Citrus Sinensis ID: 040338


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-----
MKACGSLKSLPIARKIHAQLISTCLISSIFLQLIDDDYRVFCDIGPRYLFTYNTMINGGVRCLCVGNIKMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALVTMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSQAGVLEKPRFFFFFVSLLSGCSHSGPVTKGKHYFTAMAKFTYTCYFVCMVDLLGLSGLLGEAKKLIDEMPSKPTCVIWGALLGACCSHYNTKLAELVMRNLLQLDVKVFGS
ccccccccccHHHHHHHHHHHHHcccccHHcccHHHHHHHHccccccccEEHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccc
ccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccEEEHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEccHHHHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccc
mkacgslkslPIARKIHAQLISTCLISSIFLQLIdddyrvfcdigprylftYNTMINGGVRCLCVGNIKMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMlnpslfcwKFGIIRLLIMFQkmperdlvSWNTMISILTRHGFGFETLCTFIELwnhgfglsSMLYATAFSARASvydlewgphlhsrvvhmepsldvfvgsGLIDMYLKcgcngiesSIQIGKALVTMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSqagvlekprFFFFFVSLLsgcshsgpvtkgkHYFTAMAKFTYTCYFVCMVDLLGLSGLLGEAKKLidempskptcVIWGALLGACCSHYNTKLAELVMRNLLQLDVKVFGS
mkacgslkSLPIARKIHAQLISTCLISSIFLQLIDDDYRVFCDIGPRYLFTYNTMINGGVRCLCVGNIKMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALVTMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSQAGVLEKPRFFFFFVSLLSGCSHSGPVTKGKHYFTAMAKFTYTCYFVCMVDLLGLSGLLGEAKKLIDEMPSKPTCVIWGALLGACCSHYNTKLAELVMRNLLQLDVKVFGS
MKACGSLKSLPIARKIHAQLISTCLISSIFLQLIDDDYRVFCDIGPRYLFTYNTMINGGVRCLCVGNIKMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALVTMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSQAGVLEKPRFFFFFVSLLSGCSHSGPVTKGKHYFTAMAKFTYTCYFVCMVDLLGLSGLLGEAKKLIDEMPSKPTCVIWGALLGACCSHYNTKLAELVMRNLLQLDVKVFGS
********SLPIARKIHAQLISTCLISSIFLQLIDDDYRVFCDIGPRYLFTYNTMINGGVRCLCVGNIKMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALVTMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSQAGVLEKPRFFFFFVSLLSGCSHSGPVTKGKHYFTAMAKFTYTCYFVCMVDLLGLSGLLGEAKKLIDEMPSKPTCVIWGALLGACCSHYNTKLAELVMRNLLQLDVKVF**
MKACGS*KSLPIARKIHAQLISTCLISSIFLQLIDDDYRVFCDIGPRYLFTYNTMINGGVRCLCVGNIKMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALVTMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSQAGVLEKPRFFFFFVSLLSGCSHSGPVTKGKHYFTAMAKFTYTCYFVCMVDLLGLSGLLGEAKKLIDEMPSKPTCVIWGALLGACCSHYNTKLAELVMRNLLQ*DVK****
MKACGSLKSLPIARKIHAQLISTCLISSIFLQLIDDDYRVFCDIGPRYLFTYNTMINGGVRCLCVGNIKMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALVTMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSQAGVLEKPRFFFFFVSLLSGCSHSGPVTKGKHYFTAMAKFTYTCYFVCMVDLLGLSGLLGEAKKLIDEMPSKPTCVIWGALLGACCSHYNTKLAELVMRNLLQLDVKVFGS
MKACGSLKSLPIARKIHAQLISTCLISSIFLQLIDDDYRVFCDIGPRYLFTYNTMINGGVRCLCVGNIKMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALVTMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSQAGVLEKPRFFFFFVSLLSGCSHSGPVTKGKHYFTAMAKFTYTCYFVCMVDLLGLSGLLGEAKKLIDEMPSKPTCVIWGALLGACCSHYNTKLAELVMRNLLQLD******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKACGSLKSLPIARKIHAQLISTCLISSIFLQLIDDDYRVFCDIGPRYLFTYNTMINGGVRCLCVGNIKMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALVTMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSQAGVLEKPRFFFFFVSLLSGCSHSGPVTKGKHYFTAMAKFTYTCYFVCMVDLLGLSGLLGEAKKLIDEMPSKPTCVIWGALLGACCSHYNTKLAELVMRNLLQLDVKVFGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query385 2.2.26 [Sep-21-2011]
Q9SIT7697 Pentatricopeptide repeat- yes no 0.932 0.515 0.269 1e-36
Q9SY02 781 Pentatricopeptide repeat- no no 0.807 0.398 0.286 1e-35
Q9FI80 646 Pentatricopeptide repeat- no no 0.872 0.520 0.275 1e-34
Q9FJY7 620 Pentatricopeptide repeat- no no 0.828 0.514 0.304 1e-34
Q56XI1 705 Pentatricopeptide repeat- no no 0.831 0.453 0.274 2e-32
Q9LXE8 623 Pentatricopeptide repeat- no no 0.766 0.473 0.292 4e-32
Q9C8L6717 Pentatricopeptide repeat- no no 0.618 0.331 0.336 5e-32
O82380 738 Pentatricopeptide repeat- no no 0.942 0.491 0.239 7e-32
Q9S7F4 825 Putative pentatricopeptid no no 0.641 0.299 0.298 1e-31
Q9MA85658 Pentatricopeptide repeat- no no 0.820 0.480 0.280 4e-31
>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=3 SV=1 Back     alignment and function desciption
 Score =  154 bits (389), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 122/453 (26%), Positives = 196/453 (43%), Gaps = 94/453 (20%)

Query: 1   MKACGSLKSLPIARKIHAQLISTCLISSIFL--QLID---------DDYRVFCDIGPRYL 49
           + AC  L  +    ++H+ +  +  +S +++   L+D         D  RVF ++G R +
Sbjct: 159 LSACSGLNDMNKGVQVHSLIAKSPFLSDVYIGSALVDMYSKCGNVNDAQRVFDEMGDRNV 218

Query: 50  FTYNTMI-----NGGV---------------------------RCLCVGNIKMALHLHG- 76
            ++N++I     NG                              C  +  IK+   +HG 
Sbjct: 219 VSWNSLITCFEQNGPAVEALDVFQMMLESRVEPDEVTLASVISACASLSAIKVGQEVHGR 278

Query: 77  LVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSL---------FCWKFGIIR 127
           +VK     +D  ++ + +DM+ KC  +  A   F  M   ++         +        
Sbjct: 279 VVKNDKLRNDIILSNAFVDMYAKCSRIKEARFIFDSMPIRNVIAETSMISGYAMAASTKA 338

Query: 128 LLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARAS 187
             +MF KM ER++VSWN +I+  T++G   E L  F  L       +   +A    A A 
Sbjct: 339 ARLMFTKMAERNVVSWNALIAGYTQNGENEEALSLFCLLKRESVCPTHYSFANILKACAD 398

Query: 188 VYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCG---CNGIESSIQIGKALVTMYAE 244
           + +L  G   H  V                   LK G    +G E  I +G +L+ MY +
Sbjct: 399 LAELHLGMQAHVHV-------------------LKHGFKFQSGEEDDIFVGNSLIDMYVK 439

Query: 245 GGSTQKADLAFELMSRRNMISWMVLISAFSQAGVL--------------EKPRFFFFFVS 290
            G  ++  L F  M  R+ +SW  +I  F+Q G                EKP      + 
Sbjct: 440 CGCVEEGYLVFRKMMERDCVSWNAMIIGFAQNGYGNEALELFREMLESGEKPDHITM-IG 498

Query: 291 LLSGCSHSGPVTKGKHYFTAMAK----FTYTCYFVCMVDLLGLSGLLGEAKKLIDEMPSK 346
           +LS C H+G V +G+HYF++M +         ++ CMVDLLG +G L EAK +I+EMP +
Sbjct: 499 VLSACGHAGFVEEGRHYFSSMTRDFGVAPLRDHYTCMVDLLGRAGFLEEAKSMIEEMPMQ 558

Query: 347 PTCVIWGALLGACCSHYNTKLAELVMRNLLQLD 379
           P  VIWG+LL AC  H N  L + V   LL+++
Sbjct: 559 PDSVIWGSLLAACKVHRNITLGKYVAEKLLEVE 591





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description
>sp|Q56XI1|PPR25_ARATH Pentatricopeptide repeat-containing protein At1g09410 OS=Arabidopsis thaliana GN=PCMP-H18 PE=2 SV=2 Back     alignment and function description
>sp|Q9LXE8|PP386_ARATH Pentatricopeptide repeat-containing protein At5g15340, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H91 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8L6|PPR80_ARATH Pentatricopeptide repeat-containing protein At1g53600, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E63 PE=2 SV=2 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7F4|PP206_ARATH Putative pentatricopeptide repeat-containing protein At2g01510 OS=Arabidopsis thaliana GN=PCMP-H36 PE=3 SV=1 Back     alignment and function description
>sp|Q9MA85|PP215_ARATH Pentatricopeptide repeat-containing protein At3g05340 OS=Arabidopsis thaliana GN=PCMP-E83 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query385
297745590 789 unnamed protein product [Vitis vinifera] 0.685 0.334 0.426 8e-65
359491917 767 PREDICTED: pentatricopeptide repeat-cont 0.685 0.344 0.410 7e-62
255539304 742 pentatricopeptide repeat-containing prot 0.703 0.365 0.338 2e-48
147861799 1756 hypothetical protein VITISV_027167 [Viti 0.418 0.091 0.529 2e-44
449443642 663 PREDICTED: pentatricopeptide repeat-cont 0.776 0.450 0.319 3e-43
357438977 960 Pentatricopeptide repeat-containing prot 0.753 0.302 0.345 7e-43
356562443 836 PREDICTED: pentatricopeptide repeat-cont 0.789 0.363 0.295 1e-42
356562121 921 PREDICTED: pentatricopeptide repeat-cont 0.574 0.239 0.372 7e-42
294463969 514 unknown [Picea sitchensis] 0.805 0.603 0.304 8e-42
356532255 948 PREDICTED: pentatricopeptide repeat-cont 0.574 0.233 0.364 2e-40
>gi|297745590|emb|CBI40755.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  253 bits (647), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 148/347 (42%), Positives = 190/347 (54%), Gaps = 83/347 (23%)

Query: 1   MKACGSLKSLPIARKIHAQLISTCLISSIFLQ-----------LIDDDYRVFCDIGPRYL 49
           MK C SL+S+PIARK+HAQLI   L SSIFLQ           LI D YRVF  I    +
Sbjct: 11  MKECASLRSIPIARKLHAQLIFMGLKSSIFLQNHLLNMYSNCGLISDAYRVFGGIMFPNV 70

Query: 50  FTYNTMI------------------------------------NGGVRCL-----CVGNI 68
           +++NTMI                                    NG +         +G +
Sbjct: 71  YSWNTMISGFADSGQMREAEKLFEKMPERDSVSWNSMMSGYFHNGELEATIKASGSLGYL 130

Query: 69  KMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCW------- 121
           K+AL LHG  +KF F  D  +  S +DM++KCGA+D+A+  F R  NPSLFCW       
Sbjct: 131 KLALQLHGFAEKFDFGIDTCVETSVLDMYIKCGAMDFAQKVFCRTPNPSLFCWNSMIYGY 190

Query: 122 -KFGIIR-LLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYA 179
            K+G ++  L +F KMPERD VSWNTMISIL++HGFG ETL TF+E+WN GF  +SM YA
Sbjct: 191 SKYGSVKKALELFAKMPERDTVSWNTMISILSQHGFGAETLNTFLEMWNQGFRPNSMTYA 250

Query: 180 TAFSARASVYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALV 239
           +  SA  S+YDLEWG HLH+R+V MEP LDV+ G GLIDMY KCG   +ES+ Q+     
Sbjct: 251 SVLSACTSIYDLEWGAHLHARIVRMEPCLDVYAGCGLIDMYAKCG--RLESARQV----- 303

Query: 240 TMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSQAGVLEKPRFFF 286
                          F+ ++  N +SW  LI   +QAG  E+    F
Sbjct: 304 ---------------FDGLTEHNAVSWTSLIGGVAQAGFQEEALVLF 335




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359491917|ref|XP_003634341.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255539304|ref|XP_002510717.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551418|gb|EEF52904.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147861799|emb|CAN81086.1| hypothetical protein VITISV_027167 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449443642|ref|XP_004139586.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Cucumis sativus] gi|449492832|ref|XP_004159115.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357438977|ref|XP_003589765.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355478813|gb|AES60016.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356562443|ref|XP_003549481.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Glycine max] Back     alignment and taxonomy information
>gi|356562121|ref|XP_003549322.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Glycine max] Back     alignment and taxonomy information
>gi|294463969|gb|ADE77505.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|356532255|ref|XP_003534689.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query385
TAIR|locus:2054131697 SLO2 "AT2G13600" [Arabidopsis 0.802 0.443 0.316 2e-36
TAIR|locus:2140235 781 AT4G02750 [Arabidopsis thalian 0.618 0.304 0.349 2e-32
TAIR|locus:2154855 620 AT5G66520 "AT5G66520" [Arabido 0.851 0.529 0.295 2.1e-32
TAIR|locus:2196583 866 ECB2 "EARLY CHLOROPLAST BIOGEN 0.641 0.285 0.316 6.8e-31
TAIR|locus:2045580559 AT2G42920 [Arabidopsis thalian 0.779 0.536 0.317 1.4e-30
TAIR|locus:2095487504 AT3G28660 "AT3G28660" [Arabido 0.597 0.456 0.316 2.7e-29
TAIR|locus:2150936 623 AT5G15340 [Arabidopsis thalian 0.771 0.476 0.301 6.9e-29
TAIR|locus:2154389 646 LPA66 "LOW PSII ACCUMULATION 6 0.620 0.369 0.342 2.3e-28
TAIR|locus:2198678500 PDE247 "pigment defective 247" 0.625 0.482 0.326 2.4e-28
TAIR|locus:2205200 741 OTP82 "AT1G08070" [Arabidopsis 0.919 0.477 0.282 3.8e-28
TAIR|locus:2054131 SLO2 "AT2G13600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 2.0e-36, Sum P(2) = 2.0e-36
 Identities = 107/338 (31%), Positives = 165/338 (48%)

Query:    62 CLCVGNIKMALHLHG-LVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAF----LR--ML 114
             C  +  IK+   +HG +VK     +D  ++ + +DM+ KC  +  A   F    +R  + 
Sbjct:   263 CASLSAIKVGQEVHGRVVKNDKLRNDIILSNAFVDMYAKCSRIKEARFIFDSMPIRNVIA 322

Query:   115 NPSL---FCWKFGIIRLLIMFQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGF 171
               S+   +          +MF KM ER++VSWN +I+  T++G   E L  F  L     
Sbjct:   323 ETSMISGYAMAASTKAARLMFTKMAERNVVSWNALIAGYTQNGENEEALSLFCLLKRESV 382

Query:   172 GLSSMLYATAFSARASVYDLEWGPHLHSRVV-H-----MEPSLDVFVGSGLIDMYLKCGC 225
               +   +A    A A + +L  G   H  V+ H          D+FVG+ LIDMY+KCGC
Sbjct:   383 CPTHYSFANILKACADLAELHLGMQAHVHVLKHGFKFQSGEEDDIFVGNSLIDMYVKCGC 442

Query:   226 NGIESSIQIGKALVTMYAEGGSTQKADLAFELMSRRNMISWMVLISAFSQAGVLEKPRFF 285
               +E    + + +  M  +  S     + F      N    + L     ++G  EKP   
Sbjct:   443 --VEEGYLVFRKM--MERDCVSWNAMIIGFAQNGYGNEA--LELFREMLESG--EKPDHI 494

Query:   286 FFFVSLLSGCSHSGPVTKGKHYFTAMAK-FTYTC---YFVCMVDLLGLSGLLGEAKKLID 341
                + +LS C H+G V +G+HYF++M + F       ++ CMVDLLG +G L EAK +I+
Sbjct:   495 TM-IGVLSACGHAGFVEEGRHYFSSMTRDFGVAPLRDHYTCMVDLLGRAGFLEEAKSMIE 553

Query:   342 EMPSKPTCVIWGALLGACCSHYNTKLAELVMRNLLQLD 379
             EMP +P  VIWG+LL AC  H N  L + V   LL+++
Sbjct:   554 EMPMQPDSVIWGSLLAACKVHRNITLGKYVAEKLLEVE 591


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0010182 "sugar mediated signaling pathway" evidence=IMP
GO:0080156 "mitochondrial mRNA modification" evidence=IMP
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154855 AT5G66520 "AT5G66520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196583 ECB2 "EARLY CHLOROPLAST BIOGENESIS2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045580 AT2G42920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095487 AT3G28660 "AT3G28660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150936 AT5G15340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154389 LPA66 "LOW PSII ACCUMULATION 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198678 PDE247 "pigment defective 247" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query385
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-39
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-38
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-17
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-16
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-14
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-13
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 0.001
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  148 bits (376), Expect = 3e-39
 Identities = 106/442 (23%), Positives = 186/442 (42%), Gaps = 106/442 (23%)

Query: 3   ACGSLKSLPIARKIHAQLISTCLISSI-----FLQL------IDDDYRVFCDIGPRYLFT 51
           AC  L    + R++H  ++ T     +      +Q+        +  +VF  +  +   +
Sbjct: 297 ACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVS 356

Query: 52  YNTMINGGVR--------------------------------CLCVGNIKMALHLHGLVK 79
           +  MI+G  +                                C C+G++ + + LH L +
Sbjct: 357 WTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAE 416

Query: 80  KFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQKMPERD 139
           +   +S   +A + I+M+ KC  +D A                      L +F  +PE+D
Sbjct: 417 RKGLISYVVVANALIEMYSKCKCIDKA----------------------LEVFHNIPEKD 454

Query: 140 LVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHS 199
           ++SW ++I+ L  +   FE L  F ++       +S+    A SA A +  L  G  +H+
Sbjct: 455 VISWTSIIAGLRLNNRCFEALIFFRQMLLT-LKPNSVTLIAALSACARIGALMCGKEIHA 513

Query: 200 RVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALVTMYAEGGSTQKADLAFELMS 259
            V+      D F+ + L+D+Y++CG        ++  A         ++ + D+      
Sbjct: 514 HVLRTGIGFDGFLPNALLDLYVRCG--------RMNYAWNQF-----NSHEKDVV----- 555

Query: 260 RRNMISWMVLISAFSQAGVLEKPRFFF-------------FFVSLLSGCSHSGPVTKGKH 306
                SW +L++ +   G        F              F+SLL  CS SG VT+G  
Sbjct: 556 -----SWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLE 610

Query: 307 YFTAM-AKFTYTC---YFVCMVDLLGLSGLLGEAKKLIDEMPSKPTCVIWGALLGACCSH 362
           YF +M  K++ T    ++ C+VDLLG +G L EA   I++MP  P   +WGALL AC  H
Sbjct: 611 YFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIH 670

Query: 363 YNTKLAELVMRNLLQLDVKVFG 384
            + +L EL  +++ +LD    G
Sbjct: 671 RHVELGELAAQHIFELDPNSVG 692


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 385
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.93
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.81
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.79
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.78
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.76
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.74
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.72
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.72
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.71
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.71
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.7
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.66
PRK14574 822 hmsH outer membrane protein; Provisional 99.66
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.62
PRK14574 822 hmsH outer membrane protein; Provisional 99.61
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.59
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.55
PF1304150 PPR_2: PPR repeat family 99.51
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.51
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.48
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.45
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.45
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.44
PF1304150 PPR_2: PPR repeat family 99.42
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.42
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.41
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.41
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.38
KOG1126638 consensus DNA-binding cell division cycle control 99.35
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.34
KOG2076 895 consensus RNA polymerase III transcription factor 99.32
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.3
KOG1915677 consensus Cell cycle control protein (crooked neck 99.29
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.26
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.22
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.21
KOG2076 895 consensus RNA polymerase III transcription factor 99.2
KOG2003 840 consensus TPR repeat-containing protein [General f 99.2
KOG1126638 consensus DNA-binding cell division cycle control 99.2
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.2
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.2
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.17
KOG2003 840 consensus TPR repeat-containing protein [General f 99.15
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.14
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.12
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.11
PRK12370553 invasion protein regulator; Provisional 99.09
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.09
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.07
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.07
PRK12370553 invasion protein regulator; Provisional 99.06
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.04
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.04
KOG1129478 consensus TPR repeat-containing protein [General f 99.04
KOG0547606 consensus Translocase of outer mitochondrial membr 98.94
PF1285434 PPR_1: PPR repeat 98.94
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.91
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.87
PRK11189296 lipoprotein NlpI; Provisional 98.85
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.85
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.83
KOG1129478 consensus TPR repeat-containing protein [General f 98.81
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.79
KOG0547 606 consensus Translocase of outer mitochondrial membr 98.75
PRK11189296 lipoprotein NlpI; Provisional 98.75
PF1285434 PPR_1: PPR repeat 98.68
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.68
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.66
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.65
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.64
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.62
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.61
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.61
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.6
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.58
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.52
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.52
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.52
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.49
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.47
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.46
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.46
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.44
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.43
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.42
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.42
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.38
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.38
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.31
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.3
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.29
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.27
PRK04841 903 transcriptional regulator MalT; Provisional 98.27
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.27
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.25
KOG1125579 consensus TPR repeat-containing protein [General f 98.24
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 98.22
PRK15359144 type III secretion system chaperone protein SscB; 98.21
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.18
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.18
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.18
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.16
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.13
PRK10370198 formate-dependent nitrite reductase complex subuni 98.12
PRK04841 903 transcriptional regulator MalT; Provisional 98.11
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.1
PLN02789320 farnesyltranstransferase 98.09
PLN02789320 farnesyltranstransferase 98.07
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.06
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.05
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.04
PRK15359144 type III secretion system chaperone protein SscB; 98.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.01
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.01
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.0
PRK10370198 formate-dependent nitrite reductase complex subuni 98.0
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.0
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.0
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.99
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.99
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.98
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.97
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 97.96
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.95
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.95
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.95
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.93
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.9
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.9
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.89
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.79
KOG1125579 consensus TPR repeat-containing protein [General f 97.77
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.76
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.76
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.76
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.73
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.71
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.68
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.68
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.64
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.6
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.57
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.56
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.54
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.53
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.51
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.5
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.47
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.42
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.41
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.41
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.4
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.39
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.38
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.35
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.35
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.35
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.3
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.3
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.22
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.17
PRK10803263 tol-pal system protein YbgF; Provisional 97.14
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.08
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.08
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.07
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.02
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.02
KOG0553 304 consensus TPR repeat-containing protein [General f 97.01
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.99
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.96
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.95
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.92
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.91
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.89
PF12688120 TPR_5: Tetratrico peptide repeat 96.87
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.85
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.84
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.8
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.76
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.76
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.72
KOG3941406 consensus Intermediate in Toll signal transduction 96.69
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.63
PF1337173 TPR_9: Tetratricopeptide repeat 96.62
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.53
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.53
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.52
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.46
KOG0553304 consensus TPR repeat-containing protein [General f 96.35
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.33
PF12688120 TPR_5: Tetratrico peptide repeat 96.32
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.3
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.28
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.23
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.21
KOG3941406 consensus Intermediate in Toll signal transduction 96.19
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.13
COG4700251 Uncharacterized protein conserved in bacteria cont 96.07
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.01
PF1337173 TPR_9: Tetratricopeptide repeat 95.99
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.98
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.96
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.93
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.83
PRK10803263 tol-pal system protein YbgF; Provisional 95.8
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 95.79
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.62
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.57
smart00299140 CLH Clathrin heavy chain repeat homology. 95.56
smart00299140 CLH Clathrin heavy chain repeat homology. 95.51
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.47
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.3
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.2
PF14669233 Asp_Glu_race_2: Putative aspartate racemase 95.09
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.06
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.74
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.73
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.69
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.69
PF1342844 TPR_14: Tetratricopeptide repeat 94.67
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.61
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.44
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.33
KOG1585308 consensus Protein required for fusion of vesicles 94.32
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.24
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.2
PRK15331165 chaperone protein SicA; Provisional 94.18
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.18
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.18
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.17
COG4700251 Uncharacterized protein conserved in bacteria cont 94.07
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.95
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.9
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 93.83
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.76
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.71
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.61
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 93.55
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 93.49
COG3629280 DnrI DNA-binding transcriptional activator of the 93.46
PRK15331165 chaperone protein SicA; Provisional 93.36
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.14
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.02
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 93.01
PF13929292 mRNA_stabil: mRNA stabilisation 92.95
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 92.82
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.79
PF13512142 TPR_18: Tetratricopeptide repeat 92.42
KOG4555175 consensus TPR repeat-containing protein [Function 92.39
COG3898531 Uncharacterized membrane-bound protein [Function u 92.33
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.33
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 92.3
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 91.96
PF1342844 TPR_14: Tetratricopeptide repeat 91.63
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.6
COG3629280 DnrI DNA-binding transcriptional activator of the 91.32
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.26
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.94
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 90.88
KOG1941 518 consensus Acetylcholine receptor-associated protei 90.81
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.02
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 89.93
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.78
KOG4555175 consensus TPR repeat-containing protein [Function 89.76
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 89.72
PF13512142 TPR_18: Tetratricopeptide repeat 89.68
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 89.61
KOG4570418 consensus Uncharacterized conserved protein [Funct 89.52
COG4105254 ComL DNA uptake lipoprotein [General function pred 89.51
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 88.36
COG4649221 Uncharacterized protein conserved in bacteria [Fun 88.27
PRK11906458 transcriptional regulator; Provisional 88.04
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 87.57
PF13762145 MNE1: Mitochondrial splicing apparatus component 87.47
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 87.4
COG3118304 Thioredoxin domain-containing protein [Posttransla 87.16
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 86.64
PF1343134 TPR_17: Tetratricopeptide repeat 86.27
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.23
PRK11906458 transcriptional regulator; Provisional 86.21
COG3118304 Thioredoxin domain-containing protein [Posttransla 86.19
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 86.09
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.04
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 86.01
PF1343134 TPR_17: Tetratricopeptide repeat 85.87
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 85.69
KOG1585308 consensus Protein required for fusion of vesicles 85.48
PF13929292 mRNA_stabil: mRNA stabilisation 85.38
KOG2610 491 consensus Uncharacterized conserved protein [Funct 85.29
PF13934226 ELYS: Nuclear pore complex assembly 85.08
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 84.92
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 84.83
KOG4234271 consensus TPR repeat-containing protein [General f 84.02
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.8
PRK13342413 recombination factor protein RarA; Reviewed 83.27
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 83.23
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 83.16
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.88
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 82.75
COG4649221 Uncharacterized protein conserved in bacteria [Fun 82.56
KOG2610491 consensus Uncharacterized conserved protein [Funct 82.44
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.3
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 82.16
COG4455273 ImpE Protein of avirulence locus involved in tempe 81.65
COG3947361 Response regulator containing CheY-like receiver a 81.04
PRK09687280 putative lyase; Provisional 80.58
COG3898 531 Uncharacterized membrane-bound protein [Function u 80.26
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.5e-58  Score=446.82  Aligned_cols=360  Identities=15%  Similarity=0.171  Sum_probs=342.2

Q ss_pred             ccccCCChHHHHHHHHHHHHcccch-hhHHh-----------hhhhHHHHHhhhCCCChhhHHHHHHHHHhhhccCChHH
Q 040338            3 ACGSLKSLPIARKIHAQLISTCLIS-SIFLQ-----------LIDDDYRVFCDIGPRYLFTYNTMINGGVRCLCVGNIKM   70 (385)
Q Consensus         3 ~~~~~~~~~~a~~~~~~~~~~~~~~-~~~~~-----------~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~~~~   70 (385)
                      .|.+.|+++.|+++|++|.+.++.+ +...+           .+++|.++|+.|+.||..+||.+|.+|++   .|+++.
T Consensus       379 ~l~r~G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~pd~~Tyn~LL~a~~k---~g~~e~  455 (1060)
T PLN03218        379 RLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRNPTLSTFNMLMSVCAS---SQDIDG  455 (1060)
T ss_pred             HHHHCcCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCCCCHHHHHHHHHHHHh---CcCHHH
Confidence            4667899999999999999999654 33332           69999999999999999999999999777   899999


Q ss_pred             HHHHHHHHHHhccCCCchHHHhHHHHHHhcCChhHHHHHHHhccCCCccccccchHHHHHHhcCCCCCCcchHHHHHHHH
Q 040338           71 ALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQKMPERDLVSWNTMISIL  150 (385)
Q Consensus        71 a~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~li~~~  150 (385)
                      |.++|++|.+.|+.||..+|++||.+|++.|++++|.++|++|.+.|+                  .||..+|+.||.+|
T Consensus       456 A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv------------------~PdvvTynaLI~gy  517 (1060)
T PLN03218        456 ALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGV------------------EANVHTFGALIDGC  517 (1060)
T ss_pred             HHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCC------------------CCCHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999998                  89999999999999


Q ss_pred             HhCCCchHHHHHHHHHHHCCCCCCHhhHHHHHHHhcCccCccchhhHHHHHHH--hCCCCchHHHHHHHHHHHhcCCCC-
Q 040338          151 TRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRVVH--MEPSLDVFVGSGLIDMYLKCGCNG-  227 (385)
Q Consensus       151 ~~~~~~~~a~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~--~~~~~~~~~~~~li~~~~~~g~~~-  227 (385)
                      ++.|++++|.++|++|.+.|+.||..||+.+|.+|++.|++++|.++|++|..  .|+.||..+|+++|.+|++.|+.+ 
T Consensus       518 ~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~lde  597 (1060)
T PLN03218        518 ARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDR  597 (1060)
T ss_pred             HHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHH
Confidence            99999999999999999999999999999999999999999999999999987  678999999999999999999876 


Q ss_pred             ------------CCchhhHHHHHHHHHHcCCChhHHHHHHHhccc----CChhhHHHHHHHHHhcCCCCchHHHH-----
Q 040338          228 ------------IESSIQIGKALVTMYAEGGSTQKADLAFELMSR----RNMISWMVLISAFSQAGVLEKPRFFF-----  286 (385)
Q Consensus       228 ------------~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~----~~~~~~~~li~~~~~~g~~~~a~~~~-----  286 (385)
                                  +.|+..+|+.+|.+|++.|++++|.++|++|.+    ||..+|+.+|.+|++.|++++|.+++     
T Consensus       598 A~elf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k  677 (1060)
T PLN03218        598 AKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARK  677 (1060)
T ss_pred             HHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHH
Confidence                        789999999999999999999999999999985    79999999999999999999999999     


Q ss_pred             --------HHHHHHHHhcccCChhhHHHHHHHHHhccc---hhhHHHHHHHHHccCCHHHHHHHHHhCCCC---CCcchH
Q 040338          287 --------FFVSLLSGCSHSGPVTKGKHYFTAMAKFTY---TCYFVCMVDLLGLSGLLGEAKKLIDEMPSK---PTCVIW  352 (385)
Q Consensus       287 --------~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~---~~~~~~li~~~~~~g~~~~A~~~~~~m~~~---p~~~~~  352 (385)
                              +|+.+|.+|++.|++++|.++|++|.+.+.   ..+|++||.+|++.|++++|.++|++|...   ||..||
T Consensus       678 ~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty  757 (1060)
T PLN03218        678 QGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITY  757 (1060)
T ss_pred             cCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHH
Confidence                    999999999999999999999999998776   889999999999999999999999999864   999999


Q ss_pred             HHHHHHHHhcCChHHHHHHHHHHHhccccCC
Q 040338          353 GALLGACCSHYNTKLAELVMRNLLQLDVKVF  383 (385)
Q Consensus       353 ~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~  383 (385)
                      ++++.+|++.|++++|.+++++|.+.|+.|.
T Consensus       758 ~sLL~a~~k~G~le~A~~l~~~M~k~Gi~pd  788 (1060)
T PLN03218        758 SILLVASERKDDADVGLDLLSQAKEDGIKPN  788 (1060)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHcCCCCC
Confidence            9999999999999999999999999998875



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14669 Asp_Glu_race_2: Putative aspartate racemase Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13934 ELYS: Nuclear pore complex assembly Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query385
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 42.1 bits (98), Expect = 3e-04
 Identities = 39/263 (14%), Positives = 75/263 (28%), Gaps = 73/263 (27%)

Query: 7   LKSLPIARKIHAQLISTCLISSIFLQLIDDD------YRVFCDIGPRYLFT------YNT 54
           L+ L +  K +      CL       L+  +      +  F ++  + L T       + 
Sbjct: 234 LRRL-LKSKPYEN----CL-------LVLLNVQNAKAWNAF-NLSCKILLTTRFKQVTDF 280

Query: 55  MINGGVRCLCVGNIKMALHLH---GLVKKFYFVSDES---------------IAKSSIDM 96
           +       + + +  M L       L+ K+     +                IA+S  D 
Sbjct: 281 LSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDG 340

Query: 97  --------HVKCGAVDYAESAFLRMLNPSLFCWKFGIIRLLIMFQ---KMPERDLVS-WN 144
                   HV C  +     + L +L P+ +   F     L +F     +P   L   W 
Sbjct: 341 LATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMF---DRLSVFPPSAHIPTILLSLIWF 397

Query: 145 TMISILTRHGFGFETLC---TFIELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRV 201
            +I                 + +E       +S  + +     +  + +      LH  +
Sbjct: 398 DVIKSDVMV---VVNKLHKYSLVEKQPKESTIS--IPSIYLELKVKLENE---YALHRSI 449

Query: 202 VHMEPSLDVFVGSGL----IDMY 220
           V        F    L    +D Y
Sbjct: 450 VDHYNIPKTFDSDDLIPPYLDQY 472


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query385
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.98
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.98
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.88
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.84
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.84
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.81
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.75
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.71
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.69
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.69
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.69
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.66
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.61
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.58
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.58
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.58
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.58
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.57
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.55
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.54
3u4t_A272 TPR repeat-containing protein; structural genomics 99.53
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.52
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.5
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.49
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.48
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.47
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.46
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.46
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.46
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.46
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.45
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.44
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.43
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.43
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.42
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.42
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.41
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.41
3u4t_A272 TPR repeat-containing protein; structural genomics 99.41
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.41
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.4
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.4
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.39
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.39
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.38
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.38
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.33
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.33
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.31
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.26
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.23
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.22
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.22
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.22
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.19
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.18
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.17
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.14
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.09
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.09
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.08
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.07
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.07
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.03
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.01
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.98
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.96
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.96
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.9
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.83
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.81
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.8
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.8
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.78
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.76
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.76
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.74
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.72
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.71
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.71
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.7
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.67
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.65
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.64
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.64
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.63
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.59
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.59
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.58
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.58
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.58
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.55
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.52
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.51
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.5
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.5
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.46
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.45
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.45
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.44
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.44
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.41
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.39
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.36
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.35
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.34
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.34
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.33
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.3
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.29
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.29
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.28
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.27
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.27
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.25
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.25
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.25
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.24
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.22
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.21
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.19
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.15
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.15
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.13
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.12
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.12
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.08
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.07
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.05
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.03
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.02
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.02
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.02
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.01
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.01
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.01
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.0
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.0
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.0
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.98
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.98
3k9i_A117 BH0479 protein; putative protein binding protein, 97.97
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.96
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.91
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.9
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.9
3k9i_A117 BH0479 protein; putative protein binding protein, 97.86
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.85
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.85
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.85
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.81
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.78
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.77
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.7
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.67
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.66
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.65
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.64
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 97.59
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.56
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.54
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.53
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.51
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.5
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.48
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.43
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.43
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.35
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.3
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.28
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.2
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.16
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.16
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.04
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.03
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.02
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.99
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.93
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.92
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.91
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.84
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.76
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.74
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.69
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.69
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.66
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.4
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.36
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.32
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.26
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.24
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.17
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.15
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.09
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.9
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.42
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.19
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.15
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.05
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.03
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.86
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.23
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.17
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.85
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.8
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.1
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.8
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 92.76
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.58
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.34
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.92
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 89.23
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.21
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 87.14
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.99
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 86.49
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.71
2uwj_G115 Type III export protein PSCG; virulence, chaperone 84.46
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 84.41
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 84.11
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 83.54
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 83.05
2p58_C116 Putative type III secretion protein YSCG; type III 82.8
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.92
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=5.8e-34  Score=272.09  Aligned_cols=377  Identities=9%  Similarity=-0.042  Sum_probs=328.0

Q ss_pred             cccccCCChHHHHHHHHHHHHcccchhhHHh---------hhhhHHHHHhhh--CCCChhhHHHHHHHHHhhhccCChHH
Q 040338            2 KACGSLKSLPIARKIHAQLISTCLISSIFLQ---------LIDDDYRVFCDI--GPRYLFTYNTMINGGVRCLCVGNIKM   70 (385)
Q Consensus         2 ~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~---------~~~~A~~~~~~~--~~~~~~~~~~li~~~~~~~~~~~~~~   70 (385)
                      +.|.+.|+++.|..+++++......+..+..         ++++|..+|+++  ..+++.+|+.++.++.+   .|++++
T Consensus        92 ~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~---~g~~~~  168 (597)
T 2xpi_A           92 HDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAFCLVK---LYDWQG  168 (597)
T ss_dssp             HHHHHTTCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGGGTCHHHHHHHHHHHHH---TTCHHH
T ss_pred             HHHHHccCchHHHHHHHHHHhhCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhccccchhHHHHHHHHHHH---HhhHHH
Confidence            3567889999999999999965543322222         899999999998  47889999999999888   899999


Q ss_pred             HHHHHHHHHHh---------------ccCCCchHHHhHHHHHHhcCChhHHHHHHHhccCCCcc----------------
Q 040338           71 ALHLHGLVKKF---------------YFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLF----------------  119 (385)
Q Consensus        71 a~~~~~~m~~~---------------g~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~----------------  119 (385)
                      |.++|+++...               |.+++..+|+.++.+|.+.|++++|.++|++|.+.++.                
T Consensus       169 A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~  248 (597)
T 2xpi_A          169 ALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVSNHLLTA  248 (597)
T ss_dssp             HHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTCSCH
T ss_pred             HHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCchhhHHHHHHHHhhcccc
Confidence            99999953221               22345789999999999999999999999999654321                


Q ss_pred             ----------------------------------ccccchHHHHHHhcCCCC--CCcchHHHHHHHHHhCCCchHHHHHH
Q 040338          120 ----------------------------------CWKFGIIRLLIMFQKMPE--RDLVSWNTMISILTRHGFGFETLCTF  163 (385)
Q Consensus       120 ----------------------------------~~~~~~~~a~~~~~~~~~--~~~~~~~~li~~~~~~~~~~~a~~~~  163 (385)
                                                        ...|++++|.++|+++..  ++..+|+.++.+|.+.|++++|..+|
T Consensus       249 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~  328 (597)
T 2xpi_A          249 DEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAIT  328 (597)
T ss_dssp             HHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             hhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHH
Confidence                                              112889999999999976  88999999999999999999999999


Q ss_pred             HHHHHCCCCCCHhhHHHHHHHhcCccCccchhhHHHHHHHhCCCCchHHHHHHHHHHHhcCCCC------------CCch
Q 040338          164 IELWNHGFGLSSMLYATAFSARASVYDLEWGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNG------------IESS  231 (385)
Q Consensus       164 ~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~------------~~~~  231 (385)
                      +++.+.+ +.+..++..++.++.+.|++++|.++++.+.+.. +.+..+++.+...|.+.|+.+            .+.+
T Consensus       329 ~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~  406 (597)
T 2xpi_A          329 TKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQF  406 (597)
T ss_dssp             HHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTC
T ss_pred             HHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCC
Confidence            9999864 3378889999999999999999999999999764 467889999999999999887            4456


Q ss_pred             hhHHHHHHHHHHcCCChhHHHHHHHhccc---CChhhHHHHHHHHHhcCCCCchHHHH------------HHHHHHHHhc
Q 040338          232 IQIGKALVTMYAEGGSTQKADLAFELMSR---RNMISWMVLISAFSQAGVLEKPRFFF------------FFVSLLSGCS  296 (385)
Q Consensus       232 ~~~~~~li~~~~~~g~~~~A~~~~~~m~~---~~~~~~~~li~~~~~~g~~~~a~~~~------------~~~~l~~~~~  296 (385)
                      ..+|+.++.+|.+.|++++|+++|+++.+   ++..+|+.++.+|.+.|++++|++.|            +|+.++..|.
T Consensus       407 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~  486 (597)
T 2xpi_A          407 GPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNELGVVAF  486 (597)
T ss_dssp             HHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHH
Confidence            78999999999999999999999999875   37789999999999999999999999            8999999999


Q ss_pred             ccCChhhHHHHHHHHHhcc------c---hhhHHHHHHHHHccCCHHHHHHHHHhCCCC-C-CcchHHHHHHHHHhcCCh
Q 040338          297 HSGPVTKGKHYFTAMAKFT------Y---TCYFVCMVDLLGLSGLLGEAKKLIDEMPSK-P-TCVIWGALLGACCSHYNT  365 (385)
Q Consensus       297 ~~~~~~~a~~~~~~~~~~~------~---~~~~~~li~~~~~~g~~~~A~~~~~~m~~~-p-~~~~~~~li~~~~~~g~~  365 (385)
                      +.|++++|.++|+++.+..      +   ..++..++.+|.+.|++++|.++|+++.+. | +..+|..+..+|.+.|++
T Consensus       487 ~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~  566 (597)
T 2xpi_A          487 NKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIP  566 (597)
T ss_dssp             HTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCH
T ss_pred             HhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCH
Confidence            9999999999999998762      2   468899999999999999999999998763 4 788999999999999999


Q ss_pred             HHHHHHHHHHHhccccCC
Q 040338          366 KLAELVMRNLLQLDVKVF  383 (385)
Q Consensus       366 ~~a~~~~~~~~~~~~~~~  383 (385)
                      ++|.+.++++.+.+|.++
T Consensus       567 ~~A~~~~~~~l~~~p~~~  584 (597)
T 2xpi_A          567 GLAITHLHESLAISPNEI  584 (597)
T ss_dssp             HHHHHHHHHHHHHCTTCH
T ss_pred             HHHHHHHHHHHhcCCCCh
Confidence            999999999999988754



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query385
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.84
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.77
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.46
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.43
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.05
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.99
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.92
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.86
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.84
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.74
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.7
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.69
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.56
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.54
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.37
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.29
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.21
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.19
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.16
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.13
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.05
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.02
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.0
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.97
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.95
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.94
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.82
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.75
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.74
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.68
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.58
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.49
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.43
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.42
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.4
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.4
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.4
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.19
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.17
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.16
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.14
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.09
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.05
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.92
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.65
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.64
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.35
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.34
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.86
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.69
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.28
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.9
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.96
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 91.55
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 89.91
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 88.36
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 85.33
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.19
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.84  E-value=6.1e-18  Score=149.47  Aligned_cols=307  Identities=9%  Similarity=0.033  Sum_probs=212.3

Q ss_pred             ChhhHHHHHHHHHhhhccCChHHHHHHHHHHHHhccCCCchHHHhHHHHHHhcCChhHHHHHHHhccCCCccccc-----
Q 040338           48 YLFTYNTMINGGVRCLCVGNIKMALHLHGLVKKFYFVSDESIAKSSIDMHVKCGAVDYAESAFLRMLNPSLFCWK-----  122 (385)
Q Consensus        48 ~~~~~~~li~~~~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~~~-----  122 (385)
                      ++..+..+...+..   .|++++|...++...+.. +-+..++..+..+|.+.|++++|...+....+.+.....     
T Consensus        32 ~~~~~~~la~~~~~---~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~  107 (388)
T d1w3ba_          32 NTGVLLLLSSIHFQ---CRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINL  107 (388)
T ss_dssp             CHHHHHHHHHHHHH---TTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHH
T ss_pred             CHHHHHHHHHHHHH---cCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhccccccccccccccccccccccccccc
Confidence            45566666666555   788888888888888764 335677888888888888888888888777554332111     


Q ss_pred             -------cchHHHHHH---hcCCCCCCcchHHHHHHHHHhCCCchHHHHHHHHHHHCCCCCCHhhHHHHHHHhcCccCcc
Q 040338          123 -------FGIIRLLIM---FQKMPERDLVSWNTMISILTRHGFGFETLCTFIELWNHGFGLSSMLYATAFSARASVYDLE  192 (385)
Q Consensus       123 -------~~~~~a~~~---~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~  192 (385)
                             +....+...   ......................+....+...+....... +-+...+..+...+...|+++
T Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~  186 (388)
T d1w3ba_         108 AAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIW  186 (388)
T ss_dssp             HHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHH
Confidence                   000000000   001112333344445555566666667776666665541 224556666677777778888


Q ss_pred             chhhHHHHHHHhCCCCchHHHHHHHHHHHhcCCCCCCchhhHHHHHHHHHHcCCChhHHHHHHHhccc---CChhhHHHH
Q 040338          193 WGPHLHSRVVHMEPSLDVFVGSGLIDMYLKCGCNGIESSIQIGKALVTMYAEGGSTQKADLAFELMSR---RNMISWMVL  269 (385)
Q Consensus       193 ~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~---~~~~~~~~l  269 (385)
                      +|...++...+..+                       .+..++..+...+...|++++|...++...+   .+...+..+
T Consensus       187 ~A~~~~~~al~~~p-----------------------~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l  243 (388)
T d1w3ba_         187 LAIHHFEKAVTLDP-----------------------NFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNL  243 (388)
T ss_dssp             HHHHHHHHHHHHCT-----------------------TCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHH
T ss_pred             HHHHHHHHHHHhCc-----------------------ccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHH
Confidence            88888777766532                       1233445666667777778888877776654   345566667


Q ss_pred             HHHHHhcCCCCchHHHH------------HHHHHHHHhcccCChhhHHHHHHHHHhccc--hhhHHHHHHHHHccCCHHH
Q 040338          270 ISAFSQAGVLEKPRFFF------------FFVSLLSGCSHSGPVTKGKHYFTAMAKFTY--TCYFVCMVDLLGLSGLLGE  335 (385)
Q Consensus       270 i~~~~~~g~~~~a~~~~------------~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~--~~~~~~li~~~~~~g~~~~  335 (385)
                      ...+.+.|++++|+..+            ++..+...+...|++++|.+.++......+  ...+..+...+.+.|++++
T Consensus       244 ~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  323 (388)
T d1w3ba_         244 ACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEE  323 (388)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHH
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHH
Confidence            77777788888777777            677778888888888999999988887776  7777888888999999999


Q ss_pred             HHHHHHhCCCC-CC-cchHHHHHHHHHhcCChHHHHHHHHHHHhccccC
Q 040338          336 AKKLIDEMPSK-PT-CVIWGALLGACCSHYNTKLAELVMRNLLQLDVKV  382 (385)
Q Consensus       336 A~~~~~~m~~~-p~-~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~  382 (385)
                      |++.|++..+. |+ ..+|..+...|...|++++|...+++.++.+|..
T Consensus       324 A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~  372 (388)
T d1w3ba_         324 AVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTF  372 (388)
T ss_dssp             HHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTC
T ss_pred             HHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC
Confidence            99999987763 54 5578888899999999999999999998887764



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure