Citrus Sinensis ID: 039797

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MDGSASRAQAIIKPVLLKAGVPLAISVAGFICAKMMARKDDKVSSLKTDSYEKFRDDESCHSLNSTSSSFKEDEEIITSTHFMKSKGDLEFQDKLHYELEILNLRFQIEELQKRELETKMQFARYHDLKEQESLLMELRNMIFLEKSYVELLDREVSSVESENKRLENLVVLYLKVLDQLQQWKSESGLLKRKVKKLVRKTKELSDIIREQNLKIESADAELLRNCDVLEEKSNAIQKLENELKELHSVIDQLQEQNSELLNKLQEWHQSASSVTKIEDEGTTMENYRQLLNECEQLQKDRAAEAKELIYLRWANACLRHELMRNQAQQEQNQEKNRIVEFVGGGGIGDYGIEQHLDGLDMGNVEPCYNVANEGSRAGSKRSRLLKRLKRWVDGSEKMKCKFDEKEKHEIKCFGRHSVCSEAEEEHTILARKSCSSA
cccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccHHHHHHHHccccc
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHccccHHHHHHHcHHcHHccccHHHcccHHccccccHHcHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccHccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHcccHHHHHHHcccccccccccccccccccccccc
MDGSASRAQAIIKPVLLKAGVPLAISVAGFICAKMmarkddkvsslktdsyekfrddeschslnstsssfkedeeiitsthfmkskgdlefQDKLHYELEILNLRFQIEELQKRELETKMQFARYHDLKEQESLLMELRNMIFLEKSYVELLDREVSSVESENKRLENLVVLYLKVLDQLQQWKSESGLLKRKVKKLVRKTKELSDIIREQNLKIESADAELLRNCDVLEEKSNAIQKLENELKELHSVIDQLQEQNSELLNKLQEWHQSASSVTKIEDEGTTMENYRQLLNECEQLQKDRAAEAKELIYLRWANACLRHELMRNQAQQEQNQEKNRIVEFvggggigdygieqhldgldmgnvepcynvanegsragsKRSRLLKRLKRWVDgsekmkckfdekekheikcfgrhsvcseaeEEHTILARKSCSSA
MDGSASRAQAIIkpvllkagvpLAISVAGFICAKmmarkddkvsslKTDSyekfrddeschslnstsssfkedeEIITSTHFMKSKGDLEFQDKLHYELEILNLRFQIEELQKRELETKMQFARYHDLKEQESLLMELRNMIFLEKSYVELLDREVSSVESENKRLENLVVLYLKVLDQLQqwksesgllkrkvkkLVRKtkelsdiireqnlkiesadaeLLRNCDVLEEKSNAIQKLENELKELHSVIDQLQEQNSELLNKLQEWHQSASSVTKIEDEGTTMENYRQLLNECEQLQKDRAAEAKELIYLRWANACLRHELMRNQAQQEQNQEKNRIVEFVGGGGIGDYGIEQHLDGLDMGNVEPCYNVanegsragskrsrllkrlkrwvdgsekmkckfdekekheikcfgrhsvcseaeeehtilarkscssa
MDGSASRAQAIIKPVLLKAGVPLAISVAGFICAKMMARKDDKVSSLKTDSYEKFRDDESCHSLNSTSSSFKEDEEIITSTHFMKSKGDLEFQDKLHYELEILNLRFQIEELQKRELETKMQFARYHDLKEQESLLMELRNMIFLEKSYVELLDREVSSVESENKRLENLVVLYLKVLDQLQQWKSESGllkrkvkklvrkTKELSDIIREQNLKIESADAELLRNCDVLEEKSNAIQKLENELKELHSVIDQLQEQNSELLNKLQEWHQSASSVTKIEDEGTTMENYRQLLNECEQLQKDRAAEAKELIYLRWANACLRHELMRnqaqqeqnqeKNRIVEFVggggigdygiEQHLDGLDMGNVEPCYNVANEgsragskrsrllkrlkrWVDGSEKMKCKFDEKEKHEIKCFGRHSVCSEAEEEHTILARKSCSSA
*********AIIKPVLLKAGVPLAISVAGFICAKMM********************************************HFMK*KGDLEFQDKLHYELEILNLRFQIEELQKRELETKMQFARYHDLKEQESLLMELRNMIFLEKSYVELLDREVSSV***NKRLENLVVLYLKVLDQLQQWKSESGLLKRKVKKLVRKTKELSDIIREQNLKIESADAELLRNCDVL***********************************************************QLLNECEQL***RAAEAKELIYLRWANACLRHELM*************RIVEFVGGGGIGDYGIEQHLDGLDMGNVEPCYNVA***************RLKRWVD***************EIKCFGRHSV*******************
************KPVLLKAGVPLAISVAGFIC********************************************************************************************************************************************************************************************************************************************************************************AKELIYLRWANACL***********************************************************************************************************************
********QAIIKPVLLKAGVPLAISVAGFICAKMMA**********TDSY**********************EEIITSTHFMKSKGDLEFQDKLHYELEILNLRFQIEELQKRELETKMQFARYHDLKEQESLLMELRNMIFLEKSYVELLDREVSSVESENKRLENLVVLYLKVLDQLQQWKSESGLLKRKVKKLVRKTKELSDIIREQNLKIESADAELLRNCDVLEEKSNAIQKLENELKELHSVIDQLQEQNSELLNKLQEWHQSASSVTKIEDEGTTMENYRQLLNECEQLQKDRAAEAKELIYLRWANACLRHELMRN********EKNRIVEFVGGGGIGDYGIEQHLDGLDMGNVEPCYNVAN*********SRLLKRLKRWVDGSEKMKCKFDEKEKHEIKCFGRHSVC******************
*********AIIKPVLLKAGVPLAISVAGFICAKMMARK*************KFRDDESCHSLNSTSSSFKEDEEIITSTHFMKSKGDLEFQDKLHYELEILNLRFQIEELQKRELETKMQFARYHDLKEQESLLMELRNMIFLEKSYVELLDREVSSVESENKRLENLVVLYLKVLDQLQQWKSESGLLKRKVKKLVRKTKELSDIIREQNLKIESADAELLRNCDVLEEKSNAIQKLENELKELHSVIDQLQEQNSELLNKLQEWHQSASSVTKIEDEGTTMENYRQLLNECEQLQKDRAAEAKELIYLRWANACLRHELMRNQA*************FVGG************************************RSRLLKRLKRWVDGSE***********HEIKCFGR**V*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGSASRAQAIIKPVLLKAGVPLAISVAGFICAKMMARKDDKVSSLKTDSYEKFRDDESCHSLNSTSSSFKEDEEIITSTHFMKSKGDLEFQDxxxxxxxxxxxxxxxxxxxxxxxxxxMQFARYHDLKEQESLLMELRNMIFLEKSYxxxxxxxxxxxxxxxxxxxxxVVLYLKVLDQLQQWKSESGLLKRKVKKLVRKTKELSDIIREQNLKIESADAELLRNCDVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxASSVTKIEDEGTTMENxxxxxxxxxxxxxxxxxxxxxLIYLRWANACLRHELMRNQAQQEQNQEKNRIVEFVGGGGIGDYGIEQHLDGLDMGNVEPCYNVANEGSRAGSKRSRLLKRLKRWVDGSEKMKCKFDEKEKHEIKCFGRHSVCSEAEEEHTILARKSCSSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query437 2.2.26 [Sep-21-2011]
Q9LI74 1004 Protein CHUP1, chloroplas no no 0.668 0.290 0.251 2e-14
>sp|Q9LI74|CHUP1_ARATH Protein CHUP1, chloroplastic OS=Arabidopsis thaliana GN=CHUP1 PE=1 SV=1 Back     alignment and function desciption
 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 81/322 (25%), Positives = 164/322 (50%), Gaps = 30/322 (9%)

Query: 100 EILNLRFQIEELQKRELETKMQFARYHDLKEQESLLMELRNMIFLEKSYVELLDREVSSV 159
           E+  L+  ++EL++RE++ + +   Y+ LKEQES ++EL+  + ++   +++L+  ++S+
Sbjct: 130 ELERLKQLVKELEEREVKLEGELLEYYGLKEQESDIVELQRQLKIKTVEIDMLNITINSL 189

Query: 160 ESENKRLENLVVLYLKVLDQLQQWKSESGLLKRKVKKLVRKTKELSDIIREQNLKIESAD 219
           ++E K+L+  +     V  +L+  +++   L+R+++    +TK    ++++    ++  +
Sbjct: 190 QAERKKLQEELSQNGIVRKELEVARNKIKELQRQIQLDANQTKGQLLLLKQHVSSLQMKE 249

Query: 220 AELLRNCDVLEEKSNAIQKLENELKELHSVIDQLQEQNSELLNKLQEWHQSASS------ 273
            E +     +E K  A+Q LE ++ EL     +LQ +  EL  KL       ++      
Sbjct: 250 EEAMNKDTEVERKLKAVQDLEVQVMELKRKNRELQHEKRELSIKLDSAEARIATLSNMTE 309

Query: 274 ---VTKIEDEGTTME-NYRQLLNECEQLQKDRAAEAKELIYLRWANACLRHE-------- 321
              V K+ +E   ++ N   LL + E LQ +R +E +EL+YLRW NACLR+E        
Sbjct: 310 SDKVAKVREEVNNLKHNNEDLLKQVEGLQMNRFSEVEELVYLRWVNACLRYELRNYQTPA 369

Query: 322 -------LMRNQAQQEQNQEKNRIVEFVGG-GGIGDYGIEQHLDGLDMGNVEPCYNVANE 373
                  L +N + + Q + K  ++E+ G   G GD  +E +         +   N + +
Sbjct: 370 GKISARDLSKNLSPKSQAKAKRLMLEYAGSERGQGDTDLESNYSQPSSPGSDDFDNASMD 429

Query: 374 ----GSRAGSKRSRLLKRLKRW 391
                  + SK+  L+++LK+W
Sbjct: 430 SSTSRFSSFSKKPGLIQKLKKW 451
Required for the positioning and movement of chloroplasts. Interacts with profilin and actin independent of its polymerization status. Regulates chloroplast localization by anchoring chloroplasts to the plasma membrane and forming a bridge to the actin cytoskeleton.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
225441074440 PREDICTED: protein CHUP1, chloroplastic 0.942 0.936 0.498 2e-91
147828025 1303 hypothetical protein VITISV_022322 [Viti 0.942 0.316 0.498 2e-90
356570802445 PREDICTED: protein CHUP1, chloroplastic- 0.945 0.928 0.409 4e-76
224084010356 predicted protein [Populus trichocarpa] 0.739 0.907 0.463 2e-74
255556758412 conserved hypothetical protein [Ricinus 0.906 0.961 0.437 8e-70
356533389450 PREDICTED: protein CHUP1, chloroplastic- 0.974 0.946 0.377 2e-62
255641585450 unknown [Glycine max] 0.974 0.946 0.375 1e-61
356548369438 PREDICTED: protein CHUP1, chloroplastic- 0.926 0.924 0.380 1e-59
357440273411 Protein CHUP1 [Medicago truncatula] gi|3 0.894 0.951 0.365 2e-59
297823475395 predicted protein [Arabidopsis lyrata su 0.885 0.979 0.352 3e-53
>gi|225441074|ref|XP_002264392.1| PREDICTED: protein CHUP1, chloroplastic [Vitis vinifera] gi|297740023|emb|CBI30205.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  342 bits (877), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 211/423 (49%), Positives = 290/423 (68%), Gaps = 11/423 (2%)

Query: 12  IKPVLLKAGVPLAISVAGFICAKMMARKD--DKVSSL--KTDSYEKFRDDESCHSLNSTS 67
           +KP +LKAG+PLA+SVA FI AK+M R++   K SS   + DS       ES   LNS  
Sbjct: 1   MKPKILKAGLPLALSVAAFIIAKIMERRNLVPKASSFENQVDSPPANSMVESVDGLNSAC 60

Query: 68  SSFKEDE-EIITSTHFMKSKGDLEFQDKLHYELEILNLRFQIEELQKRELETKMQFARYH 126
              +E E +IIT+   ++S    E QD   +E EIL LR QIE LQ+RE E  M+F  Y 
Sbjct: 61  VLLEEGEGQIITNRSLVESS---EIQDPPDHEEEILALRRQIEHLQEREWELAMRFLCYC 117

Query: 127 DLKEQESLLMELRNMIFLEKSYVELLDREVSSVESENKRLENLVVLYLKVLDQLQQWKSE 186
           ++KEQES L+ELR+ + LE + VE L+ EVS +E+ENKR E+LVV YL+V++QL+ WK E
Sbjct: 118 EIKEQESRLLELRSRLLLEIARVEFLNWEVSLMEAENKRHEDLVVEYLRVVEQLEFWKLE 177

Query: 187 SGLLKRKVKKLVRKTKELSDIIREQNLKIESADAELLRNCDVLEEKSNAIQKLENELKEL 246
           + LL R+VKKL +KT++ S +IR+ NLKIE  + E+ RN + LE ++ AI KL+NE++EL
Sbjct: 178 NRLLHREVKKLAKKTRQQSRVIRDCNLKIEGIEKEISRNQEELERRTTAISKLDNEVREL 237

Query: 247 HSVIDQLQEQNSELLNKLQEWHQSASSVTKIEDEGTTMENYRQLLNECEQLQKDRAAEAK 306
            + ++Q+QE+  +L +KL+   +SA S +K E EG   E+Y QL+NE E+L KDRAAE K
Sbjct: 238 QATLNQVQEEKHQLSDKLKLAEKSAPSTSKSEAEGIAKEDYNQLVNELERLHKDRAAEVK 297

Query: 307 ELIYLRWANACLRHELMRNQAQQEQNQEKNRI-VEFVGGGGIGDYGIEQHLDGLDM-GNV 364
           EL+YLRW+NACLRHELMRNQ Q EQNQE  +  ++F   G  G++  E  L+G  +    
Sbjct: 298 ELVYLRWSNACLRHELMRNQKQPEQNQESCQSELDFEPKGETGEHASEHELEGTVLEPPS 357

Query: 365 EPCYNVANEGSRAGSKRSRLLKRLKRWVDGSEKMKCKFDEKEKHEIKCFGRHSVCSEAEE 424
           EPC  V++ GS   SKR ++L++L+RWVDGSEK+K   +E E+HEIKCFG+H V  +AEE
Sbjct: 358 EPCLGVSS-GSHISSKRPKILQKLRRWVDGSEKIKPTSEEGEEHEIKCFGKHCVLHKAEE 416

Query: 425 EHT 427
            H 
Sbjct: 417 HHV 419

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147828025|emb|CAN72920.1| hypothetical protein VITISV_022322 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356570802|ref|XP_003553573.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|224084010|ref|XP_002307197.1| predicted protein [Populus trichocarpa] gi|222856646|gb|EEE94193.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255556758|ref|XP_002519412.1| conserved hypothetical protein [Ricinus communis] gi|223541275|gb|EEF42826.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356533389|ref|XP_003535247.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255641585|gb|ACU21065.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356548369|ref|XP_003542575.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357440273|ref|XP_003590414.1| Protein CHUP1 [Medicago truncatula] gi|355479462|gb|AES60665.1| Protein CHUP1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297823475|ref|XP_002879620.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297325459|gb|EFH55879.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
TAIR|locus:2040620373 AT2G36650 "AT2G36650" [Arabido 0.567 0.664 0.348 5.9e-42
TAIR|locus:2102385 1004 CHUP1 "CHLOROPLAST UNUSUAL POS 0.624 0.271 0.246 3e-18
TAIR|locus:2034091573 AR791 "AT1G52080" [Arabidopsis 0.517 0.394 0.282 1.1e-16
UNIPROTKB|Q6V4L1398 Q6V4L1 "M protein" [Streptococ 0.590 0.648 0.256 1.7e-06
DICTYBASE|DDB_G0287291 1738 abpD "interaptin" [Dictyosteli 0.594 0.149 0.203 3.6e-06
DICTYBASE|DDB_G0290503 1492 DDB_G0290503 [Dictyostelium di 0.604 0.176 0.233 5e-06
FB|FBgn0020503 1690 CLIP-190 "Cytoplasmic linker p 0.592 0.153 0.242 9.6e-06
CGD|CAL0001468895 SYS3 [Candida albicans (taxid: 0.528 0.258 0.231 9.6e-06
UNIPROTKB|Q59UF5895 SYS3 "Potential GRIP domain Go 0.528 0.258 0.231 9.6e-06
UNIPROTKB|E1BKT9 2889 DSP "Uncharacterized protein" 0.601 0.091 0.243 1e-05
TAIR|locus:2040620 AT2G36650 "AT2G36650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 408 (148.7 bits), Expect = 5.9e-42, Sum P(2) = 5.9e-42
 Identities = 91/261 (34%), Positives = 159/261 (60%)

Query:    64 NSTSSSFKEDEEIITSTHFMKSKGDLEFQDKLHYELEILNLRFQIEELQKRELETKMQFA 123
             N  +SS    E   +S+   ++  + E +     + EIL+L+ + EELQ++E E ++ F 
Sbjct:    43 NEVTSSTSNPES--SSSPSRENDEEEEAESPNQQKQEILSLKSRFEELQRKEYEMELHFE 100

Query:   124 RYHDLKEQESLLMELRNMIFLEKSYVELLDREVSSVESENKRLENLVVLYLKVLDQLQQW 183
             R+ +LK+QE +L+E ++++ LEK+ ++   +EV ++E E+KR + LV++YLK++ ++Q+ 
Sbjct:   101 RFCNLKDQEVMLIEHKSILSLEKAQLDFFRKEVLAMEEEHKRGQALVIVYLKLVGEIQEL 160

Query:   184 KSESGXXXXXXXXXXXXTKELSDIIREQNLKIESADAELLRNCDVLEEKSNAIQKLENEL 243
             +SE+G            +K+L  ++ E   KI   + E L+  D LE K+N +++LE ++
Sbjct:   161 RSENGLLEGKAKKLRRKSKQLYRVVNESR-KIIGVEKEFLKCVDELETKNNIVKELEGKV 219

Query:   244 KELHSVIDQLQEQNSELLNKLQEWHQSASSVTKIEDEGTTMENYRQLLNECEQLQKDRAA 303
             K++ + +D LQE+  EL  K      S S +  +ED       YR+++ E E+L+KD A 
Sbjct:   220 KDMEAYVDVLQEEKEELFMKSSN---STSEMVSVED-------YRRIVEEYEELKKDYAN 269

Query:   304 EAKELIYLRWANACLRHELMR 324
               KE+I LRW+NACLRHE+MR
Sbjct:   270 GVKEVINLRWSNACLRHEVMR 290
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2102385 CHUP1 "CHLOROPLAST UNUSUAL POSITIONING 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034091 AR791 "AT1G52080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6V4L1 Q6V4L1 "M protein" [Streptococcus pyogenes (taxid:1314)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287291 abpD "interaptin" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290503 DDB_G0290503 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0020503 CLIP-190 "Cytoplasmic linker protein 190" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
CGD|CAL0001468 SYS3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59UF5 SYS3 "Potential GRIP domain Golgi protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKT9 DSP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 7e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 9e-04
COG0497557 COG0497, RecN, ATPase involved in DNA repair [DNA 0.001
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
COG4942 420 COG4942, COG4942, Membrane-bound metallopeptidase 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.004
pfam01496 707 pfam01496, V_ATPase_I, V-type ATPase 116kDa subuni 0.004
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information 
 Score = 48.9 bits (117), Expect = 4e-06
 Identities = 58/276 (21%), Positives = 118/276 (42%), Gaps = 35/276 (12%)

Query: 76  IITSTHFMKSKGDLEFQDKLHYELEILNLRFQIEELQKRELETKMQFARYHDLKEQESLL 135
            IT     K     + ++    E E+  L  Q+E+L++     K      ++L+  E LL
Sbjct: 651 SITGGSRNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSLK------NELRSLEDLL 704

Query: 136 MELRNMIFLEKSYVELLDREVSSVESENKRLENLVVLYLKVLDQLQQWKSES-------- 187
            ELR  +   +  +E L RE++++E E ++L++ +    + L++L++   E         
Sbjct: 705 EELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELE 764

Query: 188 ---GLLKRKVKKLVRKTKELSDIIREQNLKIESADAELLRNCDVLEEKSNAIQKLENELK 244
                L+  + KL  + +EL +  +    ++E  + EL      L+     ++ LE   +
Sbjct: 765 EELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRE 824

Query: 245 ELHSVIDQLQEQNSELLNKLQEWHQSASSVTKIEDEGTTMENYRQLLNECEQLQKDRAAE 304
            L   I++L+E+  EL  KL E  +    + K  +E         L  E E+L+ ++   
Sbjct: 825 RLEQEIEELEEEIEELEEKLDELEEELEELEKELEE---------LKEELEELEAEKEEL 875

Query: 305 AKELIYLRWANACLRHELMRNQAQQEQNQEKNRIVE 340
             EL            E  + + ++E  + ++ + E
Sbjct: 876 EDELK---------ELEEEKEELEEELRELESELAE 902

Length = 1163
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223571 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|216531 pfam01496, V_ATPase_I, V-type ATPase 116kDa subunit family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 437
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.42
KOG4673 961 consensus Transcription factor TMF, TATA element m 97.39
PHA02562562 46 endonuclease subunit; Provisional 97.38
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 97.24
PRK02224 880 chromosome segregation protein; Provisional 97.18
PRK03918 880 chromosome segregation protein; Provisional 97.16
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.1
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.09
KOG0977546 consensus Nuclear envelope protein lamin, intermed 97.08
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.0
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.98
KOG0996 1293 consensus Structural maintenance of chromosome pro 96.97
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 96.83
PRK02224880 chromosome segregation protein; Provisional 96.79
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 96.75
KOG0971 1243 consensus Microtubule-associated protein dynactin 96.71
PHA02562562 46 endonuclease subunit; Provisional 96.71
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.63
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 96.59
PLN031881320 kinesin-12 family protein; Provisional 96.55
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.49
PRK03918 880 chromosome segregation protein; Provisional 96.47
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 96.37
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 96.34
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.31
KOG02501074 consensus DNA repair protein RAD18 (SMC family pro 96.29
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.21
PF10174775 Cast: RIM-binding protein of the cytomatrix active 96.12
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.93
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 95.77
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 95.63
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 95.59
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 95.46
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 95.45
PRK09039343 hypothetical protein; Validated 95.45
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 95.37
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 95.36
PRK11637428 AmiB activator; Provisional 95.34
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 95.29
KOG4673 961 consensus Transcription factor TMF, TATA element m 95.15
PRK04863 1486 mukB cell division protein MukB; Provisional 95.12
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 95.09
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.08
PRK01156895 chromosome segregation protein; Provisional 95.07
PRK11637428 AmiB activator; Provisional 95.01
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.96
KOG0963 629 consensus Transcription factor/CCAAT displacement 94.9
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.88
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.87
PF13851201 GAS: Growth-arrest specific micro-tubule binding 94.82
COG4942420 Membrane-bound metallopeptidase [Cell division and 94.73
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 94.67
PF06548488 Kinesin-related: Kinesin-related; InterPro: IPR010 94.6
PF14662193 CCDC155: Coiled-coil region of CCDC155 94.56
KOG0933 1174 consensus Structural maintenance of chromosome pro 94.46
PF00038312 Filament: Intermediate filament protein; InterPro: 94.4
PRK01156895 chromosome segregation protein; Provisional 94.3
KOG09331174 consensus Structural maintenance of chromosome pro 94.24
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 93.96
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 93.92
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 93.91
PRK09039343 hypothetical protein; Validated 93.81
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 93.8
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 93.79
PF1136596 DUF3166: Protein of unknown function (DUF3166); In 93.77
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 93.57
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 93.23
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 92.93
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 92.91
COG2433652 Uncharacterized conserved protein [Function unknow 92.74
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 92.66
KOG0963 629 consensus Transcription factor/CCAAT displacement 92.56
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 92.4
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 92.22
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 92.21
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 91.96
PF10186302 Atg14: UV radiation resistance protein and autopha 91.95
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 91.94
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 91.94
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 91.89
PF00038312 Filament: Intermediate filament protein; InterPro: 91.63
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 91.55
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 91.53
KOG3091508 consensus Nuclear pore complex, p54 component (sc 91.07
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 90.79
KOG0971 1243 consensus Microtubule-associated protein dynactin 90.65
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 90.58
KOG4809654 consensus Rab6 GTPase-interacting protein involved 90.5
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 90.47
KOG0996 1293 consensus Structural maintenance of chromosome pro 90.44
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 90.4
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 90.37
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 90.14
COG4942420 Membrane-bound metallopeptidase [Cell division and 90.13
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 90.03
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 90.03
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 89.96
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 89.95
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 89.65
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 89.61
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 89.51
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 89.37
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 89.37
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 89.14
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 89.14
COG3883265 Uncharacterized protein conserved in bacteria [Fun 89.1
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 88.97
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 88.97
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 88.74
PRK10361 475 DNA recombination protein RmuC; Provisional 88.72
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 88.7
COG2433652 Uncharacterized conserved protein [Function unknow 88.64
PRK10884206 SH3 domain-containing protein; Provisional 88.42
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 88.3
TIGR00634563 recN DNA repair protein RecN. All proteins in this 88.08
PF01486100 K-box: K-box region; InterPro: IPR002487 MADS gene 88.07
COG3883265 Uncharacterized protein conserved in bacteria [Fun 87.96
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 87.8
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 87.62
PF06632342 XRCC4: DNA double-strand break repair and V(D)J re 87.17
PRK12704 520 phosphodiesterase; Provisional 86.36
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 86.14
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 86.11
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 86.07
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 86.06
KOG0979 1072 consensus Structural maintenance of chromosome pro 86.06
PRK10476346 multidrug resistance protein MdtN; Provisional 86.04
KOG1003205 consensus Actin filament-coating protein tropomyos 85.99
KOG0018 1141 consensus Structural maintenance of chromosome pro 85.97
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 85.88
KOG0249 916 consensus LAR-interacting protein and related prot 85.84
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 85.77
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 85.6
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 85.46
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 85.44
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 85.06
PRK04778569 septation ring formation regulator EzrA; Provision 85.04
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 84.85
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 84.69
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 84.19
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 84.0
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 83.57
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 83.51
PRK04863 1486 mukB cell division protein MukB; Provisional 83.43
PF05278269 PEARLI-4: Arabidopsis phospholipase-like protein ( 83.14
PF14662193 CCDC155: Coiled-coil region of CCDC155 83.06
PF04859131 DUF641: Plant protein of unknown function (DUF641) 82.76
PRK04778569 septation ring formation regulator EzrA; Provision 82.55
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 82.37
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 81.63
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 81.45
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 81.31
PRK1542279 septal ring assembly protein ZapB; Provisional 81.13
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 81.12
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 80.47
PF10226195 DUF2216: Uncharacterized conserved proteins (DUF22 80.12
KOG0979 1072 consensus Structural maintenance of chromosome pro 80.03
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information 
Probab=97.42  E-value=0.29  Score=55.17  Aligned_cols=26  Identities=35%  Similarity=0.374  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039797           98 ELEILNLRFQIEELQKRELETKMQFA  123 (437)
Q Consensus        98 ~~EI~~Lr~lVeeLqERE~~LE~eLL  123 (437)
                      ..++..|+..+..++..-..++.++.
T Consensus       676 ~~e~~~l~~~~~~l~~~l~~~~~~~~  701 (1179)
T TIGR02168       676 RREIEELEEKIEELEEKIAELEKALA  701 (1179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34555555555555555444444433

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle.
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF11365 DUF3166: Protein of unknown function (DUF3166); InterPro: IPR021507 This eukaryotic family of proteins has no known function Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF01486 K-box: K-box region; InterPro: IPR002487 MADS genes in plants encode key developmental regulators of vegetative and reproductive development Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF04859 DUF641: Plant protein of unknown function (DUF641); InterPro: IPR006943 This conserved region is found in a number of plant proteins of unknown function Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-07
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 7e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 61.0 bits (147), Expect = 4e-10
 Identities = 57/412 (13%), Positives = 125/412 (30%), Gaps = 116/412 (28%)

Query: 29  GFICAKMMARKDDKVSSLKTDSYEKFRDDESCHSLNSTSSSFKEDEEIITSTHFMKSKGD 88
            F+ + +  + + +  S+ T  Y + RD      L + +  F +        +  + +  
Sbjct: 92  KFLMSPI--KTEQRQPSMMTRMYIEQRD-----RLYNDNQVFAKY-------NVSRLQPY 137

Query: 89  LEFQDKLHYELEILNLRFQ-----------------IEELQKRELETKMQFARY----HD 127
           L+ +  L      L LR                   ++     +++ KM F  +     +
Sbjct: 138 LKLRQAL------LELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKN 191

Query: 128 LKEQESLLMELRNMIF-LEKSYVELLDREVS---SVESENKRLENLVVL--Y---LKVLD 178
               E++L  L+ +++ ++ ++    D   +    + S    L  L+    Y   L VL 
Sbjct: 192 CNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLL 251

Query: 179 QLQQWKSESGLLKR---KVKKLV--RKTKELSDIIREQNLKIESAD-----------AEL 222
            +    ++           K L+  R  K+++D +        S D             L
Sbjct: 252 NV--QNAK--AWNAFNLSCKILLTTRF-KQVTDFLSAATTTHISLDHHSMTLTPDEVKSL 306

Query: 223 LRNCDVLEEKSNAIQKLENELKELHS-VIDQLQEQNSELLNKLQEW-HQSASSVTKIED- 279
           L     L+ +    Q L  E+   +   +  + E   + L     W H +   +T I + 
Sbjct: 307 LLKY--LDCR---PQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIES 361

Query: 280 --EGTTMENYRQLLNECEQLQKDRAAEAKELIYLRW-----------ANACLR------- 319
                    YR++ +               L  + W            N   +       
Sbjct: 362 SLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLI-WFDVIKSDVMVVVNKLHKYSLVEKQ 420

Query: 320 --------HEL-MRNQAQQEQNQEKNRIVEFVGGGGIGDYGIEQHLDGLDMG 362
                     + +  + + E     +R +       +  Y I +  D  D+ 
Sbjct: 421 PKESTISIPSIYLELKVKLENEYALHRSI-------VDHYNIPKTFDSDDLI 465
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.73
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 96.71
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 96.44
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 96.04
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 96.01
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.49
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.36
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 94.53
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 93.82
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.78
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 91.96
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 91.58
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 90.95
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 89.9
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 87.78
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 87.05
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 85.73
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 85.48
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 85.07
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 84.97
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 84.35
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 83.73
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 82.92
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 81.81
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 81.78
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 81.73
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 80.14
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
Probab=96.73  E-value=0.054  Score=61.47  Aligned_cols=24  Identities=25%  Similarity=0.259  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHhHHHHHHHHHHH
Q 039797          238 KLENELKELHSVIDQLQEQNSELL  261 (437)
Q Consensus       238 ~LE~Ev~ELrr~nk~LQ~EK~eL~  261 (437)
                      +|+..|..|+..|..|+.+..+|.
T Consensus      1020 ~L~~kv~~L~~e~~~L~qq~~~l~ 1043 (1080)
T 2dfs_A         1020 ETEQLVSELKEQNTLLKTEKEELN 1043 (1080)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            444444444444444444444444
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00