Citrus Sinensis ID: 040144


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MGNLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNLKSINLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPWSFELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCYIGSRFPL
cccccEEEccccccEEcccccccccccccEEEccccccccccccHHccccccccEEEcccccccccccHHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccEEcccHHHHcccccccEEccccccccEEEcccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEccccccEEEccccccEEEEccccccccccccEEEccccEEEEEccccccccccccEEEcccccccccccc
ccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEEccccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHcccccccEEEEccccccccccHHHHcccccccEEEccccccccccccHHHccccHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHccEEcccccccccccHHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccc
mgnlrylnfsktricgiipqqlgnlsnlqfldlssKYLLYVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLSLVELRLsncqlqhfsplatvnfssLTMLDlshnqfdnSFILSWVFAlshlpfldlgfnnfqgtidlealgnltsinrldlslntgltgriprsmalcnlksinlqesldmrsssiyghltdQLGQFRNLVTFNlvnnsivgfipwsfelhiydnkLNVTLFELHFANLIEmswfrvggnqltlevkhdwiphFQLVALGLhscyigsrfpl
mgnlrylnfSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNLKSINLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPWSFELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCYIGSRFPL
MGNLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNLKSINLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPWSFELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCYIGSRFPL
***LRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNLKSINLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPWSFELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCYIGS****
MGNLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNLKSINLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPWSFELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCYIGSRFPL
MGNLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNLKSINLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPWSFELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCYIGSRFPL
*GNLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNLKSINLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPWSFELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCYIGSRFP*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNLKSINLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPWSFELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCYIGSRFPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
P47735 999 Receptor-like protein kin no no 0.712 0.206 0.318 3e-12
Q9LP24 1120 Probable leucine-rich rep no no 0.868 0.224 0.295 1e-11
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.747 0.172 0.303 4e-11
C0LGW6 966 LRR receptor-like serine/ no no 0.830 0.248 0.248 4e-11
C0LGX3 993 LRR receptor-like serine/ no no 0.705 0.205 0.322 1e-10
Q6XAT2 967 LRR receptor-like serine/ no no 0.889 0.265 0.258 2e-10
Q9LHP4 1141 Receptor-like protein kin no no 0.640 0.162 0.316 3e-10
Q9FRS6 1029 Leucine-rich repeat recep no no 0.875 0.245 0.253 5e-10
Q9SHI2 1101 Leucine-rich repeat recep no no 0.740 0.194 0.312 9e-10
C0LGS2 1136 Probable LRR receptor-lik no no 0.847 0.215 0.276 1e-09
>sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1 Back     alignment and function desciption
 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 116/223 (52%), Gaps = 17/223 (7%)

Query: 3   NLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVN 62
           NL++L  S   +   IP   G    L+ L+L+  +L        L  ++ L+ L L Y N
Sbjct: 140 NLKFLEISGNNLSDTIPSSFGEFRKLESLNLAGNFLSGTIP-ASLGNVTTLKELKLAY-N 197

Query: 63  LSIAFDWLMVANKLLSLVELR---LSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFIL 119
           L   F    + ++L +L EL+   L+ C L    P +    +SL  LDL+ NQ   S I 
Sbjct: 198 L---FSPSQIPSQLGNLTELQVLWLAGCNLVGPIPPSLSRLTSLVNLDLTFNQLTGS-IP 253

Query: 120 SWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNLKS 179
           SW+  L  +  ++L  N+F G +  E++GN+T++ R D S+N  LTG+IP ++ L NL+S
Sbjct: 254 SWITQLKTVEQIELFNNSFSGELP-ESMGNMTTLKRFDASMNK-LTGKIPDNLNLLNLES 311

Query: 180 INLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIP 222
           +NL E++      + G L + + + + L    L NN + G +P
Sbjct: 312 LNLFENM------LEGPLPESITRSKTLSELKLFNNRLTGVLP 348




Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates that controls floral organ abscission. May interact with the 'INFLORESCENCE DEFICIENT IN ABSCISSION' (IDA) ligands family.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
255543957 889 serine-threonine protein kinase, plant-t 0.989 0.321 0.394 3e-45
209970622 965 HB06p [Malus floribunda] 0.968 0.290 0.4 3e-44
350284761 915 receptor-like protein [Malus micromalus] 0.982 0.310 0.406 5e-44
350284753 915 receptor-like protein [Malus micromalus] 0.982 0.310 0.406 5e-44
209970631 962 HcrVf4 [Malus floribunda] 0.982 0.295 0.406 6e-44
350284745 976 receptor-like protein [Malus x domestica 0.986 0.292 0.359 9e-44
350284747 978 receptor-like protein [Malus x domestica 0.986 0.291 0.359 1e-43
350284743 978 receptor-like protein [Malus x domestica 0.986 0.291 0.359 1e-43
14330718 915 HcrVf3 protein [Malus floribunda] 0.982 0.310 0.406 2e-43
350284771 978 receptor-like protein [Malus x domestica 0.986 0.291 0.357 3e-43
>gi|255543957|ref|XP_002513041.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223548052|gb|EEF49544.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  187 bits (476), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 138/350 (39%), Positives = 187/350 (53%), Gaps = 64/350 (18%)

Query: 1   MGNLRYLNFSKTRICGIIPQQLGNLSNLQFLDL-----SSKYLLYVDNFLWLSGISLLEH 55
           MG+LR+L+ S     G+IP QLGNLSNLQ+L++      + Y LYV++  W+SG++ LE 
Sbjct: 141 MGSLRFLDLSSAGFGGMIPHQLGNLSNLQYLNINVDQFENNYTLYVESLNWVSGLASLEF 200

Query: 56  LDLRYVNLSIAFDWLMVANKLLSLVELRLSNCQLQHF--SPLATVNFSSLTMLDLSHNQF 113
           L L  V+LS A DW  V N L SLVEL LS CQL     +PL + NFSSL +LDLS N  
Sbjct: 201 LALSGVDLSKAIDWFDVLNTLPSLVELHLSLCQLYQVNPAPLPSANFSSLAILDLSRNNL 260

Query: 114 DNSFILSWVFALSHLPFLDLGFNNFQGTIDL-----------------------EALGNL 150
             S +  W+F+L  L  L L  N+F   I +                        A+GNL
Sbjct: 261 GLS-VPHWIFSLEKLTSLCLSNNSFVEEIPIHLLNLTSLEKLVLSHNNFNSSIPSAIGNL 319

Query: 151 TSINRLDLSLNTGLTGRIP-RSMALCNLKSINLQ-----------------------ESL 186
           TS+N LDLS N+ L G IP  S  LCNL+ ++L                        + L
Sbjct: 320 TSLNLLDLSGNS-LEGGIPIASKNLCNLRLLDLSFNKLSQEINEVFEILSKCAPERLKLL 378

Query: 187 DMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPWSF-------ELHIYDNKLNVTLF 239
           D+ S+ + GH T++L QF+NLV  ++ +NSI G IP          ++ I  N L   + 
Sbjct: 379 DLSSNHLPGHFTNRLEQFKNLVFLSVYDNSISGPIPEILGELKFLEDIDISKNLLKGDVS 438

Query: 240 ELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQ-LVALGLHSCYIGSRFP 288
           E+HFANL  + +F   GNQL+L V  DW+P FQ L +L L    +G +FP
Sbjct: 439 EIHFANLTNLRYFYAAGNQLSLRVSPDWVPPFQGLTSLHLRYWQVGPQFP 488




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|209970622|gb|ACJ03072.1| HB06p [Malus floribunda] Back     alignment and taxonomy information
>gi|350284761|gb|AEQ27752.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|350284753|gb|AEQ27748.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|209970631|gb|ACJ03074.1| HcrVf4 [Malus floribunda] Back     alignment and taxonomy information
>gi|350284745|gb|AEQ27744.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|350284747|gb|AEQ27745.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|350284743|gb|AEQ27743.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|14330718|emb|CAC40827.1| HcrVf3 protein [Malus floribunda] Back     alignment and taxonomy information
>gi|350284771|gb|AEQ27757.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.750 0.239 0.368 5.2e-23
TAIR|locus:2005540 999 HAE "HAESA" [Arabidopsis thali 0.712 0.206 0.318 3.4e-19
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.826 0.253 0.310 3e-16
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.730 0.168 0.331 1.9e-15
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.802 0.237 0.315 3.4e-15
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.833 0.245 0.324 1.4e-14
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.923 0.213 0.301 2e-14
TAIR|locus:2182855 967 ERL2 "ERECTA-like 2" [Arabidop 0.723 0.216 0.339 2e-14
TAIR|locus:2167948 966 ERL1 "ERECTA-like 1" [Arabidop 0.719 0.215 0.306 3.2e-14
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.733 0.221 0.318 2.4e-13
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 277 (102.6 bits), Expect = 5.2e-23, P = 5.2e-23
 Identities = 87/236 (36%), Positives = 128/236 (54%)

Query:     3 NLRYLNFSKTRICGIIPQQLGNLSNLQFLDL-------SSKYLLYVDNFLWLSGISL-LE 54
             +LRYLN S +   G IP  LGNLS L+ LDL       S    L   N  WLS +S  L+
Sbjct:   138 SLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLK 197

Query:    55 HLDLRYVNLSIAFD-WLMVANKLLSLVELRLSNCQLQHFSPL--ATVNFSSLTMLDLSHN 111
             +L++ YVNLS A + WL   +++ +L EL L N +L++  P   ++ +   L +LDLS N
Sbjct:   198 YLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSEN 257

Query:   112 QFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRS 171
                NS I +W+F L++L  L L ++  QG+I      NL  +  LDLS N  L G IP  
Sbjct:   258 SL-NSPIPNWLFGLTNLRKLFLRWDFLQGSIPT-GFKNLKLLETLDLSNNLALQGEIPSV 315

Query:   172 MA-LCNLKSINLQESLDMRSSSIYGHLTDQLGQFR--NLVTFNLVNNSIVGFIPWS 224
             +  L  LK ++L  S +  +  I+G L D   + +  +LV  +L +N + G +P S
Sbjct:   316 LGDLPQLKFLDL--SANELNGQIHGFL-DAFSRNKGNSLVFLDLSSNKLAGTLPES 368


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2005540 HAE "HAESA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182855 ERL2 "ERECTA-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167948 ERL1 "ERECTA-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00101000
hypothetical protein (995 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 64.1 bits (156), Expect = 2e-11
 Identities = 82/296 (27%), Positives = 132/296 (44%), Gaps = 51/296 (17%)

Query: 3   NLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYL---LYVDNFLWLSGISLLEHLDLR 59
           +LRYLN S     G IP+  G++ NL+ LDLS+  L   +  D    +   S L+ LDL 
Sbjct: 119 SLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPND----IGSFSSLKVLDLG 172

Query: 60  YVNLSIAFDWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFIL 119
                         N L+  +             P +  N +SL  L L+ NQ     I 
Sbjct: 173 -------------GNVLVGKI-------------PNSLTNLTSLEFLTLASNQLVGQ-IP 205

Query: 120 SWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNLKS 179
             +  +  L ++ LG+NN  G I  E +G LTS+N LDL  N  LTG IP S  L NLK+
Sbjct: 206 RELGQMKSLKWIYLGYNNLSGEIPYE-IGGLTSLNHLDLVYNN-LTGPIPSS--LGNLKN 261

Query: 180 INLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIP------WSFE-LHIYDN 232
           +   + L +  + + G +   +   + L++ +L +NS+ G IP       + E LH++ N
Sbjct: 262 L---QYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSN 318

Query: 233 KLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCYIGSRFP 288
                +  +   +L  +   ++  N+ + E+  +   H  L  L L +  +    P
Sbjct: 319 NFTGKI-PVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIP 373


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.98
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.78
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.76
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.7
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.69
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.66
KOG4237498 consensus Extracellular matrix protein slit, conta 99.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.42
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.29
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.04
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.0
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
PLN03150623 hypothetical protein; Provisional 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.81
PLN03150623 hypothetical protein; Provisional 98.79
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.78
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.62
KOG4341483 consensus F-box protein containing LRR [General fu 98.6
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.57
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.54
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.54
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.15
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.14
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.14
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.14
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.08
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.07
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.03
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.02
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.98
KOG4341483 consensus F-box protein containing LRR [General fu 97.91
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.75
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.6
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.45
PRK15386 426 type III secretion protein GogB; Provisional 97.4
PRK15386 426 type III secretion protein GogB; Provisional 97.24
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.23
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.09
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.03
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.03
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.9
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.12
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.07
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.32
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.84
KOG4308 478 consensus LRR-containing protein [Function unknown 93.04
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.8
KOG4308 478 consensus LRR-containing protein [Function unknown 92.73
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.96
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.21
smart0037026 LRR Leucine-rich repeats, outliers. 88.77
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.77
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 86.48
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 80.19
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=8.4e-32  Score=253.71  Aligned_cols=280  Identities=26%  Similarity=0.338  Sum_probs=164.3

Q ss_pred             CCCcEEEccCCcccccCCCccCCCCCCcEEeCCCccccccCCCcccCCCCcccEEeccCccccccchhhHhhhcCCCccE
Q 040144            2 GNLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLSLVE   81 (289)
Q Consensus         2 ~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~   81 (289)
                      ++|++|++++|.+++..|..++++++|++|++++|.+....+.. +.++++|++|++++|.+....  +..+..+++|++
T Consensus       140 ~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-~~~l~~L~~L~L~~n~l~~~~--p~~l~~l~~L~~  216 (968)
T PLN00113        140 PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNS-LTNLTSLEFLTLASNQLVGQI--PRELGQMKSLKW  216 (968)
T ss_pred             CCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChh-hhhCcCCCeeeccCCCCcCcC--ChHHcCcCCccE
Confidence            45556666666655556666666666666666666543222221 455666666666666554431  124555666666


Q ss_pred             EEccCCccCCCCcccccCCCCCcEEeccCCCCCCcchhhHhhcCCCCCEEEccCceeeeeeChhhhcCCCCccEEeCCCC
Q 040144           82 LRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLN  161 (289)
Q Consensus        82 L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n  161 (289)
                      |++++|.+....+..++.+++|+.|++++|.++ ...+..++.+++|++|++++|.+.+.+ |..+..+++|++|++++|
T Consensus       217 L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~-~~~p~~l~~l~~L~~L~L~~n~l~~~~-p~~l~~l~~L~~L~Ls~n  294 (968)
T PLN00113        217 IYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLT-GPIPSSLGNLKNLQYLFLYQNKLSGPI-PPSIFSLQKLISLDLSDN  294 (968)
T ss_pred             EECcCCccCCcCChhHhcCCCCCEEECcCceec-cccChhHhCCCCCCEEECcCCeeeccC-chhHhhccCcCEEECcCC
Confidence            666666665555555556666666666666554 445555555666666666666555444 445555556666666655


Q ss_pred             CcccCCCCcccc-ccCcceeeccc------------------cccccCCcccccccccccCCCCCcEEEccCCeeeecCC
Q 040144          162 TGLTGRIPRSMA-LCNLKSINLQE------------------SLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIP  222 (289)
Q Consensus       162 ~~~~~~~~~~~~-~~~L~~L~l~~------------------~l~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~  222 (289)
                      . +.+..|..+. +++|+.|+++.                  .+++++|.+.+.+|..++.+++|+.|++++|.+.+.+|
T Consensus       295 ~-l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p  373 (968)
T PLN00113        295 S-LSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIP  373 (968)
T ss_pred             e-eccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCC
Confidence            5 4445555555 55555555422                  23345666666666666666666666666666665554


Q ss_pred             Cce-------EEEeecceeeeeeccccccccccccEEEecCCeeeeccCCCccccccccEEecccccCccCCC
Q 040144          223 WSF-------ELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCYIGSRFP  288 (289)
Q Consensus       223 ~~~-------~L~l~~n~~~~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~L~~l~l~~n~~~~~~p  288 (289)
                      ..+       .+++.+|.+.+.+|. .+..+++|+.|++++|++++..|..+..+++|+.+++++|++++.+|
T Consensus       374 ~~~~~~~~L~~L~l~~n~l~~~~p~-~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~  445 (968)
T PLN00113        374 EGLCSSGNLFKLILFSNSLEGEIPK-SLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRIN  445 (968)
T ss_pred             hhHhCcCCCCEEECcCCEecccCCH-HHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccC
Confidence            433       566666666655665 66666777777777777776666666666666666666666665444



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 3e-05
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-05
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-04
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 4e-04
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 4e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 45.8 bits (107), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 85/357 (23%), Positives = 132/357 (36%), Gaps = 98/357 (27%) Query: 2 GNLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYV 61 G L++L S +I G + + NL+FLD+SS + +L S L+HLD+ Sbjct: 178 GELKHLAISGNKISGDV--DVSRCVNLEFLDVSSNN--FSTGIPFLGDCSALQHLDISGN 233 Query: 62 NLSIAFDWLMVANKLLSLVELRLSNCQLQHFS------PLATVNF--------------- 100 LS F + + + EL+L N F PL ++ + Sbjct: 234 KLSGDF-----SRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDF 288 Query: 101 -----SSLTMLDLSHNQF------------------------DNSFILSWVFALSHLPFL 131 +LT LDLS N F + + + L L Sbjct: 289 LSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVL 348 Query: 132 DLGFNNFQGTIDLEALGNLT-SINRLDLS-------------------------LNTGLT 165 DL FN F G + E+L NL+ S+ LDLS N G T Sbjct: 349 DLSFNEFSGELP-ESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 407 Query: 166 GRIPRSMALCNLKSINLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPW-- 223 G+IP +++ C+ + ++L S + S G + LG L L N + G IP Sbjct: 408 GKIPPTLSNCS-ELVSLHLSFNYLS----GTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 462 Query: 224 ----SFELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVAL 276 + E I D +N ++W + N+LT E+ WI + +A+ Sbjct: 463 MYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPK-WIGRLENLAI 518
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-27
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-23
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-21
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  134 bits (340), Expect = 9e-36
 Identities = 60/271 (22%), Positives = 107/271 (39%), Gaps = 24/271 (8%)

Query: 1   MGNLRYLNFSKTRICGIIP--QQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDL 58
             +L  L+ S+  + G +     LG+ S L+FL++SS  L +         ++ LE LDL
Sbjct: 99  SASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDL 158

Query: 59  RYVNLSIAF-DWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSF 117
              ++S A     ++++    L  L +S  ++     ++     +L  LD+S N F  S 
Sbjct: 159 SANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVS--RCVNLEFLDVSSNNF--ST 214

Query: 118 ILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLNTGLTGRIPRSMALCNL 177
            + ++   S L  LD+  N   G      +   T +  L++S N    G IP    L +L
Sbjct: 215 GIPFLGDCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSN-QFVGPIPPLP-LKSL 271

Query: 178 KSINLQESLDMRSSSIYGHLTDQL-GQFRNLVTFNLVNNSIVGFIPWSF-------ELHI 229
                 + L +  +   G + D L G    L   +L  N   G +P  F        L +
Sbjct: 272 ------QYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLAL 325

Query: 230 YDNKLNVTLFELHFANLIEMSWFRVGGNQLT 260
             N  +  L       +  +    +  N+ +
Sbjct: 326 SSNNFSGELPMDTLLKMRGLKVLDLSFNEFS 356


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.96
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.52
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.17
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.15
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.0
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.9
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.57
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.23
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.13
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.51
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.33
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.23
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2e-35  Score=270.81  Aligned_cols=279  Identities=24%  Similarity=0.304  Sum_probs=173.9

Q ss_pred             CCcEEEccCCcccccCCCccCCCCCCcEEeCCCccccccCCCcccCCCCcccEEeccCcccccc-chhhHhhhcCCCccE
Q 040144            3 NLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRYVNLSIA-FDWLMVANKLLSLVE   81 (289)
Q Consensus         3 ~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~-~~~~~~~~~~~~L~~   81 (289)
                      +|++|++.+|.+++..|..+.++++|++|++++|.+....+.. +.++++|++|++++|.+... +.   .+..+++|++
T Consensus       395 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~-l~~l~~L~~L~L~~n~l~~~~p~---~~~~l~~L~~  470 (768)
T 3rgz_A          395 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS-LGSLSKLRDLKLWLNMLEGEIPQ---ELMYVKTLET  470 (768)
T ss_dssp             CCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGG-GGGCTTCCEEECCSSCCCSCCCG---GGGGCTTCCE
T ss_pred             CccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHH-HhcCCCCCEEECCCCcccCcCCH---HHcCCCCceE
Confidence            3444444444444444444555555555555554433222211 34445555555555544432 22   3444555555


Q ss_pred             EEccCCccCCCCcccccCCCCCcEEeccCCCCCCcchhhHhhcCCCCCEEEccCceeeeeeChhhhcCCCCccEEeCCCC
Q 040144           82 LRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLN  161 (289)
Q Consensus        82 L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n  161 (289)
                      |++++|.+....+..+..+++|+.|++++|.++ +.+|..++.+++|++|++++|.+.+.+ |..++.+++|+.+++++|
T Consensus       471 L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~-~~~p~~~~~l~~L~~L~L~~N~l~~~~-p~~l~~l~~L~~L~Ls~N  548 (768)
T 3rgz_A          471 LILDFNDLTGEIPSGLSNCTNLNWISLSNNRLT-GEIPKWIGRLENLAILKLSNNSFSGNI-PAELGDCRSLIWLDLNTN  548 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCC-SCCCGGGGGCTTCCEEECCSSCCEEEC-CGGGGGCTTCCEEECCSS
T ss_pred             EEecCCcccCcCCHHHhcCCCCCEEEccCCccC-CcCChHHhcCCCCCEEECCCCcccCcC-CHHHcCCCCCCEEECCCC
Confidence            555555555444445555555555555555554 444445555555555555555555444 445555555555555555


Q ss_pred             CcccCCCCcccc-ccCcceeeccc----------------------------------------cccccCCccccccccc
Q 040144          162 TGLTGRIPRSMA-LCNLKSINLQE----------------------------------------SLDMRSSSIYGHLTDQ  200 (289)
Q Consensus       162 ~~~~~~~~~~~~-~~~L~~L~l~~----------------------------------------~l~l~~~~~~~~~~~~  200 (289)
                      . +.+.+|..+. ...+..+.+..                                        .+++..+.+.+.+|..
T Consensus       549 ~-l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~  627 (768)
T 3rgz_A          549 L-FNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPT  627 (768)
T ss_dssp             E-EESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCS
T ss_pred             c-cCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchh
Confidence            5 4444444433 22222111100                                        1122334455556667


Q ss_pred             ccCCCCCcEEEccCCeeeecCCCce-------EEEeecceeeeeeccccccccccccEEEecCCeeeeccCCCccccccc
Q 040144          201 LGQFRNLVTFNLVNNSIVGFIPWSF-------ELHIYDNKLNVTLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQL  273 (289)
Q Consensus       201 l~~~~~L~~L~l~~n~~~~~~~~~~-------~L~l~~n~~~~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~L  273 (289)
                      ++.+++|+.|++++|.+++.+|..+       .|++++|.++|.+|. .++++++|+.|++++|++++.+|..+..+++|
T Consensus       628 ~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~-~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L  706 (768)
T 3rgz_A          628 FDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPD-EVGDLRGLNILDLSSNKLDGRIPQAMSALTML  706 (768)
T ss_dssp             CSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCG-GGGGCTTCCEEECCSSCCEECCCGGGGGCCCC
T ss_pred             hhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCCh-HHhCCCCCCEEECCCCcccCcCChHHhCCCCC
Confidence            7788999999999999999988777       899999999999999 99999999999999999999999999999999


Q ss_pred             cEEecccccCccCCCC
Q 040144          274 VALGLHSCYIGSRFPL  289 (289)
Q Consensus       274 ~~l~l~~n~~~~~~p~  289 (289)
                      ++|++++|+++|.||+
T Consensus       707 ~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          707 TEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             SEEECCSSEEEEECCS
T ss_pred             CEEECcCCcccccCCC
Confidence            9999999999999984



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 289
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 58.1 bits (139), Expect = 3e-10
 Identities = 34/161 (21%), Positives = 69/161 (42%), Gaps = 17/161 (10%)

Query: 1   MGNLRYLNFSKTRICGIIPQQLGNLSNLQFLDLSSKYLLYVDNFLWLSGISLLEHLDLRY 60
           + NL  L+ +  +I  + P  L  L+ L  L L +  +  +     L+ ++ LE  + + 
Sbjct: 240 LTNLTDLDLANNQISNLAP--LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQL 297

Query: 61  VNLSIAFDWLMVANKLLSLVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILS 120
                  + +   + L +L  L L    +   SP++  + + L  L  ++N+  +   +S
Sbjct: 298 -------EDISPISNLKNLTYLTLYFNNISDISPVS--SLTKLQRLFFANNKVSD---VS 345

Query: 121 WVFALSHLPFLDLGFNNFQGTIDLEALGNLTSINRLDLSLN 161
            +  L+++ +L  G N          L NLT I +L L+  
Sbjct: 346 SLANLTNINWLSAGHNQISDLT---PLANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.57
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.08
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.17
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.0
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.48
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.45
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=5.4e-28  Score=197.25  Aligned_cols=253  Identities=23%  Similarity=0.234  Sum_probs=173.9

Q ss_pred             CCcEEEccCCcccc--cCCCccCCCCCCcEEeCCC-cccc-ccCCCcccCCCCcccEEeccCccccccchhhHhhhcCCC
Q 040144            3 NLRYLNFSKTRICG--IIPQQLGNLSNLQFLDLSS-KYLL-YVDNFLWLSGISLLEHLDLRYVNLSIAFDWLMVANKLLS   78 (289)
Q Consensus         3 ~L~~L~l~~~~~~~--~~~~~l~~l~~L~~L~l~~-~~~~-~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~   78 (289)
                      ++++|+|+++.+++  .+|++++++++|++|++++ |.+. .++  ..+.++++|++|++++|.+.....  ..+..+..
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP--~~i~~L~~L~~L~Ls~N~l~~~~~--~~~~~~~~  126 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIP--PAIAKLTQLHYLYITHTNVSGAIP--DFLSQIKT  126 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCC--GGGGGCTTCSEEEEEEECCEEECC--GGGGGCTT
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccc--cccccccccchhhhcccccccccc--ccccchhh
Confidence            46777777777665  4667777777777777775 3333 222  126677777777777777766532  14566777


Q ss_pred             ccEEEccCCccCCCCcccccCCCCCcEEeccCCCCCCcchhhHhhcCCCC-CEEEccCceeeeeeChhhhcCCCCccEEe
Q 040144           79 LVELRLSNCQLQHFSPLATVNFSSLTMLDLSHNQFDNSFILSWVFALSHL-PFLDLGFNNFQGTIDLEALGNLTSINRLD  157 (289)
Q Consensus        79 L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L-~~L~l~~n~~~~~~~~~~~~~~~~L~~L~  157 (289)
                      |+.+++.+|.+....+..+..+++++.+++++|.+. +.+|..+..+..+ +.+++++|++.+.. +..+..+. ...++
T Consensus       127 L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~-~~ip~~~~~l~~l~~~l~~~~n~l~~~~-~~~~~~l~-~~~l~  203 (313)
T d1ogqa_         127 LVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRIS-GAIPDSYGSFSKLFTSMTISRNRLTGKI-PPTFANLN-LAFVD  203 (313)
T ss_dssp             CCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCE-EECCGGGGCCCTTCCEEECCSSEEEEEC-CGGGGGCC-CSEEE
T ss_pred             hcccccccccccccCchhhccCcccceeeccccccc-cccccccccccccccccccccccccccc-cccccccc-ccccc
Confidence            777777777776666667777777777777777765 5566666665554 67777777777555 55565554 33577


Q ss_pred             CCCCCcccCCCCcccc-ccCcceeeccccccccCCcccccccccccCCCCCcEEEccCCeeeecCCCceEEEeecceeee
Q 040144          158 LSLNTGLTGRIPRSMA-LCNLKSINLQESLDMRSSSIYGHLTDQLGQFRNLVTFNLVNNSIVGFIPWSFELHIYDNKLNV  236 (289)
Q Consensus       158 l~~n~~~~~~~~~~~~-~~~L~~L~l~~~l~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~~~L~l~~n~~~~  236 (289)
                      +..+. ..+..|..+. ++.++.+++      +++.+.+.++ .+..+++|+.|++++|+++                 |
T Consensus       204 l~~~~-~~~~~~~~~~~~~~l~~l~~------~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~-----------------g  258 (313)
T d1ogqa_         204 LSRNM-LEGDASVLFGSDKNTQKIHL------AKNSLAFDLG-KVGLSKNLNGLDLRNNRIY-----------------G  258 (313)
T ss_dssp             CCSSE-EEECCGGGCCTTSCCSEEEC------CSSEECCBGG-GCCCCTTCCEEECCSSCCE-----------------E
T ss_pred             ccccc-cccccccccccccccccccc------cccccccccc-ccccccccccccCccCeec-----------------c
Confidence            76666 5555666655 666666664      5666665444 4566666777666666555                 5


Q ss_pred             eeccccccccccccEEEecCCeeeeccCCCccccccccEEeccccc-Ccc-CCCC
Q 040144          237 TLFELHFANLIEMSWFRVGGNQLTLEVKHDWIPHFQLVALGLHSCY-IGS-RFPL  289 (289)
Q Consensus       237 ~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~L~~l~l~~n~-~~~-~~p~  289 (289)
                      .+|. .++++++|++|++++|++++.+|. ++++++|+.+++++|+ +.| ++|.
T Consensus       259 ~iP~-~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~plp~  311 (313)
T d1ogqa_         259 TLPQ-GLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSPLPA  311 (313)
T ss_dssp             CCCG-GGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEESTTSSC
T ss_pred             cCCh-HHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCCCCCC
Confidence            6777 899999999999999999998875 5889999999999997 554 3663



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure