Citrus Sinensis ID: 040360


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MLEKSSSGYRTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELPMHARFITVQVQCKSKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAKGDKNGIINVSVRSLKVAADQHASSSNYLSKAPRLNVQGYVPAYSGFASGFGAPVGGVVTGVPVWCANRA
ccccccccccEEEEEEEEEccccccccccccccEEEEEEcccccEEEEEEccccccccccccEEEEEEccccccEEEEEEEEEEEccccccccccEEEEEEEEEcccccccccccccEEEEEEEEEcccccccEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEcccccccc
cccccccccEEEEEEEEEccccccccccccccEEEEEEEcccccccEEEcccccccccccccEEEEEccccccEEEEEEEEEEccccccccccccccEEEEEEEHHHHHccccccccEEEEEEEEEcccccccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccc
mleksssgyrtieltvlsgedlrIDRRLIKKNAFAIVqtdtsfdycttkvdesggshpswnekLVIELPMHARFITVQVQCkskssssgnnnnhnkivgfaripvsdfiggyapeNYLHFLSYRLRnakgdkngiiNVSVRSLKVAAdqhasssnylskaprlnvqgyvpaysgfasgfgapvggvvTGVPVWCANRA
mleksssgyrtieltvlsgedlriDRRLIKKNAfaivqtdtsfdyCTTKvdesggshpswNEKLVIELPMHARFITVQVQCKSKssssgnnnnhNKIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAKGDKNGIINVSVRSLKVAADQHASssnylskaprlNVQGYVPAYSGFASGFGAPVGGVVTGVPVWCANRA
MLEKSSSGYRTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELPMHARFITVQVQCkskssssgnnnnhnkIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAKGDKNGIINVSVRSLKVAADQHASSSNYLSKAPRLNVQGYVPAYSGFASgfgapvggvvtgvpvWCANRA
*********RTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELPMHARFITVQVQC*************NKIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAKGDKNGIINVSVRSLKVAA********YLSKAPRLNVQGYVPAYSGFASGFGAPVGGVVTGVPVWCA***
*************LTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDY*TTKVDESGGSHPSWNEKLVIELPMHARFITVQVQCKSKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFLSY******GDKNGIINVSVRS*******************************************VVTGVPVWCA***
********YRTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELPMHARFITVQ************NNNHNKIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAKGDKNGIINVSVRSLK***********YLSKAPRLNVQGYVPAYSGFASGFGAPVGGVVTGVPVWCANRA
*****SSGYRTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELPMHARFITVQVQCKSKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAKGDKNGIINVSVRSLKVAA**************************G*******PVGGVVTGVPVWCANR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEKSSSGYRTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELPMHARFITVQVQCKSKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAKGDKNGIINVSVRSLKVAADQHASSSNYLSKAPRLNVQGYVPAYSGFASGFGAPVGGVVTGVPVWCANRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q58FX0207 BON1-associated protein 2 yes no 0.898 0.859 0.403 3e-33
Q941L2192 BON1-associated protein 1 no no 0.808 0.833 0.364 1e-23
>sp|Q58FX0|BAP2_ARATH BON1-associated protein 2 OS=Arabidopsis thaliana GN=BAP2 PE=1 SV=1 Back     alignment and function desciption
 Score =  141 bits (356), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 122/203 (60%), Gaps = 25/203 (12%)

Query: 10  RTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELP 69
           R++E+ V+S E L++DR+ +KK  +++V+ D       +KVDE GGS+P W ++  +E+P
Sbjct: 8   RSLEIEVISAEGLKVDRKPLKKKTYSVVRIDEK--SWASKVDELGGSYPIWKDRFDMEMP 65

Query: 70  MHA--RFITVQVQCKSKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFLSYRLRN 127
           ++A  RFI+++V  ++  S SG + N    VG+A+IPV+DF+GG+AP+ +L+FLSYRLR+
Sbjct: 66  INASVRFISIEVYYRT--SGSGRDKN----VGYAKIPVTDFMGGFAPQGHLNFLSYRLRD 119

Query: 128 AKGDKNGIINVSVR---------------SLKVAADQHASSSNYLSKAPRLNVQGYVPAY 172
             GDK GI+NVS+                S  VA   +A+ S   + A R N        
Sbjct: 120 EYGDKCGIVNVSIMVKPDGNDHKSSLPSSSFAVAPVDYAACSWQATAAARNNQMWRPRTS 179

Query: 173 SGFASGFGAPVGGVVTGVPVWCA 195
           S   S  G   G VVTGVPVWCA
Sbjct: 180 SSMVSTAGYGGGRVVTGVPVWCA 202




Negative regulator of cell death and defense responses. Exhibits calcium-dependent phospholipid binding properties.
Arabidopsis thaliana (taxid: 3702)
>sp|Q941L2|BAP1_ARATH BON1-associated protein 1 OS=Arabidopsis thaliana GN=BAP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
351723595179 uncharacterized protein LOC100527075 [Gl 0.813 0.899 0.489 9e-41
255541484179 conserved hypothetical protein [Ricinus 0.863 0.955 0.451 7e-40
255541486196 conserved hypothetical protein [Ricinus 0.888 0.897 0.466 2e-38
224067852183 predicted protein [Populus trichocarpa] 0.858 0.928 0.441 5e-38
388513941171 unknown [Lotus japonicus] 0.787 0.912 0.463 6e-38
225453712176 PREDICTED: BON1-associated protein 2-lik 0.611 0.687 0.587 8e-38
380706600176 BAP1 [Vitis vinifera] 0.611 0.687 0.587 8e-38
147802422176 hypothetical protein VITISV_017490 [Viti 0.611 0.687 0.580 3e-37
356520454177 PREDICTED: BON1-associated protein 2-lik 0.813 0.909 0.479 1e-36
351724213175 uncharacterized protein LOC100500298 [Gl 0.823 0.931 0.497 1e-36
>gi|351723595|ref|NP_001238308.1| uncharacterized protein LOC100527075 [Glycine max] gi|255631498|gb|ACU16116.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 95/194 (48%), Positives = 131/194 (67%), Gaps = 33/194 (17%)

Query: 10  RTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELP 69
           RT+E+TVLS E+L+++++ I+ NAF  VQ+D S D   T VD  GGS+PSWNEKLV+++P
Sbjct: 3   RTVEITVLSAENLQMNKKPIRGNAFVTVQSDASNDTSATTVDSEGGSYPSWNEKLVMDVP 62

Query: 70  MHARFITVQVQCKSKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAK 129
           +HARFITV+V+C  K+SS+G+N+     +G ARIPVSDF+GGY PEN LHFLSYRL + K
Sbjct: 63  LHARFITVEVKC--KTSSAGSNS-----IGVARIPVSDFVGGYVPENQLHFLSYRLWDGK 115

Query: 130 GDKNGIINVSVRSLKVA----ADQHASSSNYLSKAPRLNVQGYVPAYSGFASGFGAPVG- 184
             +NG++N+SVR +KVA      QH+ +SN +S +  +                G PV  
Sbjct: 116 VRRNGVVNISVR-VKVAQQQQQQQHSCNSNSMSLSSAVT---------------GVPVAG 159

Query: 185 ----GVVTGVP-VW 193
               GVVTG+P +W
Sbjct: 160 NGSTGVVTGIPAIW 173




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255541484|ref|XP_002511806.1| conserved hypothetical protein [Ricinus communis] gi|223548986|gb|EEF50475.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|255541486|ref|XP_002511807.1| conserved hypothetical protein [Ricinus communis] gi|223548987|gb|EEF50476.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224067852|ref|XP_002302565.1| predicted protein [Populus trichocarpa] gi|222844291|gb|EEE81838.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388513941|gb|AFK45032.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225453712|ref|XP_002271138.1| PREDICTED: BON1-associated protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|380706600|gb|AFD97530.1| BAP1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147802422|emb|CAN72571.1| hypothetical protein VITISV_017490 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356520454|ref|XP_003528877.1| PREDICTED: BON1-associated protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|351724213|ref|NP_001236026.1| uncharacterized protein LOC100500298 [Glycine max] gi|255629968|gb|ACU15336.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
TAIR|locus:2050782207 BAP2 "AT2G45760" [Arabidopsis 0.722 0.690 0.403 1.4e-25
TAIR|locus:2098931192 BAP1 "BON association protein 0.611 0.630 0.386 6.5e-19
TAIR|locus:2041654 401 AT2G13350 "AT2G13350" [Arabido 0.606 0.299 0.248 2.9e-07
TAIR|locus:2197868 601 AT1G04540 "AT1G04540" [Arabido 0.636 0.209 0.260 0.00015
TAIR|locus:2172828219 AT5G23950 "AT5G23950" [Arabido 0.318 0.287 0.378 0.0006
TAIR|locus:2050782 BAP2 "AT2G45760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 290 (107.1 bits), Expect = 1.4e-25, P = 1.4e-25
 Identities = 63/156 (40%), Positives = 101/156 (64%)

Query:    10 RTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELP 69
             R++E+ V+S E L++DR+ +KK  +++V+ D       +KVDE GGS+P W ++  +E+P
Sbjct:     8 RSLEIEVISAEGLKVDRKPLKKKTYSVVRIDEKS--WASKVDELGGSYPIWKDRFDMEMP 65

Query:    70 MHA--RFITVQVQCXXXXXXXXXXXXXXXIVGFARIPVSDFIGGYAPENYLHFLSYRLRN 127
             ++A  RFI+++V                  VG+A+IPV+DF+GG+AP+ +L+FLSYRLR+
Sbjct:    66 INASVRFISIEVYYRTSGSGRDKN------VGYAKIPVTDFMGGFAPQGHLNFLSYRLRD 119

Query:   128 AKGDKNGIINVSVRSLKVAADQHASS--SNYLSKAP 161
               GDK GI+NVS+  +K   + H SS  S+  + AP
Sbjct:   120 EYGDKCGIVNVSIM-VKPDGNDHKSSLPSSSFAVAP 154




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009693 "ethylene biosynthetic process" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2098931 BAP1 "BON association protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041654 AT2G13350 "AT2G13350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197868 AT1G04540 "AT1G04540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172828 AT5G23950 "AT5G23950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58FX0BAP2_ARATHNo assigned EC number0.40390.89890.8599yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 2e-37
smart00239101 smart00239, C2, Protein kinase C conserved region 1e-07
cd00030102 cd00030, C2, C2 domain 2e-07
pfam0016885 pfam00168, C2, C2 domain 9e-04
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
 Score =  125 bits (316), Expect = 2e-37
 Identities = 43/133 (32%), Positives = 69/133 (51%), Gaps = 13/133 (9%)

Query: 11  TIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELP- 69
           T+E+T++S EDL+      K   +A+V  D S    +T VD  GG++P+WNE L   L  
Sbjct: 1   TLEITIISAEDLKNVNLFGKMKVYAVVWIDPS-HKQSTPVDRDGGTNPTWNETLRFPLDE 59

Query: 70  ----MHARFITVQVQCKSKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFLSYRL 125
                    +T++V C+         +  +K++G  R+P+ D + G +P   L FLSY+L
Sbjct: 60  RLLQQGRLALTIEVYCE-------RPSLGDKLIGEVRVPLKDLLDGASPAGELRFLSYQL 112

Query: 126 RNAKGDKNGIINV 138
           R   G   G++N 
Sbjct: 113 RRPSGKPQGVLNF 125


SRC2 production is a response to pathogen infiltration. The initial response of increased Ca2+ concentrations are coupled to downstream signal transduction pathways via calcium binding proteins. SRC2 contains a single C2 domain which localizes to the plasma membrane and is involved in Ca2+ dependent protein binding. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Length = 125

>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.94
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.93
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.91
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.91
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.9
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.9
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.89
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.89
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.89
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.89
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.89
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.89
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.88
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.88
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.87
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.87
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.86
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.86
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.86
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.86
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.86
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.85
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.85
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.85
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.85
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.84
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.84
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.83
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.82
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.82
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.82
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.82
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.82
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.81
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.81
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.81
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.81
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.8
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.8
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.8
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.8
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.8
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.8
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.8
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.8
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.79
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.79
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.79
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.79
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.79
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.78
PLN03008 868 Phospholipase D delta 99.78
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.78
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.78
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.78
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.77
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.77
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.77
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.77
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.76
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.76
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.76
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.76
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.75
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.75
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.75
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.74
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.74
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.74
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.74
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.72
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.72
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.71
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.71
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.71
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.7
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.7
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.69
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.69
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.68
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.68
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.68
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.68
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.68
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.68
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.67
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.66
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.66
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.66
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.65
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.65
PLN02270 808 phospholipase D alpha 99.63
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.62
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.62
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.57
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.56
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 99.55
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.54
PLN02223537 phosphoinositide phospholipase C 99.52
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.51
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.49
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.47
PLN02952599 phosphoinositide phospholipase C 99.47
PLN02228567 Phosphoinositide phospholipase C 99.38
PLN02230598 phosphoinositide phospholipase C 4 99.37
PLN02222581 phosphoinositide phospholipase C 2 99.34
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.33
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 99.32
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.32
KOG0169746 consensus Phosphoinositide-specific phospholipase 99.31
PLN02352 758 phospholipase D epsilon 99.31
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.24
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.12
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.97
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.94
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.73
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 98.54
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.31
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 98.22
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 98.21
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.11
KOG3837523 consensus Uncharacterized conserved protein, conta 98.02
PLN02964 644 phosphatidylserine decarboxylase 97.92
KOG10111283 consensus Neurotransmitter release regulator, UNC- 97.71
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 97.71
PF11618107 DUF3250: Protein of unknown function (DUF3250); In 97.68
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 97.68
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 97.57
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 97.37
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.36
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.28
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 97.22
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 97.16
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 97.15
PF15627156 CEP76-C2: CEP76 C2 domain 96.79
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 96.79
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 96.77
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 96.51
KOG1452 442 consensus Predicted Rho GTPase-activating protein 96.25
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 96.2
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 96.1
KOG1327 529 consensus Copine [Signal transduction mechanisms] 96.05
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 96.03
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 95.92
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 95.89
cd08397159 C2_PI3K_class_III C2 domain present in class III p 95.65
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 95.33
cd08679178 C2_DOCK180_related C2 domains found in Dedicator O 94.93
cd08696179 C2_Dock-C C2 domains found in Dedicator Of CytoKin 94.47
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 93.84
cd08697185 C2_Dock-D C2 domains found in Dedicator Of CytoKin 93.21
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 93.04
KOG1329 887 consensus Phospholipase D1 [Lipid transport and me 92.07
PTZ00447 508 apical membrane antigen 1-like protein; Provisiona 88.51
PF06219 460 DUF1005: Protein of unknown function (DUF1005); In 88.23
PF14924112 DUF4497: Protein of unknown function (DUF4497) 88.22
PF07162168 B9-C2: Ciliary basal body-associated, B9 protein; 85.0
KOG3543 1218 consensus Ca2+-dependent activator protein [Signal 82.88
PF14186147 Aida_C2: Cytoskeletal adhesion; PDB: 2QZQ_A 2QZ5_A 80.83
KOG1327 529 consensus Copine [Signal transduction mechanisms] 80.69
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
Probab=99.94  E-value=4.7e-26  Score=174.49  Aligned_cols=117  Identities=17%  Similarity=0.325  Sum_probs=101.3

Q ss_pred             eEEEEEEEEeeCCCCCCCCCcCCcEEEEEECCCCcEEEeeeecCCCCCCeeeeEEEEEecCCCcEEEEEEEeCCCCCCCC
Q 040360           10 RTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELPMHARFITVQVQCKSKSSSSG   89 (198)
Q Consensus        10 ~~LeVtVlsA~~L~~~~~~~~~dpYvvv~~~~~~~~~~T~v~~~~g~nP~WNE~f~f~v~~~~~~L~~eV~~~~~~~~~g   89 (198)
                      |+|+|+|++|++|+..+ ++++||||+|+++.  ++++|+++.+++.||+|||+|.|.++.....|.|+|||++.   ++
T Consensus         2 g~L~v~v~~Ak~l~~~~-~g~sDPYv~i~lg~--~~~kT~v~~~~~~nP~WNe~F~f~v~~~~~~l~~~V~d~d~---~~   75 (121)
T cd04016           2 GRLSITVVQAKLVKNYG-LTRMDPYCRIRVGH--AVYETPTAYNGAKNPRWNKTIQCTLPEGVDSIYIEIFDERA---FT   75 (121)
T ss_pred             cEEEEEEEEccCCCcCC-CCCCCceEEEEECC--EEEEeEEccCCCCCCccCeEEEEEecCCCcEEEEEEEeCCC---Cc
Confidence            78999999999998766 78999999999988  88899999887799999999999998766789999999998   67


Q ss_pred             CCCCCCceeEEEEEeCc-cccCCCCCCCceEeEEEEeeCCCCC-ccEEEEEEEE
Q 040360           90 NNNNHNKIVGFARIPVS-DFIGGYAPENYLHFLSYRLRNAKGD-KNGIINVSVR  141 (198)
Q Consensus        90 ~~~~~d~~IG~a~IpL~-~l~~~~~~~~~~~~~sy~L~~~~Gk-~~G~I~lsi~  141 (198)
                      +    |++||++.|+|. .+..+..     ...||+|...+|+ ..|.|||+++
T Consensus        76 ~----dd~iG~~~i~l~~~~~~g~~-----~~~W~~L~~~~~~~~~g~i~l~l~  120 (121)
T cd04016          76 M----DERIAWTHITIPESVFNGET-----LDDWYSLSGKQGEDKEGMINLVFS  120 (121)
T ss_pred             C----CceEEEEEEECchhccCCCC-----ccccEeCcCccCCCCceEEEEEEe
Confidence            3    899999999997 4665532     3469999876664 6899999987



Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice varian

>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins Back     alignment and domain information
>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>KOG1329 consensus Phospholipase D1 [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00447 apical membrane antigen 1-like protein; Provisional Back     alignment and domain information
>PF06219 DUF1005: Protein of unknown function (DUF1005); InterPro: IPR010410 This is a family of plant proteins with undetermined function Back     alignment and domain information
>PF14924 DUF4497: Protein of unknown function (DUF4497) Back     alignment and domain information
>PF07162 B9-C2: Ciliary basal body-associated, B9 protein; InterPro: IPR010796 Proteins in this entry include the MSK1 protein (Q9NXB0 from SWISSPROT) and other known or predicted flagellar basal body proteome components [] or cilia-containing species Back     alignment and domain information
>KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] Back     alignment and domain information
>PF14186 Aida_C2: Cytoskeletal adhesion; PDB: 2QZQ_A 2QZ5_A Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 4e-05
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 5e-04
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
 Score = 40.8 bits (96), Expect = 4e-05
 Identities = 25/131 (19%), Positives = 49/131 (37%), Gaps = 14/131 (10%)

Query: 11  TIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELPM 70
           T+E+ ++S + L     L   + +  +   T      + V E  G+ P WNE  +  +  
Sbjct: 11  TLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQK--SNVAEGMGTTPEWNETFIFTVSE 68

Query: 71  HARFITVQVQCKSKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAKG 130
               +  ++  K       +    +  VG A IP+         E  +   +Y +   + 
Sbjct: 69  GTTELKAKIFDK-------DVGTEDDAVGEATIPLEPVF----VEGSIPPTAYNVVKDEE 117

Query: 131 DKNGIINVSVR 141
            K G I V++ 
Sbjct: 118 YK-GEIWVALS 127


>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.92
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.91
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.91
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.9
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.9
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.89
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.89
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.89
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.88
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.88
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.87
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.87
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.84
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.82
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.81
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.81
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.81
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.81
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.81
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.8
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.8
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.8
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.8
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.79
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.79
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.79
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.79
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.79
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.79
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.79
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.78
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.78
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.78
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.77
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.77
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.77
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.76
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.74
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.73
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.73
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.7
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.64
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.6
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.58
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.53
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.53
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.51
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.5
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.42
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 99.16
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 99.08
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 97.52
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 96.26
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 95.36
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 94.85
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 90.46
2y3a_A 1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 89.68
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
Probab=99.92  E-value=1.2e-24  Score=165.49  Aligned_cols=130  Identities=20%  Similarity=0.268  Sum_probs=111.6

Q ss_pred             CCCCCcceEEEEEEEEeeCCCCCCCCCcCCcEEEEEECCCCcEEEeeeecCCCCCCeeeeEEEEEecCCCcEEEEEEEeC
Q 040360            3 EKSSSGYRTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELPMHARFITVQVQCK   82 (198)
Q Consensus         3 ~~~~m~~~~LeVtVlsA~~L~~~~~~~~~dpYvvv~~~~~~~~~~T~v~~~~g~nP~WNE~f~f~v~~~~~~L~~eV~~~   82 (198)
                      +++.+..+.|+|+|++|++|+..+..++.||||+|++++  ++++|+++++++.||+|||+|.|.+......|.|+|||+
T Consensus         3 ~~~~~~~~~L~v~v~~a~~L~~~d~~g~~dpyv~v~~~~--~~~kT~~~~~~~~nP~Wne~f~f~v~~~~~~l~~~V~d~   80 (136)
T 1wfj_A            3 SGSSGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRT--QDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFDK   80 (136)
T ss_dssp             CCCCCCEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSS--CEEECCCCTTCCSSCEEEEEEEEEEESSCCEEEEEECCS
T ss_pred             CCCCCCcEEEEEEEEeccCCCCcccCCCcCceEEEEECC--ccceeEeccCCCCCCccCcEEEEEECCCCCEEEEEEEEC
Confidence            456778899999999999999878788999999999998  678999998445999999999999987678999999999


Q ss_pred             CCCCCCCCCCCCCceeEEEEEeCccccCCCCCCCceEeEEEEeeCCCCCccEEEEEEEEEeeeCC
Q 040360           83 SKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAKGDKNGIINVSVRSLKVAA  147 (198)
Q Consensus        83 ~~~~~~g~~~~~d~~IG~a~IpL~~l~~~~~~~~~~~~~sy~L~~~~Gk~~G~I~lsi~~f~~~~  147 (198)
                      +.   ++    +|++||++.|+|.++....    .....||+|. +.++..|+|+|+++ |.+..
T Consensus        81 ~~---~~----~d~~lG~~~i~l~~l~~~~----~~~~~w~~L~-~~~~~~G~i~l~l~-~~p~~  132 (136)
T 1wfj_A           81 DV---GT----EDDAVGEATIPLEPVFVEG----SIPPTAYNVV-KDEEYKGEIWVALS-FKPSG  132 (136)
T ss_dssp             SS---CT----TTCCSEEEEEESHHHHHHS----EEEEEEEEEE-ETTEEEEEEEEEEE-EEECC
T ss_pred             CC---CC----CCceEEEEEEEHHHhccCC----CCCcEEEEee-cCCccCEEEEEEEE-EEeCC
Confidence            87   66    3999999999999995432    2356799998 66789999999999 87543



>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.94
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.91
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.9
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.88
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.88
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.87
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.83
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.81
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.8
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.79
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.76
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.74
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.74
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.72
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.71
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.71
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.7
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.69
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.65
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.62
d2yrba1142 Fantom {Human (Homo sapiens) [TaxId: 9606]} 96.78
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 96.78
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.94  E-value=3.4e-26  Score=173.49  Aligned_cols=130  Identities=20%  Similarity=0.271  Sum_probs=111.0

Q ss_pred             CCCCCcceEEEEEEEEeeCCCCCCCCCcCCcEEEEEECCCCcEEEeeeecCCCCCCeeeeEEEEEecCCCcEEEEEEEeC
Q 040360            3 EKSSSGYRTIELTVLSGEDLRIDRRLIKKNAFAIVQTDTSFDYCTTKVDESGGSHPSWNEKLVIELPMHARFITVQVQCK   82 (198)
Q Consensus         3 ~~~~m~~~~LeVtVlsA~~L~~~~~~~~~dpYvvv~~~~~~~~~~T~v~~~~g~nP~WNE~f~f~v~~~~~~L~~eV~~~   82 (198)
                      +++.-..|+|+|+|++|++|+..+..+++||||++++++  +.++|+++++++.||.|||+|.|.+......|+|+|||+
T Consensus         3 ~~~~~p~G~L~V~v~~a~~L~~~d~~g~~Dpyv~v~~~~--~~~~t~~~~~~~~nP~Wne~f~f~v~~~~~~L~v~V~d~   80 (136)
T d1wfja_           3 SGSSGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRT--QDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFDK   80 (136)
T ss_dssp             CCCCCCEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSS--CEEECCCCTTCCSSCEEEEEEEEEEESSCCEEEEEECCS
T ss_pred             CCCCCCcEEEEEEEEEeeCCCCCCCCCCCCccEEEEEee--eeEEEEEEecCCCcEEEeeEEEEEEcCccceEEEEEEEe
Confidence            566777899999999999999888889999999999998  788999988766999999999999987667899999999


Q ss_pred             CCCCCCCCCCCCCceeEEEEEeCccccCCCCCCCceEeEEEEeeCCCCCccEEEEEEEEEeeeCC
Q 040360           83 SKSSSSGNNNNHNKIVGFARIPVSDFIGGYAPENYLHFLSYRLRNAKGDKNGIINVSVRSLKVAA  147 (198)
Q Consensus        83 ~~~~~~g~~~~~d~~IG~a~IpL~~l~~~~~~~~~~~~~sy~L~~~~Gk~~G~I~lsi~~f~~~~  147 (198)
                      +.   ++    +|++||.+.|||.++....    .....+|.|.. .++.+|+|+|+++ |.+..
T Consensus        81 d~---~~----~d~~iG~~~i~L~~l~~~~----~~~~~~~~l~~-~~~~~G~i~l~l~-~~p~~  132 (136)
T d1wfja_          81 DV---GT----EDDAVGEATIPLEPVFVEG----SIPPTAYNVVK-DEEYKGEIWVALS-FKPSG  132 (136)
T ss_dssp             SS---CT----TTCCSEEEEEESHHHHHHS----EEEEEEEEEEE-TTEEEEEEEEEEE-EEECC
T ss_pred             cC---CC----CCCEEEEEEEEhHHhcccC----CcCcEEEEecC-CCccCEEEEEEEE-EEeCC
Confidence            87   66    3899999999999986542    23456888864 5678999999999 97543



>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2yrba1 b.7.1.1 (A:596-737) Fantom {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure