Citrus Sinensis ID: 039912

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
SARGKRVHWVGKYSIKMEKYKRAARAVLTPEVGNGLIGELKRGGLWVRTASDKPQATDVLLRNHLVITHKRRIEYLVVVSDDSDFVEVLLEANLRCLKTVVVGDINDGALKRISYACFSWWDILMGKARKEAVSVVGKWKDGDVLKRLEWTYDPEVEKKALDWDDGTEGADVDDITLASDADFIQKEDGGALMEAGFF
cccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEccccccccccHHccccHHHHHHHcHHHHHHHHHccccccHHHHHcccccccHHHHHHHccccccccccccccccccccccccccccccHHHHcccc
ccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHccccEEEEEccccccHccEccEEEcHHHHHcccHHHHcHHHHcccccHHHHHHHccccccHHHHHEEccccccccccccccccccccccccHccccHHHHcccc
sargkrvhwVGKYSIKMEKYKRAARAvltpevgngligelkrgglwvrtasdkpqatdVLLRNHLVITHKRRIEYLVVVSDDSDFVEVLLEANLRCLKTVVVGDINDGALKRISYACFSWWDILMGKARKEAVSVVGkwkdgdvlkrlewtydpevekkaldwddgtegadvdditlasdadfiqkedggalmeagff
sargkrvhwvgkysikmekyKRAARavltpevgngligelkrgGLWVRTasdkpqatdvllrnhLVITHKRRIEYLVVVSDDSDFVEVLLEAnlrclktvvvgdindgaLKRISYACFSWWDILMGKARKEAVsvvgkwkdgdvlkrlewtydpevekkaldwddgtegadvdditlasDADFIQKEDGGALMEAGFF
SARGKRVHWVGKYSIKMEKYKRAARAVLTPEVGNGLIGELKRGGLWVRTASDKPQATDVLLRNHLVITHKRRIEYlvvvsddsdfvevllEANLRCLKTVVVGDINDGALKRISYACFSWWDILMGKARKEAVSVVGKWKDGDVLKRLEWTYDPEVEKKALDWDDGTEGADVDDITLASDADFIQKEDGGALMEAGFF
******VHWVGKYSIKMEKYKRAARAVLTPEVGNGLIGELKRGGLWVRTASDKPQATDVLLRNHLVITHKRRIEYLVVVSDDSDFVEVLLEANLRCLKTVVVGDINDGALKRISYACFSWWDILMGKARKEAVSVVGKWKDGDVLKRLEWTYDPEVEKKALDWDDGTEGADVDDITLASDA*F***************
*************SIKMEKYKRAARAVLTPEVGNGLIGELKRGGLWVRTASDK******LLRNHLVITHKRRIEYLVVVSDDSDFVEVLLEANLRCLKTVVVGDINDGALKRISYACFSWWDILMGKARKEAVSVVGKWKDGDVLKRLEWTYDPEVEKKALDWDDGTEGADVDDITLASDADFIQKEDGGALMEAGFF
SARGKRVHWVGKYSIKMEKYKRAARAVLTPEVGNGLIGELKRGGLWVRTASDKPQATDVLLRNHLVITHKRRIEYLVVVSDDSDFVEVLLEANLRCLKTVVVGDINDGALKRISYACFSWWDILMGKARKEAVSVVGKWKDGDVLKRLEWTYDPEVEKKALDWDDGTEGADVDDITLASDADFIQKEDGGALMEAGFF
*****RVHWVGKYSIKMEKYKRAARAVLTPEVGNGLIGELKRGGLWVRTASDKPQATDVLLRNHLVITHKRRIEYLVVVSDDSDFVEVLLEANLRCLKTVVVGDINDGALKRISYACFSWWDILMGKARKEAVSVVGKWKDGDVLKRLEWTYDPEVEKKALDWDD******VDDITLASDADFIQKEDGGALMEAGFF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SARGKRVHWVGKYSIKMEKYKRAARAVLTPEVGNGLIGELKRGGLWVRTASDKPQATDVLLRNHLVITHKRRIEYLVVVSDDSDFVEVLLEANLRCLKTVVVGDINDGALKRISYACFSWWDILMGKARKEAVSVVGKWKDGDVLKRLEWTYDPEVEKKALDWDDGTEGADVDDITLASDADFIQKEDGGALMEAGFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
255537067 375 nucleic acid binding protein, putative [ 0.964 0.509 0.626 6e-58
255537065294 nucleic acid binding protein, putative [ 0.964 0.649 0.631 9e-58
224074705 300 predicted protein [Populus trichocarpa] 0.954 0.63 0.609 6e-57
356538069 393 PREDICTED: uncharacterized protein LOC10 0.964 0.486 0.576 4e-53
449494370 368 PREDICTED: uncharacterized LOC101211196 0.803 0.432 0.689 1e-52
356569166 356 PREDICTED: uncharacterized protein LOC10 0.883 0.491 0.601 3e-52
357462889 411 hypothetical protein MTR_3g084750 [Medic 0.833 0.401 0.648 3e-52
449460491 367 PREDICTED: uncharacterized protein LOC10 0.797 0.430 0.683 1e-50
15234485 364 C2H2 type zinc finger protein [Arabidops 0.954 0.519 0.529 2e-47
297809527 365 zinc finger family protein [Arabidopsis 0.803 0.435 0.577 8e-45
>gi|255537067|ref|XP_002509600.1| nucleic acid binding protein, putative [Ricinus communis] gi|223549499|gb|EEF50987.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  229 bits (583), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 126/201 (62%), Positives = 151/201 (75%), Gaps = 10/201 (4%)

Query: 1   SARGKR-VHWVGKYSIKMEKYKRAARAVLTPEVGNGLIGELKRGGLWVRTASDKPQATDV 59
           SARGKR V+ V KY++KM+KYK AAR VLTP+VG GL  ELKR G WV T SDKPQA DV
Sbjct: 163 SARGKRRVNLVAKYAMKMQKYKNAARDVLTPKVGYGLADELKRAGFWVTTVSDKPQAADV 222

Query: 60  LLRNHLV-ITHKRRIEYLVVVSDDSDFVEVLLEANLRCLKTVVVGDINDGALKRISYACF 118
            LR H+V +  KRR E LV+VSDDSDFV VL EA LRC+KTVVVGDINDGALKR++ A F
Sbjct: 223 ALREHIVDMMDKRRAECLVLVSDDSDFVGVLKEAKLRCVKTVVVGDINDGALKRVADAEF 282

Query: 119 SWWDILMGKARKEAVSVVGKWKDGDVLKRLEWTYDPEVEKKAL-----DWD---DGTEGA 170
           SW +ILMGKA+KEAVSVVGKWKD D+LK+LEWTY+PE +KK +     D++   D  +  
Sbjct: 283 SWQEILMGKAKKEAVSVVGKWKDRDILKKLEWTYNPEEQKKFVVNAFNDYNGDTDEIDNG 342

Query: 171 DVDDITLASDADFIQKEDGGA 191
           D D  +  + A+ +QKE  GA
Sbjct: 343 DFDGFSDENGANCMQKEAVGA 363

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255537065|ref|XP_002509599.1| nucleic acid binding protein, putative [Ricinus communis] gi|223549498|gb|EEF50986.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224074705|ref|XP_002304433.1| predicted protein [Populus trichocarpa] gi|222841865|gb|EEE79412.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356538069|ref|XP_003537527.1| PREDICTED: uncharacterized protein LOC100785257 [Glycine max] Back     alignment and taxonomy information
>gi|449494370|ref|XP_004159528.1| PREDICTED: uncharacterized LOC101211196 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356569166|ref|XP_003552776.1| PREDICTED: uncharacterized protein LOC100789840 [Glycine max] Back     alignment and taxonomy information
>gi|357462889|ref|XP_003601726.1| hypothetical protein MTR_3g084750 [Medicago truncatula] gi|355490774|gb|AES71977.1| hypothetical protein MTR_3g084750 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449460491|ref|XP_004147979.1| PREDICTED: uncharacterized protein LOC101211196 [Cucumis sativus] Back     alignment and taxonomy information
>gi|15234485|ref|NP_192961.1| C2H2 type zinc finger protein [Arabidopsis thaliana] gi|5281035|emb|CAB45971.1| hypothetical proteins [Arabidopsis thaliana] gi|7267925|emb|CAB78267.1| hypothetical proteins [Arabidopsis thaliana] gi|26452877|dbj|BAC43517.1| unknown protein [Arabidopsis thaliana] gi|28973009|gb|AAO63829.1| unknown protein [Arabidopsis thaliana] gi|332657707|gb|AEE83107.1| C2H2 type zinc finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297809527|ref|XP_002872647.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297318484|gb|EFH48906.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
TAIR|locus:2139119364 AT4G12240 "AT4G12240" [Arabido 0.954 0.519 0.485 6.4e-44
TAIR|locus:2173038396 AT5G52010 "AT5G52010" [Arabido 0.686 0.343 0.330 2.1e-11
TAIR|locus:2139119 AT4G12240 "AT4G12240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 463 (168.0 bits), Expect = 6.4e-44, P = 6.4e-44
 Identities = 99/204 (48%), Positives = 127/204 (62%)

Query:     1 SARG-KRVHWVGKYSIKMEKYKRAARAVLTPEVGNGLIGELKRGGLWVRTASDKPQATDV 59
             S++G +RV  V KYS+K+EKYKRAAR VLTP+ G GL  ELKR G WV+  SDKP A D 
Sbjct:   153 SSKGHRRVRLVAKYSMKIEKYKRAARNVLTPKEGYGLADELKRAGFWVKMVSDKPDAADK 212

Query:    60 LLRNHLV-ITHKRRIEYXXXXXXXXXXXXXXXEANLRCLKTVVVGDINDGALKRISYACF 118
              L+ HLV +  KR +E                EA  RCL+TVV+GD N+GALKR++   +
Sbjct:   213 ALKEHLVEVMDKREVECVVLVSDDSDFAGILWEAKERCLRTVVIGDSNEGALKRVADVAY 272

Query:   119 SWWDILMGKARKEAVSVVGKWKDGDVLKRLEWTYDPEVEKKA----------LDWDDGTE 168
             SW ++ MGKA+KE   VVGKWKD DVLK+LEWTYDP +EK+            D+DD  E
Sbjct:   273 SWKEVTMGKAKKEVEKVVGKWKDRDVLKKLEWTYDPALEKERGGSCGVWDYEFDYDDEIE 332

Query:   169 -GADVDDITLASDADF--IQKEDG 189
              G +V+ + +    D+  I  EDG
Sbjct:   333 NGTEVEPVEIGDGVDWWKIDTEDG 356
GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0005739 "mitochondrion" evidence=IDA
TAIR|locus:2173038 AT5G52010 "AT5G52010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_III000923
hypothetical protein (300 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
cd06167151 cd06167, LabA_like, LabA_like proteins 1e-04
>gnl|CDD|199895 cd06167, LabA_like, LabA_like proteins Back     alignment and domain information 
 Score = 40.5 bits (95), Expect = 1e-04
 Identities = 31/126 (24%), Positives = 50/126 (39%), Gaps = 9/126 (7%)

Query: 5   KRVHWVGKYSIKMEKYKRA--ARAVLTPEVGNGLIGELKRGGLWVRTASD-----KPQAT 57
             +  +  Y+       RA    A   P   +     L+R G  V          + +  
Sbjct: 27  ALLERLLSYADGRLVLARAYYNTARPDPSSPDRFQEALRRLGFEVIRVPRLRGKGEEKGV 86

Query: 58  DVLLRNHLV-ITHKRRIEYLVVVSDDSDFVEVLLEANLRCLKTVVVGDINDGALKRISYA 116
           DV L    + + ++RRI+ +V+VS DSDFV +L     R  + +VVG     A   +  A
Sbjct: 87  DVALALDALELAYERRIDTIVLVSGDSDFVPLLERLRERGKRVIVVGF-RRSASSALKNA 145

Query: 117 CFSWWD 122
              + D
Sbjct: 146 ADEFID 151

A well conserved group of domains found in all three kingdoms of life, with no defined function. LabA, a member from Synechococcus elongatus PCC 7942, has been shown to play a role in cyanobacterial circadian timing. It is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system. In particular, LabA seems necessary for KaiC-dependent repression of gene expression. Another member is the N-terminal domain of limkain b1, a human autoantigen associated with cytoplasmic vesicles. Curiously, a gene labeled NicB from Pseudomonas putida S16, which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls in the LabA_like family. LabA_like domains exhibit some similarity to the NYN domain, a distant relative of the PIN-domain nucleases. Length = 151

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
cd06167149 LabA_like LabA_like proteins. A well conserved gro 98.97
PF01936146 NYN: NYN domain; InterPro: IPR021139 This highly c 98.92
TIGR00288160 conserved hypothetical protein TIGR00288. This fam 98.34
COG1432181 Uncharacterized conserved protein [Function unknow 97.59
cd05013139 SIS_RpiR RpiR-like protein. RpiR contains a SIS (S 96.05
cd05014128 SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5 95.45
PRK15482285 transcriptional regulator MurR; Provisional 95.07
cd01542259 PBP1_TreR_like Ligand-binding domain of DNA transc 94.88
cd06281269 PBP1_LacI_like_5 Ligand-binding domain of uncharac 94.85
cd06282266 PBP1_GntR_like_2 Ligand-binding domain of putative 94.76
PF13407257 Peripla_BP_4: Periplasmic binding protein domain; 94.57
cd06318282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 94.42
cd06305273 PBP1_methylthioribose_binding_like Methylthioribos 94.32
cd01545270 PBP1_SalR Ligand-binding domain of DNA transcripti 94.31
cd06313272 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi 94.15
PF01380131 SIS: SIS domain SIS domain web page.; InterPro: IP 94.1
PRK11337292 DNA-binding transcriptional repressor RpiR; Provis 94.1
TIGR00441154 gmhA phosphoheptose isomerase. Involved in lipopol 94.06
TIGR02634 302 xylF D-xylose ABC transporter, substrate-binding p 93.71
cd06324 305 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b 93.62
cd06312271 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi 93.54
PRK15408 336 autoinducer 2-binding protein lsrB; Provisional 93.54
cd05008126 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repea 93.38
cd01540 289 PBP1_arabinose_binding Periplasmic L-arabinose-bin 93.1
cd06320275 PBP1_allose_binding Periplasmic allose-binding dom 93.05
cd01541273 PBP1_AraR Ligand-binding domain of DNA transcripti 93.03
cd06317275 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi 93.03
cd06306268 PBP1_TorT-like TorT-like proteins, a periplasmic b 93.02
cd06303280 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding prot 92.99
PRK11557278 putative DNA-binding transcriptional regulator; Pr 92.93
cd05005179 SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI 92.93
cd06295275 PBP1_CelR Ligand binding domain of a transcription 92.92
PRK13937188 phosphoheptose isomerase; Provisional 92.7
TIGR02637 302 RhaS rhamnose ABC transporter, rhamnose-binding pr 92.54
cd06299265 PBP1_LacI_like_13 Ligand-binding domain of DNA-bin 92.21
cd06315280 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-bi 92.04
cd06270268 PBP1_GalS_like Ligand binding domain of DNA transc 92.0
cd06308270 PBP1_sensor_kinase_like Periplasmic binding domain 91.95
PRK10653295 D-ribose transporter subunit RbsB; Provisional 91.91
cd06302 298 PBP1_LsrB_Quorum_Sensing Periplasmic binding domai 91.91
cd05710120 SIS_1 A subgroup of the SIS domain. SIS (Sugar ISo 91.85
cd01538 288 PBP1_ABC_xylose_binding Periplasmic xylose-binding 91.83
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a tr 91.81
cd06316 294 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-bi 91.69
TIGR03127179 RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of 91.62
cd06323268 PBP1_ribose_binding Periplasmic sugar-binding doma 91.55
cd01987124 USP_OKCHK USP domain is located between the N-term 91.38
PRK10014342 DNA-binding transcriptional repressor MalI; Provis 91.24
cd06309273 PBP1_YtfQ_like Periplasmic binding domain of ABC-t 91.15
PRK14101638 bifunctional glucokinase/RpiR family transcription 91.04
PRK10936 343 TMAO reductase system periplasmic protein TorT; Pr 90.97
cd06322267 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b 90.93
PRK11302284 DNA-binding transcriptional regulator HexR; Provis 90.92
cd06311274 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi 90.87
cd06296270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 90.86
cd05006177 SIS_GmhA Phosphoheptose isomerase is a member of t 90.86
cd06278266 PBP1_LacI_like_2 Ligand-binding domain of uncharac 90.72
cd06321271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b 90.53
cd06310273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi 90.48
cd06314271 PBP1_tmGBP Periplasmic sugar-binding domain of The 90.47
cd06319277 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b 90.46
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 90.38
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 90.33
cd06294270 PBP1_ycjW_transcription_regulator_like Ligand-bind 90.25
cd06292273 PBP1_LacI_like_10 Ligand-binding domain of unchara 90.14
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharac 90.0
cd06273268 PBP1_GntR_like_1 This group includes the ligand-bi 89.97
cd01539 303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 89.83
PF00532279 Peripla_BP_1: Periplasmic binding proteins and sug 89.7
cd06301272 PBP1_rhizopine_binding_like Periplasmic binding pr 89.65
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 89.56
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 89.55
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabo 89.53
cd06293269 PBP1_LacI_like_11 Ligand-binding domain of unchara 89.12
cd06342334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 89.11
PRK13936197 phosphoheptose isomerase; Provisional 89.03
PRK13938196 phosphoheptose isomerase; Provisional 88.78
PRK00414192 gmhA phosphoheptose isomerase; Reviewed 88.71
TIGR02955 295 TMAO_TorT TMAO reductase system periplasmic protei 88.6
cd06283267 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of 88.58
cd01536267 PBP1_ABC_sugar_binding_like Periplasmic sugar-bind 88.56
COG1737281 RpiR Transcriptional regulators [Transcription] 88.49
cd06291265 PBP1_Qymf_like Ligand binding domain of the lacI-l 88.43
PRK10355 330 xylF D-xylose transporter subunit XylF; Provisiona 88.24
cd06347334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 87.94
cd06274264 PBP1_FruR Ligand binding domain of DNA transcripti 87.76
PRK10892 326 D-arabinose 5-phosphate isomerase; Provisional 87.61
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 87.46
cd06297269 PBP1_LacI_like_12 Ligand-binding domain of unchara 87.25
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 87.16
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharac 86.88
PRK14987331 gluconate operon transcriptional regulator; Provis 86.85
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 86.69
cd04509299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 86.47
PRK11543 321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 86.37
PF04123 344 DUF373: Domain of unknown function (DUF373); Inter 86.08
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcripti 85.78
cd06271268 PBP1_AglR_RafR_like Ligand-binding domain of DNA t 85.61
PRK09701 311 D-allose transporter subunit; Provisional 85.24
cd06300272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi 85.16
cd06272261 PBP1_hexuronate_repressor_like Ligand-binding doma 85.0
PRK02947246 hypothetical protein; Provisional 84.52
PRK15395 330 methyl-galactoside ABC transporter galactose-bindi 84.41
cd06268298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 84.2
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 84.06
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 83.99
TIGR00522257 dph5 diphthine synthase. This protein participates 83.84
cd06330346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 83.47
cd01574264 PBP1_LacI Ligand-binding domain of DNA transcripti 83.15
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 83.12
cd06363410 PBP1_Taste_receptor Ligand-binding domain of the T 82.64
COG1609333 PurR Transcriptional regulators [Transcription] 82.36
cd06350348 PBP1_GPCR_family_C_like Ligand-binding domain of m 82.33
cd06279 283 PBP1_LacI_like_3 Ligand-binding domain of uncharac 82.32
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 82.16
cd06361403 PBP1_GPC6A_like Ligand-binding domain of the promi 82.15
cd06340347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 82.03
cd06336347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 81.68
cd06275269 PBP1_PurR Ligand-binding domain of purine represso 81.61
cd0479587 SIS SIS domain. SIS (Sugar ISomerase) domains are 81.15
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 80.7
cd06269298 PBP1_glutamate_receptors_like Family C G-protein c 80.64
cd06337357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 80.56
PRK05441299 murQ N-acetylmuramic acid-6-phosphate etherase; Re 80.24
>cd06167 LabA_like LabA_like proteins Back     alignment and domain information 
Probab=98.97  E-value=2.1e-09  Score=81.69  Aligned_cols=82  Identities=28%  Similarity=0.357  Sum_probs=70.9

Q ss_pred             CCchhHhhhcceEEEecCC-----CcchHHHHHHHHHH-HHhhcCccEEEEEeCCcchHHHHHHHHhcCCcEEEEccC--
Q 039912           34 NGLIGELKRGGLWVRTASD-----KPQATDVLLRNHLV-ITHKRRIEYLVVVSDDSDFVEVLLEANLRCLKTVVVGDI--  105 (198)
Q Consensus        34 yGLa~ELrRAGv~VrtVsd-----KPqAAD~ALkrhm~-~m~~~gv~clvLVSDdsdF~~~Lr~Ar~r~l~TVVVGd~--  105 (198)
                      -.+..+|++.||.|.+++.     .+.++|.+|.-.|. .+..++++++||||.|+||+++++.+|++|.+.+|+|-.  
T Consensus        55 ~~~~~~L~~~g~~~~~~~~~~~~~~~~~~D~~l~~d~~~~~~~~~~d~ivLvSgD~Df~~~i~~lr~~G~~V~v~~~~~~  134 (149)
T cd06167          55 RGFLDALRRLGFEPIQKPLRTRGSGKKGVDVALAIDALELAYKRRIDTIVLVSGDSDFVPLVERLRELGKRVIVVGFEAK  134 (149)
T ss_pred             HHHHHHHHHCCcEEEEEcceecCCcccCccHHHHHHHHHHhhhcCCCEEEEEECCccHHHHHHHHHHcCCEEEEEccCcc
Confidence            4567899999999998884     46799999998888 555668999999999999999999999999999999985  


Q ss_pred             CCccccchhc
Q 039912          106 NDGALKRISY  115 (198)
Q Consensus       106 ~~~~L~R~AD  115 (198)
                      ....|.+.||
T Consensus       135 ~s~~L~~~~d  144 (149)
T cd06167         135 TSRELRKAAD  144 (149)
T ss_pred             ChHHHHHhCC
Confidence            3367888887

A well conserved group of bacterial proteins with no defined function. LabA, a member from Synechococcus elongatus PCC 7942, has been shown to play a role in cyanobacterial circadian timing. It is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system. In particular, LabA seems necessary for KaiC-dependent repression of gene expression.
>PF01936 NYN: NYN domain; InterPro: IPR021139 This highly conserved domain has no known function Back     alignment and domain information
>TIGR00288 conserved hypothetical protein TIGR00288 Back     alignment and domain information
>COG1432 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05013 SIS_RpiR RpiR-like protein Back     alignment and domain information
>cd05014 SIS_Kpsf KpsF-like protein Back     alignment and domain information
>PRK15482 transcriptional regulator MurR; Provisional Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PF01380 SIS: SIS domain SIS domain web page Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>TIGR00441 gmhA phosphoheptose isomerase Back     alignment and domain information
>TIGR02634 xylF D-xylose ABC transporter, substrate-binding protein Back     alignment and domain information
>cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK15408 autoinducer 2-binding protein lsrB; Provisional Back     alignment and domain information
>cd05008 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria Back     alignment and domain information
>cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs Back     alignment and domain information
>PRK11557 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI) Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK13937 phosphoheptose isomerase; Provisional Back     alignment and domain information
>TIGR02637 RhaS rhamnose ABC transporter, rhamnose-binding protein Back     alignment and domain information
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia Back     alignment and domain information
>cd06315 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs Back     alignment and domain information
>cd05710 SIS_1 A subgroup of the SIS domain Back     alignment and domain information
>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems Back     alignment and domain information
>PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional Back     alignment and domain information
>PRK10936 TMAO reductase system periplasmic protein TorT; Provisional Back     alignment and domain information
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK11302 DNA-binding transcriptional regulator HexR; Provisional Back     alignment and domain information
>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>cd05006 SIS_GmhA Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily Back     alignment and domain information
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06314 PBP1_tmGBP Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs Back     alignment and domain information
>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors Back     alignment and domain information
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators Back     alignment and domain information
>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>PRK13936 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK13938 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK00414 gmhA phosphoheptose isomerase; Reviewed Back     alignment and domain information
>TIGR02955 TMAO_TorT TMAO reductase system periplasmic protein TorT Back     alignment and domain information
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR Back     alignment and domain information
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>COG1737 RpiR Transcriptional regulators [Transcription] Back     alignment and domain information
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs Back     alignment and domain information
>PRK10355 xylF D-xylose transporter subunit XylF; Provisional Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PF04123 DUF373: Domain of unknown function (DUF373); InterPro: IPR007254 This archaeal family of unknown function is predicted to be an integral membrane protein with six transmembrane regions Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK09701 D-allose transporter subunit; Provisional Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK02947 hypothetical protein; Provisional Back     alignment and domain information
>PRK15395 methyl-galactoside ABC transporter galactose-binding periplasmic protein MglB; Provisional Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>TIGR00522 dph5 diphthine synthase Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>cd04795 SIS SIS domain Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PRK05441 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
2qip_A165 Protein of unknown function VPA0982; APC85975, vib 98.73
3sho_A187 Transcriptional regulator, RPIR family; structural 94.62
3l6u_A 293 ABC-type sugar transport system periplasmic compo; 94.42
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 94.39
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 94.33
3h75_A 350 Periplasmic sugar-binding domain protein; protein 94.13
3o74_A272 Fructose transport system repressor FRUR; dual tra 93.98
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 93.44
3g1w_A 305 Sugar ABC transporter; sugar-binding protein, baci 93.42
2dri_A271 D-ribose-binding protein; sugar transport; HET: RI 93.39
3l49_A 291 ABC sugar (ribose) transporter, periplasmic substr 93.28
2fn9_A 290 Ribose ABC transporter, periplasmic ribose-bindin; 93.22
1tjy_A 316 Sugar transport protein; protein-ligand complex, s 93.21
3m9w_A 313 D-xylose-binding periplasmic protein; xylose bindi 93.11
2ioy_A283 Periplasmic sugar-binding protein; ribose binding 93.09
1gud_A 288 ALBP, D-allose-binding periplasmic protein; peripl 93.01
8abp_A 306 L-arabinose-binding protein; binding proteins; HET 92.81
3uug_A 330 Multiple sugar-binding periplasmic receptor CHVE; 92.65
1jx6_A 342 LUXP protein; protein-ligand complex, signaling pr 92.54
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 92.44
2vk2_A 306 YTFQ, ABC transporter periplasmic-binding protein 92.32
2rgy_A290 Transcriptional regulator, LACI family; 11011J, NY 92.1
1tk9_A188 Phosphoheptose isomerase 1; lipopolysaccharide bio 92.02
2fep_A289 Catabolite control protein A; CCPA, transcriptiona 92.0
2xbl_A198 Phosphoheptose isomerase; capsule; HET: M7P PGE PG 92.0
2fvy_A 309 D-galactose-binding periplasmic protein; periplasm 91.88
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 91.8
3k4h_A292 Putative transcriptional regulator; structural gen 91.7
3rot_A 297 ABC sugar transporter, periplasmic sugar binding; 91.36
3brs_A289 Periplasmic binding protein/LACI transcriptional; 91.35
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 91.27
2i2w_A212 Phosphoheptose isomerase; lipopolysaccharide biosy 91.14
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 91.1
3e3m_A 355 Transcriptional regulator, LACI family; structural 91.06
3hcw_A 295 Maltose operon transcriptional repressor; RNA-bind 91.05
1jeo_A180 MJ1247, hypothetical protein MJ1247; RUMP pathway, 91.0
2h3h_A 313 Sugar ABC transporter, periplasmic sugar-binding p 90.94
3egc_A 291 Putative ribose operon repressor; structural genom 90.87
3kjx_A344 Transcriptional regulator, LACI family; LACL famil 90.83
2xhz_A183 KDSD, YRBH, arabinose 5-phosphate isomerase; lipop 90.18
3h5o_A339 Transcriptional regulator GNTR; transcription regu 90.12
2iks_A293 DNA-binding transcriptional dual regulator; escher 90.08
3trj_A201 Phosphoheptose isomerase; lipopolysaccharide biosy 89.94
2yva_A196 DNAA initiator-associating protein DIAA; intermole 89.68
3gbv_A 304 Putative LACI-family transcriptional regulator; NY 89.61
3e61_A277 Putative transcriptional repressor of ribose OPER; 89.57
1x92_A199 APC5045, phosphoheptose isomerase; midwest centre 89.39
2rjo_A 332 Twin-arginine translocation pathway signal protei; 89.28
1m3s_A186 Hypothetical protein YCKF; structural genomics, PS 89.27
3kke_A 303 LACI family transcriptional regulator; structural 89.26
3d02_A 303 Putative LACI-type transcriptional regulator; peri 89.15
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 88.93
3bbl_A287 Regulatory protein of LACI family; protein structu 88.89
1vim_A200 Hypothetical protein AF1796; structural genomics, 88.78
3o1i_D 304 Periplasmic protein TORT; ligand free, two compone 88.51
3k9c_A289 Transcriptional regulator, LACI family protein; PS 88.49
3fxa_A201 SIS domain protein; structural genomics, joint cen 88.46
3c3k_A285 Alanine racemase; structural genomics, protein str 88.22
2x7x_A 325 Sensor protein; transferase, sensor histidine kina 88.09
3bil_A 348 Probable LACI-family transcriptional regulator; st 87.75
3qk7_A 294 Transcriptional regulators; structural genomics, N 87.61
3clk_A290 Transcription regulator; 11017J, PSI-II, NYSGXRC, 87.5
1dbq_A289 Purine repressor; transcription regulation, DNA-bi 86.99
3gv0_A288 Transcriptional regulator, LACI family; transcript 86.95
3etn_A220 Putative phosphosugar isomerase involved in capsu 86.74
2l82_A162 Designed protein OR32; structural genomics, northe 86.41
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 85.72
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 84.35
3mmz_A176 Putative HAD family hydrolase; structural genomics 84.32
2h0a_A276 TTHA0807, transcriptional regulator; repressor, st 83.88
3hs3_A277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 83.72
1pea_A385 Amidase operon; gene regulator, receptor, binding 83.43
3cvj_A243 Putative phosphoheptose isomerase; rossman fold, 3 83.41
2hqb_A 296 Transcriptional activator of COMK gene; berkeley s 83.37
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 82.81
2zj3_A 375 Glucosamine--fructose-6-phosphate aminotransferase 82.58
1nri_A306 Hypothetical protein HI0754; structural genomics, 82.09
2fqx_A 318 Membrane lipoprotein TMPC; ABC transport system, l 82.01
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 81.5
3miz_A 301 Putative transcriptional regulator protein, LACI f 81.43
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 81.38
1j5x_A 342 Glucosamine-6-phosphate deaminase; structural geno 81.22
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 80.94
3g68_A 352 Putative phosphosugar isomerase; SIS domain, doubl 80.67
2a3n_A 355 Putative glucosamine-fructose-6-phosphate aminotr; 80.54
2aml_A 373 SIS domain protein; 46906266, LMO0035 protein, str 80.41
>2qip_A Protein of unknown function VPA0982; APC85975, vibrio parahaemolyticus RIMD 2210633, STR genomics, PSI-2, protein structure initiative; 1.48A {Vibrio parahaemolyticus} Back     alignment and structure
Probab=98.73  E-value=1.8e-08  Score=78.67  Aligned_cols=87  Identities=18%  Similarity=0.089  Sum_probs=70.6

Q ss_pred             chhHhhhcceEEEecCCC-------cchHHHHHHHHHHHHhhcCccEEEEEeCCcchHHHHHHHHhc-CCcEEEEccC--
Q 039912           36 LIGELKRGGLWVRTASDK-------PQATDVLLRNHLVITHKRRIEYLVVVSDDSDFVEVLLEANLR-CLKTVVVGDI--  105 (198)
Q Consensus        36 La~ELrRAGv~VrtVsdK-------PqAAD~ALkrhm~~m~~~gv~clvLVSDdsdF~~~Lr~Ar~r-~l~TVVVGd~--  105 (198)
                      +-..|++.||.|++.+-+       -.+.|.+|-=.++.+. ..++++||||-|+||+++++.+|++ |.+.+|+|=.  
T Consensus        66 ~~~~L~~~g~~v~~~p~~~~~~~~~k~~~Dv~laiD~~~~a-~~~d~~vLvSgD~DF~plv~~lr~~~G~~V~v~g~~~~  144 (165)
T 2qip_A           66 FHHILRGVGFEVMLKPYIQRRDGSAKGDWDVGITLDAIEIA-PDVDRVILVSGDGDFSLLVERIQQRYNKKVTVYGVPRL  144 (165)
T ss_dssp             HHHHHHHHTCEEEECCCCCCSSCCCSCCCHHHHHHHHHHHG-GGCSEEEEECCCGGGHHHHHHHHHHHCCEEEEEECGGG
T ss_pred             HHHHHHHCCcEEEEEeeeeccCCccCCCccHHHHHHHHHhh-ccCCEEEEEECChhHHHHHHHHHHHcCcEEEEEeCCCc
Confidence            346788999998864321       2499999988888664 6899999999999999999999997 9999999942  


Q ss_pred             CCccccchhcccccHHHH
Q 039912          106 NDGALKRISYACFSWWDI  123 (198)
Q Consensus       106 ~~~~L~R~AD~~fsW~eV  123 (198)
                      ....|.+.||-++..+++
T Consensus       145 ~s~~L~~~ad~fi~l~~~  162 (165)
T 2qip_A          145 TSQTLIDCADNFVAIDDD  162 (165)
T ss_dssp             SCHHHHHHSSEEEECSGG
T ss_pred             ChHHHHHhCCEEEecchh
Confidence            236799999988877654
>3sho_A Transcriptional regulator, RPIR family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.80A {Sphaerobacter thermophilus} Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A* Back     alignment and structure
>8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} SCOP: c.93.1.1 PDB: 7abp_A* 6abp_A* 1abe_A* 1abf_A* 5abp_A* 1bap_A* 1apb_A* 9abp_A* 2wrz_A Back     alignment and structure
>3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>1tk9_A Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} SCOP: c.80.1.3 Back     alignment and structure
>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>2xbl_A Phosphoheptose isomerase; capsule; HET: M7P PGE PG4; 1.62A {Burkholderia pseudomallei} PDB: 2x3y_A Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>2i2w_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1jeo_A MJ1247, hypothetical protein MJ1247; RUMP pathway, phosphosugar, 3-hexulose-6-phosphate isomerase structural genomics; HET: CME CIT; 2.00A {Methanocaldococcus jannaschii} SCOP: c.80.1.3 Back     alignment and structure
>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>2xhz_A KDSD, YRBH, arabinose 5-phosphate isomerase; lipopolysaccharide biogenesis; 2.60A {Escherichia coli} Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>3trj_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 2.80A {Francisella tularensis subsp} Back     alignment and structure
>2yva_A DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar BIND protein, DNAA binding protein; 1.85A {Escherichia coli} Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1x92_A APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} SCOP: c.80.1.3 PDB: 3bjz_A Back     alignment and structure
>2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} Back     alignment and structure
>1m3s_A Hypothetical protein YCKF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} SCOP: c.80.1.3 PDB: 1viv_A Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>1vim_A Hypothetical protein AF1796; structural genomics, unknown function; 1.36A {Archaeoglobus fulgidus} SCOP: c.80.1.3 Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>3fxa_A SIS domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Listeria monocytogenes str} Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3etn_A Putative phosphosugar isomerase involved in capsu formation; YP_209877.1; HET: MSE CMK; 1.70A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3cvj_A Putative phosphoheptose isomerase; rossman fold, 3-layer (ABA) sandwich, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.00A {Bacillus halodurans c-125} Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>2zj3_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1; glucosamine-6-phosphate synthase, aldose/ketose isomerase, rossmann-like fold; HET: G6P; 1.90A {Homo sapiens} PDB: 2zj4_A* 2v4m_A* Back     alignment and structure
>1nri_A Hypothetical protein HI0754; structural genomics, haemophilus influ PSI, protein structure initiative, midwest center for struc genomics; 1.90A {Haemophilus influenzae} SCOP: c.80.1.3 Back     alignment and structure
>2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>1j5x_A Glucosamine-6-phosphate deaminase; structural genomics, TM0813, glucosamine-6-phosphate deamina PSI, protein structure initiative; 1.80A {Thermotoga maritima} SCOP: c.80.1.1 Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3g68_A Putative phosphosugar isomerase; SIS domain, double-SIS DOMA protein, structural genomics, joint center for structural G JCSG; HET: MSE CIT; 1.80A {Clostridium difficile} Back     alignment and structure
>2a3n_A Putative glucosamine-fructose-6-phosphate aminotr; structural genomics, joint center for structural genomics; HET: MSE; 1.23A {Salmonella typhimurium} Back     alignment and structure
>2aml_A SIS domain protein; 46906266, LMO0035 protein, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d2dria_271 D-ribose-binding protein {Escherichia coli, strain 94.68
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 93.24
d1tjya_ 316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 92.84
d1dbqa_282 Purine repressor (PurR), C-terminal domain {Escher 92.6
d2fvya1 305 Galactose/glucose-binding protein {Escherichia col 91.49
d1guda_ 288 D-allose-binding protein {Escherichia coli [TaxId: 90.96
d8abpa_ 305 L-arabinose-binding protein {Escherichia coli [Tax 90.66
d1x94a_191 Phosphoheptose isomerase GmhA1 {Vibrio cholerae [T 89.71
d1vima_192 Hypothetical protein AF1796 {Archaeon Archaeoglobu 89.63
d1m3sa_186 Hypothetical protein YckF {Bacillus subtilis [TaxI 89.4
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 87.36
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 83.77
d1tk9a_188 Phosphoheptose isomerase GmhA1 {Campylobacter jeju 83.35
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 82.23
d1jeoa_177 Probable 3-hexulose-6-phosphate isomerase MJ1247 { 81.72
d1byka_255 Trehalose repressor, C-terminal domain {Escherichi 80.39
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: D-ribose-binding protein
species: Escherichia coli, strain k-12 [TaxId: 562]

Probab=94.68  E-value=0.046  Score=39.87  Aligned_cols=69  Identities=10%  Similarity=0.068  Sum_probs=53.1

Q ss_pred             CCchhHhhhcceEEEecCCCcchHHHHH-HHHHHHHhhcCccEEEEEeC-CcchHHHHHHHHhcCCcEEEEccC
Q 039912           34 NGLIGELKRGGLWVRTASDKPQATDVLL-RNHLVITHKRRIEYLVVVSD-DSDFVEVLLEANLRCLKTVVVGDI  105 (198)
Q Consensus        34 yGLa~ELrRAGv~VrtVsdKPqAAD~AL-krhm~~m~~~gv~clvLVSD-dsdF~~~Lr~Ar~r~l~TVVVGd~  105 (198)
                      .|+-.++++.|+.+.+....   .|.+. .+.+..+..+|++.|++..- ...+.+.++.+++.++..|+++..
T Consensus        21 ~gi~~~a~~~g~~~~i~~~~---~~~~~~~~~i~~~~~~~~d~ii~~~~~~~~~~~~~~~~~~~~ipvV~~~~~   91 (271)
T d2dria_          21 DGAQKEADKLGYNLVVLDSQ---NNPAKELANVQDLTVRGTKILLINPTDSDAVGNAVKMANQANIPVITLDRQ   91 (271)
T ss_dssp             HHHHHHHHHHTCEEEEEECT---TCHHHHHHHHHHHTTTTEEEEEECCSSTTTTHHHHHHHHHTTCCEEEESSC
T ss_pred             HHHHHHHHHcCCEEEEEeCC---CCHHHHHHHHHHHHhcCCcccccccccccchHHHHHHHhhcceeEEEeccc
Confidence            37888999999999765432   23333 44455888999999999875 466789999999999999999864
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vima_ c.80.1.3 (A:) Hypothetical protein AF1796 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m3sa_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tk9a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jeoa_ c.80.1.3 (A:) Probable 3-hexulose-6-phosphate isomerase MJ1247 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure