Citrus Sinensis ID: 040429
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 168 | ||||||
| 255537661 | 117 | catalytic, putative [Ricinus communis] g | 0.696 | 1.0 | 0.923 | 5e-58 | |
| 449524902 | 117 | PREDICTED: uncharacterized LOC101214305 | 0.690 | 0.991 | 0.923 | 1e-56 | |
| 297742279 | 650 | unnamed protein product [Vitis vinifera] | 0.684 | 0.176 | 0.904 | 1e-56 | |
| 224072071 | 118 | predicted protein [Populus trichocarpa] | 0.690 | 0.983 | 0.905 | 1e-55 | |
| 359473885 | 116 | PREDICTED: uncharacterized protein LOC10 | 0.684 | 0.991 | 0.904 | 2e-55 | |
| 357481505 | 116 | hypothetical protein MTR_5g009740 [Medic | 0.678 | 0.982 | 0.894 | 9e-55 | |
| 15238137 | 117 | lactoylglutathione lyase family protein | 0.696 | 1.0 | 0.829 | 1e-52 | |
| 351723257 | 116 | uncharacterized protein LOC100500516 [Gl | 0.678 | 0.982 | 0.842 | 8e-52 | |
| 297805484 | 119 | lactoylglutathione lyase family protein | 0.696 | 0.983 | 0.823 | 5e-51 | |
| 356539523 | 117 | PREDICTED: uncharacterized protein LOC10 | 0.678 | 0.974 | 0.826 | 2e-50 |
| >gi|255537661|ref|XP_002509897.1| catalytic, putative [Ricinus communis] gi|223549796|gb|EEF51284.1| catalytic, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 228 bits (582), Expect = 5e-58, Method: Compositional matrix adjust.
Identities = 108/117 (92%), Positives = 111/117 (94%)
Query: 52 MAAASFRWILQLHKDVPKAARFYSEGLDFTVNVCTLRWAELQSGPLKLALMQSPSDHVVQ 111
MAAASFRWILQLHKDVPKAARFYS GLDFTVNVCTLRWAELQSG LKLALMQSP+DHVVQ
Sbjct: 1 MAAASFRWILQLHKDVPKAARFYSHGLDFTVNVCTLRWAELQSGSLKLALMQSPNDHVVQ 60
Query: 112 NGNSSLLSFTVTDINSAVTKLMALGAELDGSIKYEIHGKVAAMRCIDGHMLGLYEPA 168
G SS+LSFTVTDINS VTKLMALGAELDGSIKYEIHGKVAAMRC DGH+LGLYEPA
Sbjct: 61 KGYSSMLSFTVTDINSTVTKLMALGAELDGSIKYEIHGKVAAMRCTDGHVLGLYEPA 117
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449524902|ref|XP_004169460.1| PREDICTED: uncharacterized LOC101214305 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297742279|emb|CBI34428.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224072071|ref|XP_002303619.1| predicted protein [Populus trichocarpa] gi|118482666|gb|ABK93252.1| unknown [Populus trichocarpa] gi|222841051|gb|EEE78598.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359473885|ref|XP_003631373.1| PREDICTED: uncharacterized protein LOC100854951 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357481505|ref|XP_003611038.1| hypothetical protein MTR_5g009740 [Medicago truncatula] gi|355512373|gb|AES93996.1| hypothetical protein MTR_5g009740 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|15238137|ref|NP_198980.1| lactoylglutathione lyase family protein / glyoxalase I family protein [Arabidopsis thaliana] gi|10178019|dbj|BAB11471.1| unnamed protein product [Arabidopsis thaliana] gi|26452670|dbj|BAC43418.1| unknown protein [Arabidopsis thaliana] gi|28827256|gb|AAO50472.1| unknown protein [Arabidopsis thaliana] gi|332007320|gb|AED94703.1| lactoylglutathione lyase family protein / glyoxalase I family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|351723257|ref|NP_001235481.1| uncharacterized protein LOC100500516 [Glycine max] gi|255630518|gb|ACU15617.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297805484|ref|XP_002870626.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. lyrata] gi|297316462|gb|EFH46885.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356539523|ref|XP_003538247.1| PREDICTED: uncharacterized protein LOC100812515 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 168 | ||||||
| TAIR|locus:2160517 | 117 | AT5G41650 "AT5G41650" [Arabido | 0.696 | 1.0 | 0.829 | 1.1e-48 | |
| TAIR|locus:505006200 | 118 | AT1G64185 "AT1G64185" [Arabido | 0.696 | 0.991 | 0.788 | 1.2e-47 | |
| TIGR_CMR|GSU_0119 | 116 | GSU_0119 "glyoxalase family pr | 0.607 | 0.879 | 0.291 | 5.5e-06 |
| TAIR|locus:2160517 AT5G41650 "AT5G41650" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 508 (183.9 bits), Expect = 1.1e-48, P = 1.1e-48
Identities = 97/117 (82%), Positives = 108/117 (92%)
Query: 52 MAAASFRWILQLHKDVPKAARFYSEGLDFTVNVCTLRWAELQSGPLKLALMQSPSDHVVQ 111
MA ASFRWILQLH+DVPKAARFY++GLDF+VNV TLRWAEL SGP+KLALMQSPS+HV +
Sbjct: 1 MATASFRWILQLHRDVPKAARFYAQGLDFSVNVVTLRWAELHSGPIKLALMQSPSNHVAE 60
Query: 112 NGNSSLLSFTVTDINSAVTKLMALGAELDGSIKYEIHGKVAAMRCIDGHMLGLYEPA 168
G SSLLSFTVTDIN+ VTKLMALGAELDG+IKYEIHGKVAAM+C DG+MLGLYE A
Sbjct: 61 KGYSSLLSFTVTDINTTVTKLMALGAELDGTIKYEIHGKVAAMKCPDGYMLGLYEAA 117
|
|
| TAIR|locus:505006200 AT1G64185 "AT1G64185" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0119 GSU_0119 "glyoxalase family protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00002496001 | SubName- Full=Chromosome chr2 scaffold_132, whole genome shotgun sequence; (116 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 168 | |||
| pfam12681 | 109 | pfam12681, Glyoxalase_2, Glyoxalase-like domain | 2e-13 | |
| cd06587 | 110 | cd06587, Glo_EDI_BRP_like, This domain superfamily | 5e-11 | |
| cd08349 | 112 | cd08349, BLMA_like, Bleomycin binding protein (BLM | 8e-07 | |
| cd07263 | 120 | cd07263, Glo_EDI_BRP_like_16, This conserved domai | 1e-04 | |
| cd07264 | 125 | cd07264, Glo_EDI_BRP_like_15, This conserved domai | 1e-04 |
| >gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain | Back alignment and domain information |
|---|
Score = 62.5 bits (152), Expect = 2e-13
Identities = 26/106 (24%), Positives = 41/106 (38%), Gaps = 5/106 (4%)
Query: 65 KDVPKAARFYSEGLDFTVNVCTLRWAELQSG----PLKLALMQSPSDHVVQNGNSSLLSF 120
D+ A FY E L F V +AE + G + + G L F
Sbjct: 4 SDLEAARAFYEELLGFEVEEEDGEYAEFRLGLVLALGGFIELIGLPEPDAPGGGGVHLYF 63
Query: 121 TVTDINSAVTKLMALGAE-LDGSIKYEIHGKVAAMRCIDGHMLGLY 165
V D+++ V +L A G L+ G+ +R DG+++ L
Sbjct: 64 EVDDLDALVARLKAAGGTILEPPEDTPWGGREFYVRDPDGNLIELI 109
|
This domain is related to the Glyoxalase domain pfam00903. Length = 109 |
| >gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >gnl|CDD|211357 cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm | Back alignment and domain information |
|---|
| >gnl|CDD|211353 cd07263, Glo_EDI_BRP_like_16, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176685 cd07264, Glo_EDI_BRP_like_15, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| cd07247 | 114 | SgaA_N_like N-terminal domain of Streptomyces gris | 99.86 | |
| cd08342 | 136 | HPPD_N_like N-terminal domain of 4-hydroxyphenylpy | 99.85 | |
| cd09011 | 120 | Glo_EDI_BRP_like_23 This conserved domain belongs | 99.84 | |
| PRK11478 | 129 | putative lyase; Provisional | 99.84 | |
| cd07264 | 125 | Glo_EDI_BRP_like_15 This conserved domain belongs | 99.83 | |
| cd07243 | 143 | 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg | 99.83 | |
| PRK04101 | 139 | fosfomycin resistance protein FosB; Provisional | 99.83 | |
| cd08363 | 131 | FosB FosB, a fosfomycin resistance protein, cataly | 99.82 | |
| cd07255 | 125 | Glo_EDI_BRP_like_12 This conserved domain belongs | 99.82 | |
| cd08359 | 119 | Glo_EDI_BRP_like_22 This conserved domain belongs | 99.82 | |
| cd08349 | 112 | BLMA_like Bleomycin binding protein (BLMA) and sim | 99.82 | |
| cd08350 | 120 | BLMT_like BLMT, a bleomycin resistance protein enc | 99.81 | |
| cd08351 | 123 | ChaP_like ChaP, an enzyme involved in the biosynth | 99.81 | |
| cd07253 | 125 | Glo_EDI_BRP_like_2 This conserved domain belongs t | 99.81 | |
| cd07263 | 119 | Glo_EDI_BRP_like_16 This conserved domain belongs | 99.81 | |
| cd08364 | 131 | FosX FosX, a fosfomycin resistance protein, cataly | 99.81 | |
| cd07245 | 114 | Glo_EDI_BRP_like_9 This conserved domain belongs t | 99.81 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 99.81 | |
| cd07265 | 122 | 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg | 99.8 | |
| cd07241 | 125 | Glo_EDI_BRP_like_3 This conserved domain belongs t | 99.8 | |
| cd08347 | 157 | PcpA_C_like C-terminal domain of Sphingobium chlor | 99.8 | |
| cd09013 | 121 | BphC-JF8_N_like N-terminal, non-catalytic, domain | 99.8 | |
| cd08356 | 113 | Glo_EDI_BRP_like_17 This conserved domain belongs | 99.8 | |
| PLN02367 | 233 | lactoylglutathione lyase | 99.8 | |
| cd07238 | 112 | Glo_EDI_BRP_like_5 This conserved domain belongs t | 99.8 | |
| cd08361 | 124 | PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma | 99.8 | |
| cd07244 | 121 | FosA FosA, a Fosfomycin resistance protein, cataly | 99.8 | |
| cd07235 | 122 | MRD Mitomycin C resistance protein (MRD). Mitomyci | 99.8 | |
| PF12681 | 108 | Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B | 99.79 | |
| cd07261 | 114 | Glo_EDI_BRP_like_11 This conserved domain belongs | 99.79 | |
| cd08352 | 125 | Glo_EDI_BRP_like_1 This conserved domain belongs t | 99.79 | |
| cd08357 | 125 | Glo_EDI_BRP_like_18 This conserved domain belongs | 99.79 | |
| cd08355 | 122 | Glo_EDI_BRP_like_14 This conserved domain belongs | 99.79 | |
| TIGR03211 | 303 | catechol_2_3 catechol 2,3 dioxygenase. Members of | 99.79 | |
| cd08345 | 113 | Fosfomycin_RP Fosfomycin resistant protein; inhibi | 99.79 | |
| cd07233 | 121 | Glyoxalase_I Glyoxalase I catalyzes the isomerizat | 99.79 | |
| cd07246 | 122 | Glo_EDI_BRP_like_8 This conserved domain belongs t | 99.79 | |
| TIGR03213 | 286 | 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | 99.79 | |
| cd07240 | 117 | ED_TypeI_classII_N N-terminal domain of type I, cl | 99.79 | |
| TIGR03645 | 162 | glyox_marine lactoylglutathione lyase family prote | 99.79 | |
| cd07242 | 128 | Glo_EDI_BRP_like_6 This conserved domain belongs t | 99.78 | |
| TIGR03081 | 128 | metmalonyl_epim methylmalonyl-CoA epimerase. Membe | 99.78 | |
| cd07266 | 121 | HPCD_N_class_II N-terminal domain of 3,4-dihydroxy | 99.78 | |
| cd08354 | 122 | Glo_EDI_BRP_like_13 This conserved domain belongs | 99.78 | |
| cd08360 | 134 | MhqB_like_C C-terminal domain of Burkholderia sp. | 99.78 | |
| cd08348 | 134 | BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro | 99.78 | |
| cd07267 | 113 | THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr | 99.78 | |
| cd07239 | 144 | BphC5-RK37_C_like C-terminal, catalytic, domain of | 99.77 | |
| cd07252 | 120 | BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro | 99.77 | |
| TIGR00068 | 150 | glyox_I lactoylglutathione lyase. Glyoxylase I is | 99.77 | |
| cd07257 | 153 | THT_oxygenase_C The C-terminal domain of 2,4,5-Tri | 99.77 | |
| cd09012 | 124 | Glo_EDI_BRP_like_24 This conserved domain belongs | 99.77 | |
| cd07262 | 123 | Glo_EDI_BRP_like_19 This conserved domain belongs | 99.77 | |
| cd07254 | 120 | Glo_EDI_BRP_like_20 This conserved domain belongs | 99.76 | |
| cd08362 | 120 | BphC5-RrK37_N_like N-terminal, non-catalytic, doma | 99.76 | |
| PF00903 | 128 | Glyoxalase: Glyoxalase/Bleomycin resistance protei | 99.76 | |
| PLN03042 | 185 | Lactoylglutathione lyase; Provisional | 99.76 | |
| cd09014 | 166 | BphC-JF8_C_like C-terminal, catalytic, domain of B | 99.75 | |
| cd08346 | 126 | PcpA_N_like N-terminal domain of Sphingobium chlor | 99.75 | |
| PRK06724 | 128 | hypothetical protein; Provisional | 99.75 | |
| cd07256 | 161 | HPCD_C_class_II C-terminal domain of 3,4-dihydroxy | 99.75 | |
| cd07249 | 128 | MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als | 99.75 | |
| cd07258 | 141 | PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma | 99.74 | |
| cd07237 | 154 | BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro | 99.74 | |
| TIGR02295 | 294 | HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T | 99.74 | |
| COG3324 | 127 | Predicted enzyme related to lactoylglutathione lya | 99.74 | |
| cd08344 | 112 | MhqB_like_N N-terminal domain of MhqB, a type I ex | 99.73 | |
| cd08343 | 131 | ED_TypeI_classII_C C-terminal domain of type I, cl | 99.73 | |
| cd06587 | 112 | Glo_EDI_BRP_like This domain superfamily is found | 99.73 | |
| PRK10291 | 129 | glyoxalase I; Provisional | 99.72 | |
| cd07251 | 121 | Glo_EDI_BRP_like_10 This conserved domain belongs | 99.72 | |
| PLN02300 | 286 | lactoylglutathione lyase | 99.71 | |
| cd08358 | 127 | Glo_EDI_BRP_like_21 This conserved domain belongs | 99.68 | |
| TIGR03211 | 303 | catechol_2_3 catechol 2,3 dioxygenase. Members of | 99.66 | |
| TIGR02295 | 294 | HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T | 99.65 | |
| PLN02300 | 286 | lactoylglutathione lyase | 99.65 | |
| TIGR03213 | 286 | 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | 99.65 | |
| COG3565 | 138 | Predicted dioxygenase of extradiol dioxygenase fam | 99.64 | |
| cd06588 | 128 | PhnB_like Escherichia coli PhnB and similar protei | 99.5 | |
| COG3607 | 133 | Predicted lactoylglutathione lyase [General functi | 99.45 | |
| COG2514 | 265 | Predicted ring-cleavage extradiol dioxygenase [Gen | 99.45 | |
| PRK01037 | 357 | trmD tRNA (guanine-N(1)-)-methyltransferase/unknow | 99.29 | |
| COG0346 | 138 | GloA Lactoylglutathione lyase and related lyases [ | 99.27 | |
| PF13669 | 109 | Glyoxalase_4: Glyoxalase/Bleomycin resistance prot | 99.26 | |
| COG2764 | 136 | PhnB Uncharacterized protein conserved in bacteria | 99.24 | |
| KOG2944 | 170 | consensus Glyoxalase [Carbohydrate transport and m | 99.24 | |
| KOG2943 | 299 | consensus Predicted glyoxalase [Carbohydrate trans | 99.09 | |
| cd07250 | 191 | HPPD_C_like C-terminal domain of 4-hydroxyphenylpy | 99.03 | |
| TIGR01263 | 353 | 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr | 98.99 | |
| PRK10148 | 147 | hypothetical protein; Provisional | 98.87 | |
| TIGR01263 | 353 | 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr | 98.76 | |
| COG2514 | 265 | Predicted ring-cleavage extradiol dioxygenase [Gen | 98.61 | |
| PF14506 | 125 | CppA_N: CppA N-terminal; PDB: 3E0R_D. | 98.53 | |
| KOG2943 | 299 | consensus Predicted glyoxalase [Carbohydrate trans | 98.39 | |
| PLN02875 | 398 | 4-hydroxyphenylpyruvate dioxygenase | 98.29 | |
| PF14696 | 139 | Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H | 98.14 | |
| PF13468 | 175 | Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. | 97.99 | |
| PF06983 | 116 | 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans | 97.91 | |
| KOG0638 | 381 | consensus 4-hydroxyphenylpyruvate dioxygenase [Ami | 97.88 | |
| PLN02875 | 398 | 4-hydroxyphenylpyruvate dioxygenase | 97.88 | |
| PF15067 | 236 | FAM124: FAM124 family | 97.83 | |
| COG3185 | 363 | 4-hydroxyphenylpyruvate dioxygenase and related he | 97.58 | |
| COG3185 | 363 | 4-hydroxyphenylpyruvate dioxygenase and related he | 97.48 | |
| PF14507 | 101 | CppA_C: CppA C-terminal; PDB: 3E0R_D. | 97.0 | |
| PF13669 | 109 | Glyoxalase_4: Glyoxalase/Bleomycin resistance prot | 95.83 | |
| COG3865 | 151 | Uncharacterized protein conserved in bacteria [Fun | 95.34 | |
| KOG0638 | 381 | consensus 4-hydroxyphenylpyruvate dioxygenase [Ami | 95.03 | |
| PF13670 | 83 | PepSY_2: Peptidase propeptide and YPEB domain This | 88.64 | |
| KOG2944 | 170 | consensus Glyoxalase [Carbohydrate transport and m | 86.65 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 83.25 |
| >cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains | Back alignment and domain information |
|---|
Probab=99.86 E-value=2e-20 Score=127.91 Aligned_cols=109 Identities=21% Similarity=0.301 Sum_probs=87.7
Q ss_pred ccEEEEEeCCHHHHHHHHHhccCCEEEEec---ccEEEEEeCC-eEEEEEeCCCCCcccCCCeEEEEEEeCCHHHHHHHH
Q 040429 57 FRWILQLHKDVPKAARFYSEGLDFTVNVCT---LRWAELQSGP-LKLALMQSPSDHVVQNGNSSLLSFTVTDINSAVTKL 132 (168)
Q Consensus 57 i~hv~l~v~D~~~a~~FY~~vLGf~~~~~~---~~~~~~~~~~-~~i~l~~~~~~~~~~~~~~~~~~~~v~dl~~~~~~l 132 (168)
++|+.|.|+|+++|++||+++|||++.... ..++.+..++ ..+.+....... ...+...+++|.++|+++++++|
T Consensus 1 ~~hi~l~v~d~~~s~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~f~v~di~~~~~~l 79 (114)
T cd07247 1 PVWFELPTTDPERAKAFYGAVFGWTFEDMGDGGGDYAVFSTGGGAVGGLMKAPEPA-AGSPPGWLVYFAVDDVDAAAARV 79 (114)
T ss_pred CEEEEeeCCCHHHHHHHHHhccCceeeeccCCCCceEEEEeCCccEEEEecCCCCC-CCCCCeEEEEEEeCCHHHHHHHH
Confidence 479999999999999999999999998765 4677777653 455665544332 22345567999999999999999
Q ss_pred HHCCCeEeccceeeC-CeEEEEEECCCCCEEEEEe
Q 040429 133 MALGAELDGSIKYEI-HGKVAAMRCIDGHMLGLYE 166 (168)
Q Consensus 133 ~~~G~~~~~~~~~~~-~g~~~~~~DPdGn~iel~e 166 (168)
+++|+++..++...+ +++.++|+|||||.|+|+|
T Consensus 80 ~~~g~~~~~~~~~~~~~~~~~~~~DPdG~~~~l~~ 114 (114)
T cd07247 80 EAAGGKVLVPPTDIPGVGRFAVFADPEGAVFGLWQ 114 (114)
T ss_pred HHCCCEEEeCCcccCCcEEEEEEECCCCCEEEeEC
Confidence 999999886666444 5699999999999999986
|
SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a strep |
| >cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PRK11478 putative lyase; Provisional | Back alignment and domain information |
|---|
| >cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >PRK04101 fosfomycin resistance protein FosB; Provisional | Back alignment and domain information |
|---|
| >cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin | Back alignment and domain information |
|---|
| >cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm | Back alignment and domain information |
|---|
| >cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins | Back alignment and domain information |
|---|
| >cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins | Back alignment and domain information |
|---|
| >cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 | Back alignment and domain information |
|---|
| >cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PLN02367 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive | Back alignment and domain information |
|---|
| >cd07235 MRD Mitomycin C resistance protein (MRD) | Back alignment and domain information |
|---|
| >PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A | Back alignment and domain information |
|---|
| >cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03211 catechol_2_3 catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin | Back alignment and domain information |
|---|
| >cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | Back alignment and domain information |
|---|
| >cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain | Back alignment and domain information |
|---|
| >TIGR03645 glyox_marine lactoylglutathione lyase family protein | Back alignment and domain information |
|---|
| >cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase | Back alignment and domain information |
|---|
| >cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08360 MhqB_like_C C-terminal domain of Burkholderia sp | Back alignment and domain information |
|---|
| >cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase | Back alignment and domain information |
|---|
| >cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins | Back alignment and domain information |
|---|
| >cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >TIGR00068 glyox_I lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway | Back alignment and domain information |
|---|
| >cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins | Back alignment and domain information |
|---|
| >PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein | Back alignment and domain information |
|---|
| >PLN03042 Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >PRK06724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins | Back alignment and domain information |
|---|
| >cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain | Back alignment and domain information |
|---|
| >cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >PRK10291 glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PLN02300 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03211 catechol_2_3 catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >PLN02300 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | Back alignment and domain information |
|---|
| >COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] | Back alignment and domain information |
|---|
| >cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E | Back alignment and domain information |
|---|
| >COG3607 Predicted lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A | Back alignment and domain information |
|---|
| >COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >PRK10148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02875 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A | Back alignment and domain information |
|---|
| >PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B | Back alignment and domain information |
|---|
| >PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A | Back alignment and domain information |
|---|
| >KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02875 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >PF15067 FAM124: FAM124 family | Back alignment and domain information |
|---|
| >COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A | Back alignment and domain information |
|---|
| >COG3865 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13670 PepSY_2: Peptidase propeptide and YPEB domain This Prosite motif covers only the active site | Back alignment and domain information |
|---|
| >KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 168 | |||
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 2e-15 | |
| 3fcd_A | 134 | Lyase, ORF125EGC139; lactoylglutathione lyase, YEC | 5e-11 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 4e-08 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 9e-08 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 3e-07 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 1e-06 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 2e-06 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 1e-05 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 1e-05 | |
| 1xrk_A | 124 | Bleomycin resistance protein; arm exchange, ligand | 2e-05 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 2e-05 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 4e-05 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 7e-05 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 3e-04 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 3e-04 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 4e-04 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 4e-04 | |
| 1qto_A | 122 | Bleomycin-binding protein; arm-exchange, antibioti | 4e-04 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 5e-04 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 8e-04 |
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 | Back alignment and structure |
|---|
Score = 67.9 bits (166), Expect = 2e-15
Identities = 18/104 (17%), Positives = 37/104 (35%), Gaps = 1/104 (0%)
Query: 65 KDVPKAARFYSEGLDFTVNVCTLRWAELQSGPLKLALMQSPSDHVVQNGNSSLLSFTVTD 124
+VP+ LD + +A+ G L L Q+ + + ++ V D
Sbjct: 14 SNVPQVCADLEHILDKKADYANDGFAQFTIGSHCLMLSQNHLVPLENFQSGIIIHIEVED 73
Query: 125 INSAVTKLMALGAELDGSIKYEIHG-KVAAMRCIDGHMLGLYEP 167
++ +L LG ++ G + ++ G +L Y
Sbjct: 74 VDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGPAGLVLDFYRM 117
|
| >3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} Length = 134 | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 | Back alignment and structure |
|---|
| >1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Length = 124 | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Length = 138 | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 | Back alignment and structure |
|---|
| >1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Length = 122 | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 99.89 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.89 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 99.89 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 99.89 | |
| 1xrk_A | 124 | Bleomycin resistance protein; arm exchange, ligand | 99.89 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 99.88 | |
| 1qto_A | 122 | Bleomycin-binding protein; arm-exchange, antibioti | 99.88 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 99.88 | |
| 4hc5_A | 133 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.88 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 99.88 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 99.88 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.88 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 99.88 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 99.88 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 99.87 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 99.87 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 99.86 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 99.86 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 99.86 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 99.86 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 99.86 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 99.85 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 99.85 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 99.85 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 99.85 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 99.85 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 99.85 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 99.85 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.85 | |
| 1ecs_A | 126 | Bleomycin resistance protein; arm-exchange, antibi | 99.85 | |
| 3fcd_A | 134 | Lyase, ORF125EGC139; lactoylglutathione lyase, YEC | 99.85 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 99.85 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 99.85 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 99.85 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 99.85 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 99.84 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 99.84 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 99.84 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 99.84 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 99.84 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.83 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 99.83 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 99.83 | |
| 3vw9_A | 187 | Lactoylglutathione lyase; glyoxalase, lyase-lyase | 99.83 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.83 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.83 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 99.83 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 99.83 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 99.82 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 99.82 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 99.82 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 99.81 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 99.81 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 99.81 | |
| 4gym_A | 149 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.81 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 99.8 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 99.8 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 99.79 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 99.79 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 99.77 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 99.77 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 99.76 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 99.76 | |
| 4ghg_A | 365 | Homoprotocatechuate 2,3-dioxygenase; oxygen activa | 99.76 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 99.75 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 99.74 | |
| 3zi1_A | 330 | Glyoxalase domain-containing protein 4; isomerase; | 99.74 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 99.73 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 99.73 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 99.72 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 99.72 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 99.71 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 99.71 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 99.71 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.7 | |
| 1u7i_A | 136 | Hypothetical protein; structural genomics, PA1358, | 99.7 | |
| 1xy7_A | 166 | Unknown protein; structural genomics, protein stru | 99.69 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 99.69 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 99.69 | |
| 1u6l_A | 149 | Hypothetical protein; structural genomics, PSI, pr | 99.68 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 99.68 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 99.68 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 99.68 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 99.67 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 99.66 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 99.64 | |
| 4ghg_A | 365 | Homoprotocatechuate 2,3-dioxygenase; oxygen activa | 99.64 | |
| 3zi1_A | 330 | Glyoxalase domain-containing protein 4; isomerase; | 99.6 | |
| 1tsj_A | 139 | Conserved hypothetical protein; structural genomic | 99.6 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 99.57 | |
| 3l20_A | 172 | Putative uncharacterized protein; hypothetical pro | 99.5 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 99.5 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 99.48 | |
| 3oms_A | 138 | PHNB protein; structural genomics, PSI-2, protein | 99.48 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.43 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.33 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 99.31 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.27 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.25 | |
| 3e0r_A | 244 | C3-degrading proteinase (CPPA protein); MCSG, PSI, | 99.23 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 99.18 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 98.92 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 98.83 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 98.8 | |
| 1u69_A | 163 | Hypothetical protein; structural genomics, MSCG, p | 98.57 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 98.12 | |
| 3e0r_A | 244 | C3-degrading proteinase (CPPA protein); MCSG, PSI, | 97.95 | |
| 3opy_B | 941 | 6-phosphofructo-1-kinase beta-subunit; ATP binding | 97.76 | |
| 3p8a_A | 274 | Uncharacterized protein; mainly antiparallel beta | 95.82 | |
| 3p8a_A | 274 | Uncharacterized protein; mainly antiparallel beta | 95.3 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 89.0 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 87.58 | |
| 3opy_A | 989 | 6-phosphofructo-1-kinase alpha-subunit; ATP bindin | 87.42 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 85.4 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 84.41 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 83.04 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 82.63 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 82.62 |
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* | Back alignment and structure |
|---|
Probab=99.89 E-value=3.9e-22 Score=137.67 Aligned_cols=118 Identities=17% Similarity=0.201 Sum_probs=96.9
Q ss_pred cccccccccEEEEEeCCHHHHHHHHHhccCCEEEEecccEEEEEeCCeEEEEEeCCCCC----cccCCCeEEEEEEeCC-
Q 040429 50 RVMAAASFRWILQLHKDVPKAARFYSEGLDFTVNVCTLRWAELQSGPLKLALMQSPSDH----VVQNGNSSLLSFTVTD- 124 (168)
Q Consensus 50 ~~m~~~~i~hv~l~v~D~~~a~~FY~~vLGf~~~~~~~~~~~~~~~~~~i~l~~~~~~~----~~~~~~~~~~~~~v~d- 124 (168)
.+|...+++|+.|.|+|+++|++||+++|||++....+.+..+..++..+.+....... ........|++|.++|
T Consensus 4 ~~m~~~~i~hi~l~v~D~~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~v~dd 83 (133)
T 3ey7_A 4 FLMKISHLDHLVLTVADIPTTTNFYEKVLGMKAVSFGAGRIALEFGHQKINLHQLGNEFEPKAQNVRVGSADLCFITDTV 83 (133)
T ss_dssp CCCCCCEEEEEEEEESCHHHHHHHHHHHHCCEEEEETTTEEEEEETTEEEEEEETTSCCSSCCTTCCTTCCEEEEECSSC
T ss_pred eEeEecccCEEEEEECCHHHHHHHHHHccCceEEEecCCeEEEEcCCEEEEEEcCCCCccccCCCCCCCccEEEEEeCcH
Confidence 34566799999999999999999999999999999888888888899999998764321 1122344689999997
Q ss_pred HHHHHHHHHHCCCeEeccce--eeCCe--EEEEEECCCCCEEEEEee
Q 040429 125 INSAVTKLMALGAELDGSIK--YEIHG--KVAAMRCIDGHMLGLYEP 167 (168)
Q Consensus 125 l~~~~~~l~~~G~~~~~~~~--~~~~g--~~~~~~DPdGn~iel~e~ 167 (168)
+++++++|+++|+++..++. ....+ +.+||+|||||.|||+|+
T Consensus 84 ~~~~~~~l~~~G~~~~~~~~~~~~~~g~~~~~~~~DPdG~~iel~~~ 130 (133)
T 3ey7_A 84 LSDAMKHVEDQGVTIMEGPVKRTGAQGAITSFYFRDPDGNLIEVSTY 130 (133)
T ss_dssp HHHHHHHHHHTTCCCCEEEEEEEETTEEEEEEEEECTTCCEEEEEES
T ss_pred HHHHHHHHHHCCCccccCCccccCCCCCeEEEEEECCCCCEEEEEec
Confidence 99999999999999876553 33323 799999999999999986
|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* | Back alignment and structure |
|---|
| >1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} | Back alignment and structure |
|---|
| >1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} | Back alignment and structure |
|---|
| >1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A | Back alignment and structure |
|---|
| >3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* | Back alignment and structure |
|---|
| >4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* | Back alignment and structure |
|---|
| >3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* | Back alignment and structure |
|---|
| >3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} | Back alignment and structure |
|---|
| >3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} | Back alignment and structure |
|---|
| >3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* | Back alignment and structure |
|---|
| >1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* | Back alignment and structure |
|---|
| >3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} | Back alignment and structure |
|---|
| >3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A | Back alignment and structure |
|---|
| >3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 168 | ||||
| d2i7ra1 | 115 | d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Str | 9e-11 | |
| d2pjsa1 | 111 | d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 | 0.002 | |
| d1xrka_ | 120 | d.32.1.2 (A:) Bleomycin resistance protein, BRP {S | 0.003 | |
| d1cjxa1 | 150 | d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxyge | 0.004 |
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase family: Antibiotic resistance proteins domain: Hypotheical protein SP0731 species: Streptococcus pneumoniae [TaxId: 1313]
Score = 54.1 bits (129), Expect = 9e-11
Identities = 18/104 (17%), Positives = 37/104 (35%), Gaps = 1/104 (0%)
Query: 65 KDVPKAARFYSEGLDFTVNVCTLRWAELQSGPLKLALMQSPSDHVVQNGNSSLLSFTVTD 124
+VP+ LD + +A+ G L L Q+ + + ++ V D
Sbjct: 11 SNVPQVCADLEHILDKKADYANDGFAQFTIGSHCLMLSQNHLVPLENFQSGIIIHIEVED 70
Query: 125 INSAVTKLMALGAELDGSIKYEIHG-KVAAMRCIDGHMLGLYEP 167
++ +L LG ++ G + ++ G +L Y
Sbjct: 71 VDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGPAGLVLDFYRM 114
|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 150 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| d2i7ra1 | 115 | Hypotheical protein SP0731 {Streptococcus pneumoni | 99.93 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 99.86 | |
| d1npba_ | 140 | Fosfomycin resistance protein A (FosA) {Serratia m | 99.85 | |
| d1r9ca_ | 130 | Fosfomycin resistance protein FosX {Mesorhizobium | 99.85 | |
| d2pjsa1 | 111 | Uncharacterized protein Atu1953 {Agrobacterium tum | 99.84 | |
| d1nkia_ | 134 | Fosfomycin resistance protein A (FosA) {Pseudomona | 99.84 | |
| d1klla_ | 128 | Mitomycin resistance protein D, MRD {Streptomyces | 99.84 | |
| d1zswa2 | 170 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.83 | |
| d1ss4a_ | 149 | Hypothetical protein BC1747 {Bacillus cereus (stra | 99.83 | |
| d1f9za_ | 135 | Glyoxalase I (lactoylglutathione lyase) {Escherich | 99.83 | |
| d1zswa1 | 144 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.83 | |
| d1mpya2 | 162 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.83 | |
| d1lgta1 | 131 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.83 | |
| d1jifa_ | 122 | Bleomycin resistance protein, BRP {Streptomyces ve | 99.82 | |
| d1ecsa_ | 120 | Bleomycin resistance protein, BRP {Klebsiella pneu | 99.82 | |
| d1qipa_ | 176 | Glyoxalase I (lactoylglutathione lyase) {Human (Ho | 99.82 | |
| d1kw3b1 | 132 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.81 | |
| d1f1ua1 | 146 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.81 | |
| d1twua_ | 137 | Hypothetical protein YycE {Bacillus subtilis [TaxI | 99.8 | |
| d1kw3b2 | 156 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.79 | |
| d1xrka_ | 120 | Bleomycin resistance protein, BRP {Streptoalloteic | 99.79 | |
| d1mpya1 | 145 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.79 | |
| d1f1ua2 | 176 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.76 | |
| d2c21a1 | 139 | Glyoxalase I (lactoylglutathione lyase) {Leishmani | 99.76 | |
| d1jc4a_ | 145 | Methylmalonyl-CoA epimerase {Propionibacterium she | 99.75 | |
| d1xy7a_ | 135 | Hypothetical protein At5g48480 {Thale cress (Arabi | 99.7 | |
| d1t47a1 | 163 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 99.69 | |
| d1sqia1 | 149 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 99.66 | |
| d1sqda1 | 167 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 99.64 | |
| d1sp8a1 | 172 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 99.58 | |
| d1u6la_ | 137 | Hypothetical protein PA1353 {Pseudomonas aeruginos | 99.46 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.36 | |
| d1u7ia_ | 134 | Hypothetical protein PA1358 {Pseudomonas aeruginos | 99.24 | |
| d1tsja_ | 129 | Hypothetical protein MW1090 {Staphylococcus aureus | 98.97 | |
| d1cjxa2 | 203 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 98.9 | |
| d1sp8a2 | 224 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 98.86 | |
| d1t47a2 | 199 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 98.72 | |
| d1sqia2 | 210 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 98.69 | |
| d1sqda2 | 230 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 98.45 | |
| d1u69a_ | 156 | Hypothetical protein PA2721 {Pseudomonas aeruginos | 97.85 | |
| d1sp8a1 | 172 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 83.15 | |
| d1sqda1 | 167 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 81.34 |
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase family: Antibiotic resistance proteins domain: Hypotheical protein SP0731 species: Streptococcus pneumoniae [TaxId: 1313]
Probab=99.93 E-value=1.4e-25 Score=152.13 Aligned_cols=113 Identities=16% Similarity=0.174 Sum_probs=99.5
Q ss_pred ccccEEEEEeCCHHHHHHHHHhccCCEEEEecccEEEEEeCCeEEEEEeCCCCCcccCCCeEEEEEEeCCHHHHHHHHHH
Q 040429 55 ASFRWILQLHKDVPKAARFYSEGLDFTVNVCTLRWAELQSGPLKLALMQSPSDHVVQNGNSSLLSFTVTDINSAVTKLMA 134 (168)
Q Consensus 55 ~~i~hv~l~v~D~~~a~~FY~~vLGf~~~~~~~~~~~~~~~~~~i~l~~~~~~~~~~~~~~~~~~~~v~dl~~~~~~l~~ 134 (168)
++++|+.|.|+|+++|++||+++||+++....+.|+.+..++..+++...........+...+++|.|+|+++++++|++
T Consensus 1 m~l~~i~i~V~di~~a~~FYe~~lg~~~~~~~~~~~~~~~g~~~l~l~~~~~~~~~~~~~~~~~~f~v~D~d~~~~~l~~ 80 (115)
T d2i7ra1 1 MNLNQLDIIVSNVPQVCADLEHILDKKADYANDGFAQFTIGSHCLMLSQNHLVPLENFQSGIIIHIEVEDVDQNYKRLNE 80 (115)
T ss_dssp CEEEEEEEECSCHHHHHHHHHHHHTSCCSEEETTEEEEEETTEEEEEESSCSSSCCCCCSCEEEEEECSCHHHHHHHHHH
T ss_pred CcceEEEEEECCHHHHHHHHHHhhCCceeeecCCeEEEEEcCceeeeeecccCCCCCCCcceEEEEEECCHHHHHHHHHh
Confidence 37899999999999999999999999998888899999999999999876554444455556799999999999999999
Q ss_pred CCCeEeccceeeCCe-EEEEEECCCCCEEEEEee
Q 040429 135 LGAELDGSIKYEIHG-KVAAMRCIDGHMLGLYEP 167 (168)
Q Consensus 135 ~G~~~~~~~~~~~~g-~~~~~~DPdGn~iel~e~ 167 (168)
+|+.+..++...++| +.+||+|||||.|||+|.
T Consensus 81 ~G~~i~~~~~~~~~g~~~~~~~DPdGn~ie~~~~ 114 (115)
T d2i7ra1 81 LGIKVLHGPTVTDWGTESLLVQGPAGLVLDFYRM 114 (115)
T ss_dssp HTCCEEEEEEECTTSCEEEEEECGGGCEEEEEEC
T ss_pred hccccccceEEeeCCeEEEEEECCCCCEEEEEEe
Confidence 999988777766666 899999999999999985
|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} | Back information, alignment and structure |
|---|
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} | Back information, alignment and structure |
|---|
| >d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|