+LDLS+N+L+G I      +  LS L L  N L GE+P  L  +  
Sbjct: 514 EIPD-ELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVES 572

Query: 579 LQLLDLSNNSLHGSIP 594
           L  +++S+N LHGS+P
Sbjct: 573 LVQVNISHNHLHGSLP 588


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 628
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
KOG4237498 consensus Extracellular matrix protein slit, conta 99.77
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.3
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.21
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
KOG4341483 consensus F-box protein containing LRR [General fu 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
KOG4341483 consensus F-box protein containing LRR [General fu 98.96
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.93
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
PLN03150623 hypothetical protein; Provisional 98.79
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.77
PLN03150623 hypothetical protein; Provisional 98.73
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.72
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.71
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.66
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.62
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.58
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.57
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.51
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.37
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.36
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.36
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.34
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.33
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.12
PRK15386 426 type III secretion protein GogB; Provisional 97.94
PRK15386 426 type III secretion protein GogB; Provisional 97.88
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.71
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.68
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.64
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.63
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.53
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.49
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.39
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.84
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.77
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.23
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.97
KOG4308478 consensus LRR-containing protein [Function unknown 95.77
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.33
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.02
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.34
KOG4308478 consensus LRR-containing protein [Function unknown 91.76
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.67
smart0037026 LRR Leucine-rich repeats, outliers. 91.67
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.33
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.56
smart0037026 LRR Leucine-rich repeats, outliers. 85.56
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 84.91
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 84.9
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 80.91
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=9.3e-53  Score=477.59  Aligned_cols=522  Identities=31%  Similarity=0.462  Sum_probs=389.9

Q ss_pred             CCCcEEecCCCCCCCcchhHhhccCCCCceEecccccccccccCCCccccCccceeecccchhhcCcchhhhhhccCCCc
Q 039739           31 TNLEYLTLDSSSLHISLLQSIASIFPSLKNLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSL  110 (628)
Q Consensus        31 ~~L~~L~l~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L  110 (628)
                      .+++.|+++++.+++..+..+.. +++|+.|++++|.+.+.+|...+.++++|++|++++|  .+.+..+.  +. +++|
T Consensus        69 ~~v~~L~L~~~~i~~~~~~~~~~-l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n--~l~~~~p~--~~-l~~L  142 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISSAIFR-LPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNN--NFTGSIPR--GS-IPNL  142 (968)
T ss_pred             CcEEEEEecCCCccccCChHHhC-CCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCC--ccccccCc--cc-cCCC
Confidence            35667777776666666666666 6777777777776665555544556777777777766  44443332  22 6677


Q ss_pred             cEEeeccccCC-CCCCccccccccCCCCCcEEEccCCcccccCchhhhcCCCCCEEEccccccccccCCCCCCCCCcccE
Q 039739          111 KYLSLFGSILG-TNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEE  189 (628)
Q Consensus       111 ~~L~l~~~~~~-~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~l~~~~l~~l~~L~~  189 (628)
                      ++|++++|.+. .    ++ ..+..+++|++|++++|.+.+.+|..+..+++|++|++++|.+.+.+|. .+.++++|+.
T Consensus       143 ~~L~Ls~n~~~~~----~p-~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~  216 (968)
T PLN00113        143 ETLDLSNNMLSGE----IP-NDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPR-ELGQMKSLKW  216 (968)
T ss_pred             CEEECcCCccccc----CC-hHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCCh-HHcCcCCccE
Confidence            77777776663 2    33 4566777777777777776666677777777777777777776655555 5667777777


Q ss_pred             EEcccCeeeeecCCCCcCCCCcccEEeccCCcccccccccccCccCcccceeeeccCCCCCCcccccccccCCCccEEEc
Q 039739          190 LYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDL  269 (628)
Q Consensus       190 L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l  269 (628)
                      |++++|.+.+..+ ..+..+++|++|++++|.+.+                            ..|..+..+++|+.|++
T Consensus       217 L~L~~n~l~~~~p-~~l~~l~~L~~L~L~~n~l~~----------------------------~~p~~l~~l~~L~~L~L  267 (968)
T PLN00113        217 IYLGYNNLSGEIP-YEIGGLTSLNHLDLVYNNLTG----------------------------PIPSSLGNLKNLQYLFL  267 (968)
T ss_pred             EECcCCccCCcCC-hhHhcCCCCCEEECcCceecc----------------------------ccChhHhCCCCCCEEEC
Confidence            7777776654333 345666666666666554432                            23445666677777777


Q ss_pred             cCCcccCcCchhHHhcCccCcEEEeecCCCCCCCCcccccCCccCEEEccCCcCCcccchhhhhhCCCccEEEcccccCC
Q 039739          270 SHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALD  349 (628)
Q Consensus       270 ~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~L~~~~~~  349 (628)
                      ++|.+.+..|..+ ..+++|++|++++|.+.+..+..+..+++|+.|++++|.+.+..|..+.. +++|+.|++++|.+.
T Consensus       268 ~~n~l~~~~p~~l-~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~-l~~L~~L~L~~n~l~  345 (968)
T PLN00113        268 YQNKLSGPIPPSI-FSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTS-LPRLQVLQLWSNKFS  345 (968)
T ss_pred             cCCeeeccCchhH-hhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhc-CCCCCEEECcCCCCc
Confidence            7777766666665 56777777777777777666666777788888888888777777766655 778888888888887


Q ss_pred             CcccccccCCCCccEEECcCCcccCccchhhhcCCccccEEEccCCccCCcccccccCCCCCcEEEccCccCcCcccccc
Q 039739          350 GSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSL  429 (628)
Q Consensus       350 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~  429 (628)
                      +..|..+..+++|+.|++++|++.+.++..+. .+++|+.|++++|.+.+..+..+..+++|+.|++++|.+++..|..+
T Consensus       346 ~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~-~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~  424 (968)
T PLN00113        346 GEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLC-SSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF  424 (968)
T ss_pred             CcCChHHhCCCCCcEEECCCCeeEeeCChhHh-CcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhH
Confidence            77777788888888888888887766665443 36788888888888877777777788888888888888887788888


Q ss_pred             cCCCcccEEEccCCcCCCccCccccCCCCcceEECCCCcCCCCCcccccCCCCCCEEEccCCcCcCCCCCCCC-CCcccE
Q 039739          430 SKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFH-PLSVEQ  508 (628)
Q Consensus       430 ~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~-~~~L~~  508 (628)
                      ..++.|+.|++++|.+.+..+..+..+++|+.|++++|.+.+..|..+ ..++|+.|++++|++.+..|..+. +++|+.
T Consensus       425 ~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~  503 (968)
T PLN00113        425 TKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQ  503 (968)
T ss_pred             hcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCE
Confidence            888888888888888887777777788888888888888876666554 457888888888888877776554 778888


Q ss_pred             EecCCCcCcCCCCccccccCCCccEEECCCcccCCccchhhcCCCCCcEEECCCCcCCccCCccccCCCCCcEEECCCCc
Q 039739          509 VHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNS  588 (628)
Q Consensus       509 L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~i~~~~~~~l~~l~~L~~L~l~~~~  588 (628)
                      |++++|.+.+.+|.. +.++++|+.|++++|.+++.+|..++.+++|+.|++++|++++.+|..+..+++|+.+++++|+
T Consensus       504 L~Ls~N~l~~~~p~~-~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~  582 (968)
T PLN00113        504 LKLSENKLSGEIPDE-LSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNH  582 (968)
T ss_pred             EECcCCcceeeCChH-HcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCc
Confidence            899999888777776 8889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccc
Q 039739          589 LHGSIPLCLD  598 (628)
Q Consensus       589 ~~~~ip~~~~  598 (628)
                      +.+.+|+.-.
T Consensus       583 l~~~~p~~~~  592 (968)
T PLN00113        583 LHGSLPSTGA  592 (968)
T ss_pred             ceeeCCCcch
Confidence            9999997644



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query628
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-34
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-21
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-34
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-21
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-11
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-07
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 142 bits (357), Expect = 7e-34, Method: Compositional matrix adjust. Identities = 152/564 (26%), Positives = 240/564 (42%), Gaps = 111/564 (19%) Query: 79 HFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHL 138 SLE LD+ I+ ++ + LK+L++ G+ + S +D C V+L Sbjct: 149 KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKI----SGDVDVSRC--VNL 202 Query: 139 QVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHFQ 198 + L+++ N+ +P+ L + ++L+ LD+S N+L+G S + + T ++ L +S+N F Sbjct: 203 EFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFV 260 Query: 199 IPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQLSRLSLSSGYGDGFIFPKF- 257 PI P L+ N+ EI L+ L+ L LS + G + P F Sbjct: 261 GPIPPLPL---KSLQYLSLAENKFTGEIPDF--LSGACDTLTGLDLSGNHFYGAVPPFFG 315 Query: 258 -----------------------LYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSL 294 L L+ +DLS + +GE P L + L L L Sbjct: 316 SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL 375 Query: 295 VNDSLGGPF--QLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSI 352 +++ GP L + L L + NN F G IP + + L SL++S N L G+I Sbjct: 376 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC-SELVSLHLSFNYLSGTI 434 Query: 353 PSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVXXXXXXXXXXXXXGHMFSRNFNLTNLR 412 PSS G++ L+ L L N L GEIP+ L+ + L Sbjct: 435 PSSLGSLSKLRDLKLWLNMLEGEIPQELMY-------------------------VKTLE 469 Query: 413 WLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGP 472 L L+ N GEIP LS C L + L+NN L+G+IP+W+G L L + + N G Sbjct: 470 TLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGN 529 Query: 473 IPVEFCQLDWLQILDISDNNISGSLPSCFHPLS---------------------VEQVHL 511 IP E L LD++ N +G++P+ S ++ H Sbjct: 530 IPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHG 589 Query: 512 SKNMLHGQLKRG-------------------------TFFNSYSLVTLDLSYNRLNGNIS 546 + N+L Q R TF N+ S++ LD+SYN L+G I Sbjct: 590 AGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP 649 Query: 547 DWVDGLSQLSHLILGHNNLEGEVP 570 + + L L LGHN++ G +P Sbjct: 650 KEIGSMPYLFILNLGHNDISGSIP 673
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query628
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-111
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-102
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-99
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-88
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-60
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-51
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-41
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-66
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-50
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-52
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-39
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-33
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-43
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-49
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-45
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-32
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-36
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-37
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-38
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-28
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-34
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-20
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-10
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-20
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-13
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  349 bits (898), Expect = e-111
 Identities = 159/599 (26%), Positives = 257/599 (42%), Gaps = 29/599 (4%)

Query: 2   GSFPSLNTLYLSSNNFTDIATATQELHNFTNLEYLTLDSSSLH--ISLLQSIASIFPSLK 59
            S   L +L+LS+++      +        +L  L L  +SL   ++ L S+ S    LK
Sbjct: 74  LSLTGLESLFLSNSHING---SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGS-CSGLK 129

Query: 60  NLSMIGCEVNGLVRGQGFPHFKSLEHLDMEGALIALNTSFLQIIGESMPSLKYLSLFGSI 119
            L++    ++   +  G     SLE LD+    I+       ++ +    LK+L++ G+ 
Sbjct: 130 FLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNK 189

Query: 120 LGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWCLANMTSLRILDVSSNQLTGSISSS 179
           +   S  +    +   V+L+ L+++ N+    +P+ L + ++L+ LD+S N+L+G  S +
Sbjct: 190 I---SGDV---DVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRA 242

Query: 180 PLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAPNFQL 239
            +   T ++ L +S+N F  PI   P      L+      N+   EI    S       L
Sbjct: 243 -ISTCTELKLLNISSNQFVGPI---PPLPLKSLQYLSLAENKFTGEIPDFLSGACDT--L 296

Query: 240 SRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSL 299
           + L LS  +  G + P F      LE + LS    +GE P   L     L+ L L  +  
Sbjct: 297 TGLDLSGNHFYGAV-PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF 355

Query: 300 GGPFQLPIHS-HKRLGMLDISNNNFRGHIPVEIGDV-LPSLFSLNISMNALDGSIPSSFG 357
            G     + +    L  LD+S+NNF G I   +      +L  L +  N   G IP +  
Sbjct: 356 SGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS 415

Query: 358 NMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLE 417
           N   L  L LS N+L+G IP  L      L  L L  N LEG +      +  L  L L+
Sbjct: 416 NCSELVSLHLSFNYLSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILD 474

Query: 418 GNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEF 477
            N   GEIP  LS C  L  + L+NN L+G+IP+W+G L  L  + +  N   G IP E 
Sbjct: 475 FNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL 534

Query: 478 CQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLS 537
                L  LD++ N  +G++P+     S +   ++ N + G+       N         +
Sbjct: 535 GDCRSLIWLDLNTNLFNGTIPAAMFKQSGK---IAANFIAGKR-YVYIKNDGMKKECHGA 590

Query: 538 YN--RLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIP 594
            N     G  S+ ++ LS  +   +      G           +  LD+S N L G IP
Sbjct: 591 GNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP 649


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query628
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.98
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.64
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.5
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.43
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.34
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.31
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.25
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.19
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.18
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.85
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.7
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.51
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.88
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.78
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.7
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.7
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-63  Score=547.83  Aligned_cols=576  Identities=29%  Similarity=0.395  Sum_probs=502.8

Q ss_pred             CCCCCCCCEEeCCCCCCCCccchhhhcccCCCCcEEecCCCCCCCcchh--HhhccCCCCceEecccccccccccCCCcc
Q 039739            1 MGSFPSLNTLYLSSNNFTDIATATQELHNFTNLEYLTLDSSSLHISLLQ--SIASIFPSLKNLSMIGCEVNGLVRGQGFP   78 (628)
Q Consensus         1 ~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~--~l~~~~~~L~~L~l~~~~~~~~~~~~~~~   78 (628)
                      |.++++|+.++++.+.+.   .+++.++++++|++|+|++|.+.+..+.  .+.. +++|++|++++|.+....+...+.
T Consensus        73 l~~L~~L~~l~~~~~~~~---~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~-l~~L~~L~Ls~n~l~~~~~~~~~~  148 (768)
T 3rgz_A           73 LLSLTGLESLFLSNSHIN---GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGS-CSGLKFLNVSSNTLDFPGKVSGGL  148 (768)
T ss_dssp             TTTCTTCCEEECTTSCEE---ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGG-CTTCCEEECCSSEEECCSSCCSCC
T ss_pred             HhccCcccccCCcCCCcC---CCchhhccCCCCCEEECCCCcCCCcCCChHHHhC-CCCCCEEECcCCccCCcCCHHHhc
Confidence            345677777777766543   3567899999999999999999887777  8888 999999999999998777775568


Q ss_pred             ccCccceeecccchhhcCcchhhh---hhccCCCccEEeeccccCCCCCCccccccccCCCCCcEEEccCCcccccCchh
Q 039739           79 HFKSLEHLDMEGALIALNTSFLQI---IGESMPSLKYLSLFGSILGTNSSRILDRGLCSLVHLQVLNIAYNDLRGSLPWC  155 (628)
Q Consensus        79 ~l~~L~~L~l~~~~~~~~~~~~~~---~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~  155 (628)
                      ++++|++|++++|  .+.+..+..   +.. +++|++|++++|.+..    ..  .+..+++|++|++++|.+.+..|. 
T Consensus       149 ~l~~L~~L~Ls~n--~l~~~~~~~~~~~~~-l~~L~~L~Ls~n~l~~----~~--~~~~l~~L~~L~Ls~n~l~~~~~~-  218 (768)
T 3rgz_A          149 KLNSLEVLDLSAN--SISGANVVGWVLSDG-CGELKHLAISGNKISG----DV--DVSRCVNLEFLDVSSNNFSTGIPF-  218 (768)
T ss_dssp             CCTTCSEEECCSS--CCEEETHHHHHHTTC-CTTCCEEECCSSEEES----CC--BCTTCTTCCEEECCSSCCCSCCCB-
T ss_pred             cCCCCCEEECCCC--ccCCcCChhhhhhcc-CCCCCEEECCCCcccc----cC--CcccCCcCCEEECcCCcCCCCCcc-
Confidence            9999999999999  666666655   566 9999999999998832    22  348899999999999999977776 


Q ss_pred             hhcCCCCCEEEccccccccccCCCCCCCCCcccEEEcccCeeeeecCCCCcCCCCcccEEeccCCcccccccccccCccC
Q 039739          156 LANMTSLRILDVSSNQLTGSISSSPLVHLTSIEELYLSNNHFQIPISLEPFFNHSRLKSFYADNNEINAEITQSHSLTAP  235 (628)
Q Consensus       156 l~~l~~L~~L~l~~~~~~~~l~~~~l~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~  235 (628)
                      +..+++|++|++++|.+.+.++. .+..+++|++|++++|.+.+..+..   .+++|++|++++|.+.+.++......+ 
T Consensus       219 l~~l~~L~~L~Ls~n~l~~~~~~-~l~~l~~L~~L~Ls~n~l~~~~~~~---~l~~L~~L~L~~n~l~~~ip~~~~~~~-  293 (768)
T 3rgz_A          219 LGDCSALQHLDISGNKLSGDFSR-AISTCTELKLLNISSNQFVGPIPPL---PLKSLQYLSLAENKFTGEIPDFLSGAC-  293 (768)
T ss_dssp             CTTCCSCCEEECCSSCCCSCHHH-HTTTCSSCCEEECCSSCCEESCCCC---CCTTCCEEECCSSEEEESCCCCSCTTC-
T ss_pred             cccCCCCCEEECcCCcCCCcccH-HHhcCCCCCEEECCCCcccCccCcc---ccCCCCEEECcCCccCCccCHHHHhhc-
Confidence            99999999999999999877776 7999999999999999988655532   789999999999998876665533221 


Q ss_pred             cccceeeeccCCCCCCcccccccccCCCccEEEccCCcccCcCchhHHhcCccCcEEEeecCCCCCCCCcccccCC-ccC
Q 039739          236 NFQLSRLSLSSGYGDGFIFPKFLYHQHDLEYVDLSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFQLPIHSHK-RLG  314 (628)
Q Consensus       236 ~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~-~L~  314 (628)
                       .+|++|++ ..+...+..|..+..+++|++|++++|.+.+.+|...+..+++|++|++++|.+.+..+..+..++ +|+
T Consensus       294 -~~L~~L~L-s~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~  371 (768)
T 3rgz_A          294 -DTLTGLDL-SGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL  371 (768)
T ss_dssp             -TTCSEEEC-CSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCS
T ss_pred             -CcCCEEEC-cCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCc
Confidence             48999999 777788888999999999999999999998888887668999999999999999877888888877 999


Q ss_pred             EEEccCCcCCcccchhhhhh-CCCccEEEcccccCCCcccccccCCCCccEEECcCCcccCccchhhhcCCccccEEEcc
Q 039739          315 MLDISNNNFRGHIPVEIGDV-LPSLFSLNISMNALDGSIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALS  393 (628)
Q Consensus       315 ~L~l~~~~i~~~~~~~~~~~-~~~L~~L~L~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~  393 (628)
                      +|++++|.+.+.++..+... +++|+.|++++|.+++..|..+..+++|+.|++++|.+.+.++.. +..+++|+.|+++
T Consensus       372 ~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~-l~~l~~L~~L~L~  450 (768)
T 3rgz_A          372 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS-LGSLSKLRDLKLW  450 (768)
T ss_dssp             EEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGG-GGGCTTCCEEECC
T ss_pred             EEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHH-HhcCCCCCEEECC
Confidence            99999999988777766532 578999999999999889999999999999999999998666655 4468999999999


Q ss_pred             CCccCCcccccccCCCCCcEEEccCccCcCcccccccCCCcccEEEccCCcCCCccCccccCCCCcceEECCCCcCCCCC
Q 039739          394 NNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLTRLQHIMMPKNHLEGPI  473 (628)
Q Consensus       394 ~~~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~  473 (628)
                      +|.+.+..+..+..+++|++|++++|.+.+.+|..+..+++|++|++++|.+.+..|..+..+++|++|++++|.+.+..
T Consensus       451 ~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~  530 (768)
T 3rgz_A          451 LNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI  530 (768)
T ss_dssp             SSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEEC
T ss_pred             CCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcC
Confidence            99999888888999999999999999999899999999999999999999999999999999999999999999999889


Q ss_pred             cccccCCCCCCEEEccCCcCcCCCCCCC----------------------------------------------------
Q 039739          474 PVEFCQLDWLQILDISDNNISGSLPSCF----------------------------------------------------  501 (628)
Q Consensus       474 ~~~l~~l~~L~~L~l~~~~~~~~~~~~~----------------------------------------------------  501 (628)
                      |..+..+++|+.|++++|++.+..|..+                                                    
T Consensus       531 p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~  610 (768)
T 3rgz_A          531 PAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTR  610 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGT
T ss_pred             CHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccc
Confidence            9999999999999999999886655421                                                    


Q ss_pred             -------------------CCCcccEEecCCCcCcCCCCccccccCCCccEEECCCcccCCccchhhcCCCCCcEEECCC
Q 039739          502 -------------------HPLSVEQVHLSKNMLHGQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGH  562 (628)
Q Consensus       502 -------------------~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~  562 (628)
                                         ...+|+.|++++|++++.+|.. ++.+++|+.|++++|++++.+|..++++++|+.|+|++
T Consensus       611 ~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~-l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~  689 (768)
T 3rgz_A          611 NPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKE-IGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSS  689 (768)
T ss_dssp             CCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGG-GGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCS
T ss_pred             cccccccceecccCchhhhccccccEEECcCCcccccCCHH-HhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCC
Confidence                               1356889999999999999887 89999999999999999999999999999999999999


Q ss_pred             CcCCccCCccccCCCCCcEEECCCCcccccccccccc
Q 039739          563 NNLEGEVPVQLCKLNQLQLLDLSNNSLHGSIPLCLDN  599 (628)
Q Consensus       563 ~~i~~~~~~~l~~l~~L~~L~l~~~~~~~~ip~~~~~  599 (628)
                      |++++.+|+.+.++++|++|++++|+++|.||+.-+-
T Consensus       690 N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~  726 (768)
T 3rgz_A          690 NKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQF  726 (768)
T ss_dssp             SCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSG
T ss_pred             CcccCcCChHHhCCCCCCEEECcCCcccccCCCchhh
Confidence            9999999999999999999999999999999987443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 628
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-08
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 86.3 bits (212), Expect = 5e-19
 Identities = 57/258 (22%), Positives = 93/258 (36%), Gaps = 4/258 (1%)

Query: 340 SLNISMNALDG--SIPSSFGNMKFLQILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSL 397
           +L++S   L     IPSS  N+ +L  L +   +         +     L  L +++ ++
Sbjct: 54  NLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNV 113

Query: 398 EGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNNSLSGKIPRWLGNLT 457
            G +      +  L  L    N   G +P S+S    L G+  + N +SG IP   G+ +
Sbjct: 114 SGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFS 173

Query: 458 RLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHPLSVEQVHLSKNMLH 517
           +L   M    +              L  +D+S N + G     F      Q         
Sbjct: 174 KLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL 233

Query: 518 GQLKRGTFFNSYSLVTLDLSYNRLNGNISDWVDGLSQLSHLILGHNNLEGEVPVQLCKLN 577
                    +       DL  NR+ G +   +  L  L  L +  NNL GE+P Q   L 
Sbjct: 234 AFDLGKVGLSKNLNGL-DLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQ 291

Query: 578 QLQLLDLSNNSLHGSIPL 595
           +  +   +NN      PL
Sbjct: 292 RFDVSAYANNKCLCGSPL 309


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query628
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.56
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.33
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.3
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.11
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.09
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.09
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.85
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.85
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.72
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.93  E-value=2.8e-23  Score=208.60  Aligned_cols=190  Identities=26%  Similarity=0.382  Sum_probs=117.0

Q ss_pred             hcCccCcEEEeecCCCCCCCCcccccCCccCEEEccCCcCCcccchhhhhhCCCccEEEcccccCCCcccccccCCCCcc
Q 039739          284 ENNTKLRQLSLVNDSLGGPFQLPIHSHKRLGMLDISNNNFRGHIPVEIGDVLPSLFSLNISMNALDGSIPSSFGNMKFLQ  363 (628)
Q Consensus       284 ~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~~~~L~  363 (628)
                      ..+++++.+.++++.+.+..  ....+++|+++++++|.+. .++ .+. .+++|+.+++.+|.+++..  .+..+++|+
T Consensus       194 ~~l~~~~~l~l~~n~i~~~~--~~~~~~~L~~L~l~~n~l~-~~~-~l~-~l~~L~~L~l~~n~l~~~~--~~~~~~~L~  266 (384)
T d2omza2         194 AKLTNLESLIATNNQISDIT--PLGILTNLDELSLNGNQLK-DIG-TLA-SLTNLTDLDLANNQISNLA--PLSGLTKLT  266 (384)
T ss_dssp             GGCTTCSEEECCSSCCCCCG--GGGGCTTCCEEECCSSCCC-CCG-GGG-GCTTCSEEECCSSCCCCCG--GGTTCTTCS
T ss_pred             ccccccceeeccCCccCCCC--cccccCCCCEEECCCCCCC-Ccc-hhh-cccccchhccccCccCCCC--cccccccCC
Confidence            45566666666666655432  2345566777777777665 333 222 3667777777777666432  256667777


Q ss_pred             EEECcCCcccCccchhhhcCCccccEEEccCCccCCcccccccCCCCCcEEEccCccCcCcccccccCCCcccEEEccCC
Q 039739          364 ILDLSNNHLTGEIPEHLVVGCVNLESLALSNNSLEGHMFSRNFNLTNLRWLQLEGNHFVGEIPQSLSKCFVLEGLFLNNN  443 (628)
Q Consensus       364 ~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~  443 (628)
                      .++++++++. .++.  +..++.++.+.++.|.+.+  ...+..+++++.|++++|.+.+..  .+..+++|++|++++|
T Consensus       267 ~L~l~~~~l~-~~~~--~~~~~~l~~l~~~~n~l~~--~~~~~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n  339 (384)
T d2omza2         267 ELKLGANQIS-NISP--LAGLTALTNLELNENQLED--ISPISNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFANN  339 (384)
T ss_dssp             EEECCSSCCC-CCGG--GTTCTTCSEEECCSSCCSC--CGGGGGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCSS
T ss_pred             EeeccCcccC-CCCc--ccccccccccccccccccc--ccccchhcccCeEECCCCCCCCCc--ccccCCCCCEEECCCC
Confidence            7777777665 3333  3346667777777766654  233556677777777777666432  2566677777777777


Q ss_pred             cCCCccCccccCCCCcceEECCCCcCCCCCcccccCCCCCCEEEccCC
Q 039739          444 SLSGKIPRWLGNLTRLQHIMMPKNHLEGPIPVEFCQLDWLQILDISDN  491 (628)
Q Consensus       444 ~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~  491 (628)
                      .+++ ++ .+.++++|++|++++|++++..|  +.++++|+.|++++|
T Consensus       340 ~l~~-l~-~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         340 KVSD-VS-SLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CCCC-CG-GGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCE
T ss_pred             CCCC-Ch-hHcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCCCC
Confidence            6653 22 46667777777777777664433  666777777777665



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure