Citrus Sinensis ID: 040033
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 158 | ||||||
| 357130210 | 635 | PREDICTED: uncharacterized protein LOC10 | 0.930 | 0.231 | 0.333 | 9e-15 | |
| 242085414 | 1462 | hypothetical protein SORBIDRAFT_08g01083 | 0.892 | 0.096 | 0.309 | 3e-14 | |
| 218197921 | 402 | hypothetical protein OsI_22431 [Oryza sa | 0.886 | 0.348 | 0.329 | 3e-13 | |
| 147774273 | 1469 | hypothetical protein VITISV_026680 [Viti | 0.936 | 0.100 | 0.289 | 4e-12 | |
| 18425247 | 848 | Putative polyprotein [Oryza sativa] gi|3 | 0.905 | 0.168 | 0.329 | 5e-12 | |
| 242065034 | 1414 | hypothetical protein SORBIDRAFT_04g01807 | 0.886 | 0.099 | 0.271 | 5e-12 | |
| 147843077 | 1366 | hypothetical protein VITISV_044100 [Viti | 0.936 | 0.108 | 0.289 | 7e-12 | |
| 147789424 | 2822 | hypothetical protein VITISV_017554 [Viti | 0.911 | 0.051 | 0.295 | 8e-12 | |
| 116309032 | 1448 | OSIGBa0114M03.4 [Oryza sativa Indica Gro | 0.898 | 0.098 | 0.300 | 9e-11 | |
| 356529593 | 572 | PREDICTED: uncharacterized protein LOC10 | 0.905 | 0.25 | 0.289 | 6e-10 |
| >gi|357130210|ref|XP_003566743.1| PREDICTED: uncharacterized protein LOC100838891 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Score = 85.1 bits (209), Expect = 9e-15, Method: Compositional matrix adjust.
Identities = 57/171 (33%), Positives = 84/171 (49%), Gaps = 24/171 (14%)
Query: 10 RNSSIPVRGLSRAELQERRAKVCATIATKSFPRDIGERSCFFMEACVKVEDGDVIMEVDE 69
R ++ + L+ AE++ER+AK + F R + F++E K E+ D+ + +
Sbjct: 128 RGATPVFKKLNAAEMEERQAKGLCFNCDEKFVRGHRCKCLFYIEVADKEEEEDLQISLLA 187
Query: 70 NAGVRASETLRINGRIGNISPIVLVDSGSTHNFISDTFAKKVKNFIVN------LILQGV 123
GVR S+T+++ +G + L+DSGSTHNFIS+ A V I G
Sbjct: 188 ITGVRTSDTMQLVVWVGERELLALIDSGSTHNFISEELAAHVSAPFCTGRRLRVTIANGD 247
Query: 124 YV------------------IVDFNLRELEGYDVVLGTQWLRTLEPILWDF 156
+V +VD L G+DVVLGT WL+TL PILWDF
Sbjct: 248 HVTCSGLLRHTAIAIGQESFVVDLYAIPLGGFDVVLGTHWLKTLGPILWDF 298
|
Source: Brachypodium distachyon Species: Brachypodium distachyon Genus: Brachypodium Family: Poaceae Order: Poales Class: Liliopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|242085414|ref|XP_002443132.1| hypothetical protein SORBIDRAFT_08g010830 [Sorghum bicolor] gi|241943825|gb|EES16970.1| hypothetical protein SORBIDRAFT_08g010830 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|218197921|gb|EEC80348.1| hypothetical protein OsI_22431 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|147774273|emb|CAN76793.1| hypothetical protein VITISV_026680 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|18425247|gb|AAL69425.1|AC098565_7 Putative polyprotein [Oryza sativa] gi|31430198|gb|AAP52144.1| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|242065034|ref|XP_002453806.1| hypothetical protein SORBIDRAFT_04g018075 [Sorghum bicolor] gi|241933637|gb|EES06782.1| hypothetical protein SORBIDRAFT_04g018075 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|147843077|emb|CAN83300.1| hypothetical protein VITISV_044100 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147789424|emb|CAN66607.1| hypothetical protein VITISV_017554 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|116309032|emb|CAH66146.1| OSIGBa0114M03.4 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|356529593|ref|XP_003533374.1| PREDICTED: uncharacterized protein LOC100812827 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
No hits with e-value below 0.001 by BLAST
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 158 | |||
| cd00303 | 92 | cd00303, retropepsin_like, Retropepsins; pepsin-li | 4e-10 | |
| pfam08284 | 135 | pfam08284, RVP_2, Retroviral aspartyl protease | 6e-05 | |
| pfam13975 | 72 | pfam13975, gag-asp_proteas, gag-polyprotein putati | 2e-04 |
| >gnl|CDD|133136 cd00303, retropepsin_like, Retropepsins; pepsin-like aspartate proteases | Back alignment and domain information |
|---|
Score = 53.1 bits (128), Expect = 4e-10
Identities = 29/92 (31%), Positives = 41/92 (44%), Gaps = 25/92 (27%)
Query: 81 INGRIGNISPIVLVDSGSTHNFISDTFAKK-------------VKNF------------I 115
+ G+I + LVDSG++ NFIS++ AKK VK
Sbjct: 1 LKGKINGVPVRALVDSGASVNFISESLAKKLGLPPRLLPTPLKVKGANGSSVKTLGVILP 60
Query: 116 VNLILQGVYVIVDFNLRELEGYDVVLGTQWLR 147
V + + G VDF + +L YDV+LG WL
Sbjct: 61 VTIGIGGKTFTVDFYVLDLLSYDVILGRPWLE 92
|
The family includes pepsin-like aspartate proteases from retroviruses, retrotransposons and retroelements, as well as eukaryotic dna-damage-inducible proteins (DDIs), and bacterial aspartate peptidases. While fungal and mammalian pepsins are bilobal proteins with structurally related N and C-terminals, retropepsins are half as long as their fungal and mammalian counterparts. The monomers are structurally related to one lobe of the pepsin molecule and retropepsins function as homodimers. The active site aspartate occurs within a motif (Asp-Thr/Ser-Gly), as it does in pepsin. Retroviral aspartyl protease is synthesized as part of the POL polyprotein that contains an aspartyl protease, a reverse transcriptase, RNase H, and an integrase. The POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. In aspartate peptidases, Asp residues are ligands of an activated water molecule in all examples where catalytic residues have been identified. This group of aspartate peptidases is classified by MEROPS as the peptidase family A2 (retropepsin family, clan AA), subfamily A2A. Length = 92 |
| >gnl|CDD|116868 pfam08284, RVP_2, Retroviral aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|206145 pfam13975, gag-asp_proteas, gag-polyprotein putative aspartyl protease | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| PF08284 | 135 | RVP_2: Retroviral aspartyl protease; InterPro: IPR | 99.93 | |
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 99.86 | |
| cd05484 | 91 | retropepsin_like_LTR_2 Retropepsins_like_LTR, peps | 99.64 | |
| PF09668 | 124 | Asp_protease: Aspartyl protease; InterPro: IPR0191 | 99.64 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 99.52 | |
| PF13650 | 90 | Asp_protease_2: Aspartyl protease | 99.48 | |
| PF00077 | 100 | RVP: Retroviral aspartyl protease The Prosite entr | 99.45 | |
| cd05480 | 103 | NRIP_C NRIP_C; putative nuclear receptor interacti | 99.45 | |
| cd05483 | 96 | retropepsin_like_bacteria Bacterial aspartate prot | 99.41 | |
| PF12384 | 177 | Peptidase_A2B: Ty3 transposon peptidase; InterPro: | 99.28 | |
| TIGR03698 | 107 | clan_AA_DTGF clan AA aspartic protease, AF_0612 fa | 99.28 | |
| cd06095 | 86 | RP_RTVL_H_like Retropepsin of the RTVL_H family of | 99.24 | |
| cd00303 | 92 | retropepsin_like Retropepsins; pepsin-like asparta | 99.18 | |
| KOG0012 | 380 | consensus DNA damage inducible protein [Replicatio | 99.11 | |
| PF13975 | 72 | gag-asp_proteas: gag-polyprotein putative aspartyl | 99.0 | |
| COG3577 | 215 | Predicted aspartyl protease [General function pred | 98.88 | |
| PF02160 | 201 | Peptidase_A3: Cauliflower mosaic virus peptidase ( | 98.6 | |
| cd05481 | 93 | retropepsin_like_LTR_1 Retropepsins_like_LTR; peps | 98.41 | |
| cd06094 | 89 | RP_Saci_like RP_Saci_like, retropepsin family. Ret | 98.23 | |
| PF00098 | 18 | zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi | 98.18 | |
| PF05585 | 164 | DUF1758: Putative peptidase (DUF1758); InterPro: I | 98.16 | |
| COG5550 | 125 | Predicted aspartyl protease [Posttranslational mod | 98.1 | |
| cd05482 | 87 | HIV_retropepsin_like Retropepsins, pepsin-like asp | 97.87 | |
| PF13696 | 32 | zf-CCHC_2: Zinc knuckle | 96.66 | |
| smart00343 | 26 | ZnF_C2HC zinc finger. | 95.88 | |
| PF13917 | 42 | zf-CCHC_3: Zinc knuckle | 95.67 | |
| PF12382 | 137 | Peptidase_A2E: Retrotransposon peptidase; InterPro | 95.21 | |
| PF14787 | 36 | zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: | 95.08 | |
| COG5082 | 190 | AIR1 Arginine methyltransferase-interacting protei | 94.71 | |
| PF05618 | 138 | Zn_protease: Putative ATP-dependant zinc protease; | 94.21 | |
| COG5082 | 190 | AIR1 Arginine methyltransferase-interacting protei | 93.89 | |
| PF14392 | 49 | zf-CCHC_4: Zinc knuckle | 93.23 | |
| COG4067 | 162 | Uncharacterized protein conserved in archaea [Post | 93.12 | |
| PTZ00368 | 148 | universal minicircle sequence binding protein (UMS | 91.21 | |
| KOG4400 | 261 | consensus E3 ubiquitin ligase interacting with arg | 90.86 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 90.13 | |
| cd05476 | 265 | pepsin_A_like_plant Chroloplast Nucleoids DNA-bind | 89.34 | |
| cd05477 | 318 | gastricsin Gastricsins, asparate proteases produce | 89.22 | |
| PTZ00368 | 148 | universal minicircle sequence binding protein (UMS | 88.93 | |
| PTZ00013 | 450 | plasmepsin 4 (PM4); Provisional | 87.34 | |
| cd05470 | 109 | pepsin_retropepsin_like Cellular and retroviral pe | 86.83 | |
| cd05478 | 317 | pepsin_A Pepsin A, aspartic protease produced in g | 86.08 | |
| PTZ00147 | 453 | plasmepsin-1; Provisional | 85.75 | |
| PF15288 | 40 | zf-CCHC_6: Zinc knuckle | 85.34 | |
| cd06096 | 326 | Plasmepsin_5 Plasmepsins are a class of aspartic p | 84.62 | |
| cd05474 | 295 | SAP_like SAPs, pepsin-like proteinases secreted fr | 84.25 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 81.4 |
| >PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.4e-25 Score=163.35 Aligned_cols=84 Identities=40% Similarity=0.676 Sum_probs=79.0
Q ss_pred ccCceEEEEEEECCEeeEEEecCCCceeEECHHHHHHcCCeE------------------------EEEEECCEEEEEEE
Q 040033 74 RASETLRINGRIGNISPIVLVDSGSTHNFISDTFAKKVKNFI------------------------VNLILQGVYVIVDF 129 (158)
Q Consensus 74 ~~~~~i~~~~~i~~~~v~aLiDSGat~sfI~~~~a~~~~~~~------------------------A~i~i~g~~~~~~~ 129 (158)
..++.|...+.|+++++.+|||||||||||++++|++++++. .++.++|++|..+|
T Consensus 17 ~~~~vi~g~~~I~~~~~~vLiDSGAThsFIs~~~a~~~~l~~~~l~~~~~V~~~g~~~~~~~~~~~~~~~i~g~~~~~dl 96 (135)
T PF08284_consen 17 ESPDVITGTFLINSIPASVLIDSGATHSFISSSFAKKLGLPLEPLPRPIVVSAPGGSINCEGVCPDVPLSIQGHEFVVDL 96 (135)
T ss_pred CCCCeEEEEEEeccEEEEEEEecCCCcEEccHHHHHhcCCEEEEccCeeEEecccccccccceeeeEEEEECCeEEEeee
Confidence 457889999999999999999999999999999999999887 18899999999999
Q ss_pred EEecCCCCcEEechhHhhhcCCceeeecC
Q 040033 130 NLRELEGYDVVLGTQWLRTLEPILWDFAS 158 (158)
Q Consensus 130 ~v~~~~~~dvILG~dwL~~~~~i~idw~~ 158 (158)
.|+++.++|||||||||.+|+| .|||.+
T Consensus 97 ~vl~l~~~DvILGm~WL~~~~~-~IDw~~ 124 (135)
T PF08284_consen 97 LVLDLGGYDVILGMDWLKKHNP-VIDWAT 124 (135)
T ss_pred EEecccceeeEeccchHHhCCC-EEEccC
Confidence 9999999999999999999999 899974
|
These proteases are generally part of a larger polyprotein; usually pol, more rarely gag. Retroviral proteases appear to be homologous to a single domain of the two-domain eukaryotic aspartyl proteases. |
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >PF09668 Asp_protease: Aspartyl protease; InterPro: IPR019103 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >PF13650 Asp_protease_2: Aspartyl protease | Back alignment and domain information |
|---|
| >PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein | Back alignment and domain information |
|---|
| >cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family | Back alignment and domain information |
|---|
| >PF12384 Peptidase_A2B: Ty3 transposon peptidase; InterPro: IPR024650 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family | Back alignment and domain information |
|---|
| >cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements | Back alignment and domain information |
|---|
| >cd00303 retropepsin_like Retropepsins; pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >KOG0012 consensus DNA damage inducible protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease | Back alignment and domain information |
|---|
| >COG3577 Predicted aspartyl protease [General function prediction only] | Back alignment and domain information |
|---|
| >PF02160 Peptidase_A3: Cauliflower mosaic virus peptidase (A3); InterPro: IPR000588 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd05481 retropepsin_like_LTR_1 Retropepsins_like_LTR; pepsin-like aspartate protease from retrotransposons with long terminal repeats | Back alignment and domain information |
|---|
| >cd06094 RP_Saci_like RP_Saci_like, retropepsin family | Back alignment and domain information |
|---|
| >PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05585 DUF1758: Putative peptidase (DUF1758); InterPro: IPR008737 This is a family of nematode proteins of unknown function [] | Back alignment and domain information |
|---|
| >COG5550 Predicted aspartyl protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd05482 HIV_retropepsin_like Retropepsins, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >PF13696 zf-CCHC_2: Zinc knuckle | Back alignment and domain information |
|---|
| >smart00343 ZnF_C2HC zinc finger | Back alignment and domain information |
|---|
| >PF13917 zf-CCHC_3: Zinc knuckle | Back alignment and domain information |
|---|
| >PF12382 Peptidase_A2E: Retrotransposon peptidase; InterPro: IPR024648 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A | Back alignment and domain information |
|---|
| >COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF05618 Zn_protease: Putative ATP-dependant zinc protease; InterPro: IPR008503 This family consists of several hypothetical proteins from different archaeal and bacterial species | Back alignment and domain information |
|---|
| >COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF14392 zf-CCHC_4: Zinc knuckle | Back alignment and domain information |
|---|
| >COG4067 Uncharacterized protein conserved in archaea [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >PTZ00013 plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >PTZ00147 plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >PF15288 zf-CCHC_6: Zinc knuckle | Back alignment and domain information |
|---|
| >cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 158 | |||
| 3s8i_A | 148 | Protein DDI1 homolog 1; protease, structural genom | 9e-06 |
| >3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
Score = 42.0 bits (98), Expect = 9e-06
Identities = 17/99 (17%), Positives = 37/99 (37%), Gaps = 24/99 (24%)
Query: 79 LRINGRIGNISPIVLVDSGSTHNFISDTFAKKV-------KNFI---------------- 115
L IN ++ VDSG+ +S A++ + +
Sbjct: 25 LYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVH 84
Query: 116 -VNLILQGVYVIVDFNLRELEGYDVVLGTQWLRTLEPIL 153
+ ++G ++ F++ E + D++LG LR + +
Sbjct: 85 LAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSI 123
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| 3s8i_A | 148 | Protein DDI1 homolog 1; protease, structural genom | 99.81 | |
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 99.72 | |
| 3slz_A | 132 | GAG-Pro-POL polyprotein; beta sheet and dimer, pro | 98.75 | |
| 1fmb_A | 104 | EIAV protease; hydrolase (acid proteinase), RNA-di | 98.7 | |
| 3ec0_A | 99 | Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 | 98.45 | |
| 2hs1_A | 99 | HIV-1 protease; ultra-high resolution active site | 98.39 | |
| 3ka2_A | 203 | [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro | 98.15 | |
| 1nc8_A | 29 | Nucleocapsid protein; HIV-2, RNA recognition, zinc | 98.02 | |
| 1a6b_B | 40 | Momulv, zinc finger protein NCP10; nucleocapsid pr | 97.95 | |
| 2hah_A | 116 | Protease, retropepsin; retroviral, aspartyl, hydro | 97.95 | |
| 1dsq_A | 26 | Nucleic acid binding protein P14; CCHC type zinc f | 97.94 | |
| 1u6p_A | 56 | GAG polyprotein; MLV, A-minor K-turn, stem loop, b | 97.73 | |
| 3ka2_A | 203 | [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro | 97.53 | |
| 3sqf_A | 114 | Protease; folded monomer, retropepsin, D-type retr | 97.22 | |
| 2ysa_A | 55 | Retinoblastoma-binding protein 6; zinc finger, CCH | 97.2 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 97.02 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 97.0 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 96.94 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 96.92 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 96.87 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 96.86 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 96.74 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 96.74 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 96.68 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 96.64 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 96.64 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 96.63 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 96.61 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 96.51 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 96.5 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 96.39 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 96.09 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 95.43 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 95.27 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 94.97 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 94.92 | |
| 2rsp_A | 124 | RSV protease; hydrolase(aspartyl proteinase); 2.00 | 94.14 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 93.86 | |
| 3liy_A | 116 | Protease; hydrolase, hydrolase-hydrolase inhibitor | 93.14 | |
| 2pma_A | 146 | Uncharacterized protein; APC86035.2, protein LPG00 | 92.89 | |
| 2jys_A | 107 | Protease/reverse transcriptase; retroviral proteas | 91.36 | |
| 1lya_A | 97 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 89.21 |
| >3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.81 E-value=1.8e-19 Score=132.02 Aligned_cols=82 Identities=22% Similarity=0.344 Sum_probs=75.7
Q ss_pred CceEEEEEEECCEeeEEEecCCCceeEECHHHHHHcCCeE------------------------EEEEECCEEEEEEEEE
Q 040033 76 SETLRINGRIGNISPIVLVDSGSTHNFISDTFAKKVKNFI------------------------VNLILQGVYVIVDFNL 131 (158)
Q Consensus 76 ~~~i~~~~~i~~~~v~aLiDSGat~sfI~~~~a~~~~~~~------------------------A~i~i~g~~~~~~~~v 131 (158)
...+.+.+.|||+++++||||||+++||+.++|+++|+.. +++++++..+.++|.|
T Consensus 22 ~~~l~v~~~Ing~~v~~LVDTGAs~s~Is~~~A~rlGL~~~~~~~~~~~a~g~G~~~~~g~v~~~~I~Ig~~~~~~~~~V 101 (148)
T 3s8i_A 22 VTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSI 101 (148)
T ss_dssp CCCCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHTTCGGGEEGGGCEECCC---CEEEEEEEEEEEEETTEEEEEEEEE
T ss_pred cCEEEEEEEECCEEEEEEEeCCCCcEeeCHHHHHHcCCccccCcceeEEEEcCCccEEEEEEEEEEEEECCEEEEEEEEE
Confidence 5678899999999999999999999999999999999852 2789999999999999
Q ss_pred ecCCCCcEEechhHhhhcCCceeeecC
Q 040033 132 RELEGYDVVLGTQWLRTLEPILWDFAS 158 (158)
Q Consensus 132 ~~~~~~dvILG~dwL~~~~~i~idw~~ 158 (158)
++...+|+|||||||++++. .|||++
T Consensus 102 le~~~~d~LLGmD~L~~~~~-~ID~~~ 127 (148)
T 3s8i_A 102 LEDQPMDMLLGLDMLRRHQC-SIDLKK 127 (148)
T ss_dssp ETTCSSSEEECHHHHHHTTC-EEETTT
T ss_pred eCCCCcCeeccHHHHHhCCE-EEEcCC
Confidence 99999999999999999997 899974
|
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3slz_A GAG-Pro-POL polyprotein; beta sheet and dimer, protease, peptide inhibitor, TL-3 PEPS virus, hydrolase-hydrolase inhibitor complex; HET: 3TL; 1.40A {Dg-75 murine leukemia virus} PDB: 3nr6_A* 3sm1_A* 3sm2_A* 4exh_A* | Back alignment and structure |
|---|
| >1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* | Back alignment and structure |
|---|
| >3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... | Back alignment and structure |
|---|
| >2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... | Back alignment and structure |
|---|
| >3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... | Back alignment and structure |
|---|
| >1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A | Back alignment and structure |
|---|
| >1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2hah_A Protease, retropepsin; retroviral, aspartyl, hydrolase-hydrolase complex; HET: 3TL; 1.70A {Feline immunodeficiency virus} PDB: 3ogp_A* 3ogq_A* 2fiv_A* 6fiv_A* 3fiv_A* 5fiv_A* 4fiv_A* 1fiv_A* 1b11_A* | Back alignment and structure |
|---|
| >1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A | Back alignment and structure |
|---|
| >3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... | Back alignment and structure |
|---|
| >3sqf_A Protease; folded monomer, retropepsin, D-type retrovirus; 1.63A {Mason-pfizer monkey virus} SCOP: b.50.1.1 PDB: 1nso_A | Back alignment and structure |
|---|
| >2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2rsp_A RSV protease; hydrolase(aspartyl proteinase); 2.00A {Rous sarcoma virus} SCOP: b.50.1.1 PDB: 1mvp_A 1bai_A* | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3liy_A Protease; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.86A {Human t-lymphotropic virus 1} PDB: 2b7f_A* 3liq_A* 3lit_A* 3liv_A* 3lix_A* 3lin_A* | Back alignment and structure |
|---|
| >2pma_A Uncharacterized protein; APC86035.2, protein LPG0085, DUF785, legionella pneumophila pneumophila STR. philadelphia 1; 1.89A {Legionella pneumophila subsp} SCOP: b.50.1.3 | Back alignment and structure |
|---|
| >2jys_A Protease/reverse transcriptase; retroviral protease, hydrolase; NMR {Simian foamy virus type 1} | Back alignment and structure |
|---|
| >1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| d2fmba_ | 104 | EIAV protease {Equine infectious anemia virus [Tax | 98.82 | |
| d4fiva_ | 113 | Feline immunodeficiency virus (FIV) protease {Feli | 98.1 | |
| d1nc8a_ | 29 | HIV nucleocapsid {Human immunodeficiency virus typ | 97.96 | |
| d2nmza1 | 99 | Human immunodeficiency virus type 1 protease {Huma | 97.72 | |
| d1nsoa_ | 107 | Mason-Pfizer monkey virus protease {Simian retrovi | 97.72 | |
| d1hvca_ | 203 | Human immunodeficiency virus type 1 protease {Huma | 97.66 | |
| d1dsqa_ | 26 | Nucleic acid binding protein p14 {Mouse mammary tu | 97.33 | |
| d3ecga1 | 99 | Human immunodeficiency virus type 2 (HIV-2) protea | 97.31 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 97.04 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 96.93 | |
| d1a6bb_ | 40 | Zinc finger protein ncp10 {Moloney murine leukemia | 96.74 | |
| d2pmaa1 | 141 | Uncharacterized protein LPG0085 {Legionella pneumo | 96.65 | |
| d1hvca_ | 203 | Human immunodeficiency virus type 1 protease {Huma | 95.81 | |
| d2rspa_ | 124 | Rous sarcoma virus protease {Rous sarcoma virus, s | 93.29 | |
| d1izea_ | 323 | Acid protease {Fungus (Aspergillus oryzae) [TaxId: | 91.34 | |
| d1wkra_ | 340 | Acid protease {Irpex lacteus (Polyporus tulipifera | 91.14 | |
| d1cl4a_ | 32 | Nucleocapsid protein from mason-pfizer monkey viru | 91.03 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 90.31 | |
| d1dsva_ | 31 | Nucleic acid binding protein p14 {Mouse mammary tu | 89.8 | |
| d3cmsa_ | 323 | Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId | 86.45 | |
| d2bjua1 | 329 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 85.78 | |
| d1miqa_ | 373 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 83.67 | |
| d1am5a_ | 324 | Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: | 83.3 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 81.36 |
| >d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Acid proteases superfamily: Acid proteases family: Retroviral protease (retropepsin) domain: EIAV protease species: Equine infectious anemia virus [TaxId: 11665]
Probab=98.82 E-value=2.1e-08 Score=67.28 Aligned_cols=72 Identities=17% Similarity=0.218 Sum_probs=57.1
Q ss_pred eEEEEEEECCEeeEEEecCCCceeEECHHHHHHcCCeE---------------------EEEEECCEEEEEEEEEecCCC
Q 040033 78 TLRINGRIGNISPIVLVDSGSTHNFISDTFAKKVKNFI---------------------VNLILQGVYVIVDFNLRELEG 136 (158)
Q Consensus 78 ~i~~~~~i~~~~v~aLiDSGat~sfI~~~~a~~~~~~~---------------------A~i~i~g~~~~~~~~v~~~~~ 136 (158)
.-.+.+.|+|+++.+|+||||.++.|+..-..+..... -.+.+.|+.....++|.|. +
T Consensus 8 RP~~~i~I~Gq~v~~LLDTGAD~TVI~~~~~p~~~~~~~~~~~~~igg~g~~~~~~~~~v~i~~~g~~~~~~~lV~p~-P 86 (104)
T d2fmba_ 8 RPTTIVLINDTPLNVLLDTGADTSVLTTAHYNRLKYRGRKYQGTGIGGVGGNVETFSTPVTIKKKGRHIKTRMLVADI-P 86 (104)
T ss_dssp CCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHCSSCCCCEECCCEEETTEEECCEEEEEEEEETTEEEEEEEEEESC-S
T ss_pred CeEEEEEECCEEEEEEEeCCCCeEEEcccccCccCCCCCCcceeEEEEecceEEEEEEEEEEEECCeEEEEEEEECCC-C
Confidence 34578899999999999999999999998766432111 0667789898889999884 3
Q ss_pred CcEEechhHhhhcCC
Q 040033 137 YDVVLGTQWLRTLEP 151 (158)
Q Consensus 137 ~dvILG~dwL~~~~~ 151 (158)
.+ |||+|.|++.+.
T Consensus 87 vn-LlGRdlL~qlG~ 100 (104)
T d2fmba_ 87 VT-ILGRDILQDLGA 100 (104)
T ss_dssp SC-EECHHHHHHHTC
T ss_pred cc-eecHHHHHHhCC
Confidence 33 999999999885
|
| >d4fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]} | Back information, alignment and structure |
|---|
| >d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d2nmza1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1nsoa_ b.50.1.1 (A:) Mason-Pfizer monkey virus protease {Simian retrovirus 1, SRV-1 [TaxId: 11942]} | Back information, alignment and structure |
|---|
| >d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} | Back information, alignment and structure |
|---|
| >d3ecga1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} | Back information, alignment and structure |
|---|
| >d2pmaa1 b.50.1.3 (A:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d2rspa_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C [TaxId: 11886]} | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} | Back information, alignment and structure |
|---|
| >d1cl4a_ g.40.1.1 (A:) Nucleocapsid protein from mason-pfizer monkey virus (MPMV) {Mason-pfizer monkey virus [TaxId: 11855]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|
| >d1dsva_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|