Citrus Sinensis ID: 040518

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MSGSNQKQWSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEPVSIDYHQQYKNED
ccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
ccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccEEccccccccc
msgsnqkqwsweenkAFENGVALYYkegqdeewvkihslvptktiDEIKVHFKKLMEDLEliefgfepvsidyhqqykned
msgsnqkqwsweenkAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEPVSIDYHQQYKNED
MSGSNQKQWSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEPVSIDYHQQYKNED
**********WEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEPVSIDYH*******
******K***WEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEPV************
**********WEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEPVSIDYHQQYKNED
********WSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEPVSIDYHQQ*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGSNQKQWSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEPVSIDYHQQYKNED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query81 2.2.26 [Sep-21-2011]
Q8S9H7 307 Transcription factor DIVA N/A no 0.753 0.198 0.387 1e-06
Q58FS393 Transcription factor RADI N/A no 0.753 0.655 0.403 3e-06
Q1A17397 Protein RADIALIS-like 6 O no no 0.827 0.690 0.382 1e-05
F4JVB8100 Protein RADIALIS-like 1 O no no 0.728 0.59 0.35 0.0002
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function desciption
 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 8  QWSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFE 67
          +W+  ENKAFEN +A++  E     W ++   VP KT+ ++   +K+L +D+  IE GF 
Sbjct: 25 RWTAAENKAFENALAVF-DENTPNRWERVAERVPGKTVGDVMRQYKELEDDVSSIEAGFV 83

Query: 68 PV 69
          PV
Sbjct: 84 PV 85
Involved in the dorsovental asymmetry of flowers. Promotes ventral identity.
Antirrhinum majus (taxid: 4151)
>sp|Q58FS3|RAD_ANTMA Transcription factor RADIALIS OS=Antirrhinum majus GN=RAD PE=1 SV=1 Back     alignment and function description
>sp|Q1A173|RADL6_ARATH Protein RADIALIS-like 6 OS=Arabidopsis thaliana GN=RL6 PE=2 SV=1 Back     alignment and function description
>sp|F4JVB8|RADL1_ARATH Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
225455856 296 PREDICTED: uncharacterized protein LOC10 0.753 0.206 0.491 1e-09
297734169 252 unnamed protein product [Vitis vinifera] 0.753 0.242 0.491 2e-09
297847182 310 hypothetical protein ARALYDRAFT_891746 [ 0.839 0.219 0.428 2e-08
351727817 307 MYB transcription factor MYB109 [Glycine 0.703 0.185 0.465 3e-08
18402458 314 myb/SANT-like DNA-binding domain-contain 0.839 0.216 0.414 3e-08
358248190 296 uncharacterized protein LOC100819797 [Gl 0.790 0.216 0.446 8e-08
255541820 297 DNA binding protein, putative [Ricinus c 0.753 0.205 0.467 8e-08
25558226385 conserved hypothetical protein [Ricinus 0.839 0.8 0.428 8e-08
255641394 243 unknown [Glycine max] 0.703 0.234 0.465 1e-07
327412643 302 putative MYB transcription factor [Rosa 0.753 0.201 0.467 2e-07
>gi|225455856|ref|XP_002274167.1| PREDICTED: uncharacterized protein LOC100245771 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 43/61 (70%)

Query: 9  WSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEP 68
          WS EE KAFEN +A+++ E   E W KI S+VP K++DE+K H++ L+ED+  IE G  P
Sbjct: 8  WSREEEKAFENAIAMHWTEDCKEVWDKIASMVPGKSVDELKQHYQFLVEDVNAIEAGHIP 67

Query: 69 V 69
          +
Sbjct: 68 L 68

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297734169|emb|CBI15416.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297847182|ref|XP_002891472.1| hypothetical protein ARALYDRAFT_891746 [Arabidopsis lyrata subsp. lyrata] gi|297337314|gb|EFH67731.1| hypothetical protein ARALYDRAFT_891746 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|351727817|ref|NP_001235894.1| MYB transcription factor MYB109 [Glycine max] gi|356511607|ref|XP_003524515.1| PREDICTED: uncharacterized protein LOC100812196 [Glycine max] gi|110931704|gb|ABH02851.1| MYB transcription factor MYB109 [Glycine max] Back     alignment and taxonomy information
>gi|18402458|ref|NP_564537.1| myb/SANT-like DNA-binding domain-containing protein [Arabidopsis thaliana] gi|7770343|gb|AAF69713.1|AC016041_18 F27J15.20 [Arabidopsis thaliana] gi|21555865|gb|AAM63950.1| unknown [Arabidopsis thaliana] gi|41618992|gb|AAS09998.1| MYB transcription factor [Arabidopsis thaliana] gi|89274145|gb|ABD65593.1| At1g49010 [Arabidopsis thaliana] gi|332194260|gb|AEE32381.1| myb/SANT-like DNA-binding domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|358248190|ref|NP_001240091.1| uncharacterized protein LOC100819797 [Glycine max] gi|255641236|gb|ACU20895.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255541820|ref|XP_002511974.1| DNA binding protein, putative [Ricinus communis] gi|223549154|gb|EEF50643.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255582263|ref|XP_002531923.1| conserved hypothetical protein [Ricinus communis] gi|223528433|gb|EEF30467.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|255641394|gb|ACU20974.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|327412643|emb|CCA29110.1| putative MYB transcription factor [Rosa hybrid cultivar] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
TAIR|locus:2028461 314 AT1G49010 [Arabidopsis thalian 0.839 0.216 0.414 8.6e-11
UNIPROTKB|Q58FS393 RAD "Transcription factor RADI 0.790 0.688 0.409 2.6e-08
TAIR|locus:2074723 263 AT3G11280 [Arabidopsis thalian 0.839 0.258 0.362 3.2e-08
TAIR|locus:2166459 277 AT5G05790 [Arabidopsis thalian 0.740 0.216 0.409 8e-08
TAIR|locus:2042872 298 AT2G38090 [Arabidopsis thalian 0.753 0.204 0.370 1.2e-07
UNIPROTKB|Q8S9H7 307 DIVARICATA "Transcription fact 0.753 0.198 0.387 1.3e-07
TAIR|locus:202518297 RL6 "RAD-like 6" [Arabidopsis 0.827 0.690 0.382 1.4e-07
TAIR|locus:2136283100 RL1 "RAD-like 1" [Arabidopsis 0.827 0.67 0.338 2.9e-07
TAIR|locus:2150149 267 AT5G01200 [Arabidopsis thalian 0.728 0.220 0.412 9.6e-07
TAIR|locus:2016417100 RL5 "RAD-like 5" [Arabidopsis 0.827 0.67 0.352 1e-06
TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 155 (59.6 bits), Expect = 8.6e-11, P = 8.6e-11
 Identities = 29/70 (41%), Positives = 50/70 (71%)

Query:     9 WSWEENKAFENGVALYYKEGQ--DEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGF 66
             WS EE KAFEN +AL+  E +  +++W K+ S+VP+K ++E+K H++ L+ED++ IE G 
Sbjct:     8 WSREEEKAFENAIALHCVEEEITEDQWNKMSSMVPSKALEEVKKHYQILLEDVKAIENGQ 67

Query:    67 EPVSIDYHQQ 76
              P+   +H++
Sbjct:    68 VPLPRYHHRK 77
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009733 "response to auxin stimulus" evidence=IEP
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0016556 "mRNA modification" evidence=RCA
UNIPROTKB|Q58FS3 RAD "Transcription factor RADIALIS" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2074723 AT3G11280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166459 AT5G05790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2025182 RL6 "RAD-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136283 RL1 "RAD-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150149 AT5G01200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016417 RL5 "RAD-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00017631001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (296 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 0.004
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information 
 Score = 31.7 bits (73), Expect = 0.004
 Identities = 10/48 (20%), Positives = 21/48 (43%), Gaps = 4/48 (8%)

Query: 9  WSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLM 56
          W+ EE++     V  +     +  W KI   +P +T ++ K  +   +
Sbjct: 4  WTPEEDELLIEAVKKH----GNGNWSKIAKHLPGRTDNQCKNRWNNYL 47

This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family. Length = 47

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 81
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.51
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.34
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.27
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.97
PLN03212 249 Transcription repressor MYB5; Provisional 98.85
KOG0724 335 consensus Zuotin and related molecular chaperones 98.8
KOG0048 238 consensus Transcription factor, Myb superfamily [T 98.8
PLN03091 459 hypothetical protein; Provisional 98.72
PLN03212 249 Transcription repressor MYB5; Provisional 98.68
PLN03091 459 hypothetical protein; Provisional 98.37
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.28
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.09
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.07
KOG0048 238 consensus Transcription factor, Myb superfamily [T 97.94
KOG1279 506 consensus Chromatin remodeling factor subunit and 97.81
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.77
KOG4167 907 consensus Predicted DNA-binding protein, contains 97.54
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 97.4
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.31
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.69
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.58
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 96.49
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.42
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 96.09
COG5147 512 REB1 Myb superfamily proteins, including transcrip 96.09
KOG0051 607 consensus RNA polymerase I termination factor, Myb 95.81
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 95.74
KOG1194 534 consensus Predicted DNA-binding protein, contains 95.29
KOG0049 939 consensus Transcription factor, Myb superfamily [T 95.24
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 94.77
KOG4329445 consensus DNA-binding protein [General function pr 94.28
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 93.7
smart0059589 MADF subfamily of SANT domain. 93.35
KOG4468 782 consensus Polycomb-group transcriptional regulator 92.61
KOG4282 345 consensus Transcription factor GT-2 and related pr 92.13
PF11035 344 SnAPC_2_like: Small nuclear RNA activating complex 90.93
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 90.82
PRK13923170 putative spore coat protein regulator protein YlbO 90.36
KOG0051607 consensus RNA polymerase I termination factor, Myb 90.34
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 89.22
COG5147 512 REB1 Myb superfamily proteins, including transcrip 88.43
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 88.21
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 85.21
PF0450498 DUF573: Protein of unknown function, DUF573; Inter 85.1
cd0008659 homeodomain Homeodomain; DNA binding domains invol 85.06
KOG2656 445 consensus DNA methyltransferase 1-associated prote 85.06
PF0004657 Homeobox: Homeobox domain not present here.; Inter 83.76
PF05263130 DUF722: Protein of unknown function (DUF722); Inte 82.26
smart0042668 TEA TEA domain. 80.16
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information 
Probab=99.51  E-value=3.7e-14  Score=80.56  Aligned_cols=46  Identities=24%  Similarity=0.563  Sum_probs=40.5

Q ss_pred             CCCCHHHHHHHHHHHHhhccCCCchHHHHHHHhCC-CCCHHHHHHHHHHHH
Q 040518            7 KQWSWEENKAFENGVALYYKEGQDEEWVKIHSLVP-TKTIDEIKVHFKKLM   56 (81)
Q Consensus         7 ~~WT~eE~k~fE~aL~~~~p~~~~~RWekIA~~vp-gKS~~ev~~ry~~L~   56 (81)
                      ..||.+|+.+|..|+.+| +.+   +|.+||..|| |||..||+.||..++
T Consensus         2 ~~Wt~eE~~~l~~~v~~~-g~~---~W~~Ia~~~~~~Rt~~qc~~~~~~~~   48 (48)
T PF00249_consen    2 GPWTEEEDEKLLEAVKKY-GKD---NWKKIAKRMPGGRTAKQCRSRYQNLL   48 (48)
T ss_dssp             -SS-HHHHHHHHHHHHHS-TTT---HHHHHHHHHSSSSTHHHHHHHHHHHT
T ss_pred             CCCCHHHHHHHHHHHHHh-CCc---HHHHHHHHcCCCCCHHHHHHHHHhhC
Confidence            579999999999999999 543   7999999999 999999999999873

These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B ....
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF11035 SnAPC_2_like: Small nuclear RNA activating complex subunit 2-like; InterPro: IPR021281 This family of proteins is SnAPC subunit 2-like Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PF04504 DUF573: Protein of unknown function, DUF573; InterPro: IPR007592 This is a family of uncharacterised proteins Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>PF05263 DUF722: Protein of unknown function (DUF722); InterPro: IPR007927 This entry is represented by Bacteriophage bIL285, Orf38 Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
2cjj_A93 Crystal Structure Of The Myb Domain Of The Rad Tran 2e-07
>pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 Back     alignment and structure 
Iteration: 1

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (62%), Gaps = 1/62 (1%)
Query: 7  KQWSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGF 66
          + WS +ENKAFE  +A+Y K+  D  W  +   V  +T +E+K H++ L+ED++ IE G 
Sbjct: 9  RPWSAKENKAFERALAVYDKDTPDR-WANVARAVEGRTPEEVKKHYEILVEDIKYIESGK 67
Query: 67 EP 68
           P
Sbjct: 68 VP 69

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
2cjj_A93 Radialis; plant development, DNA-binding protein, 3e-15
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 3e-11
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 8e-11
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 3e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 5e-06
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 1e-04
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
 Score = 63.4 bits (154), Expect = 3e-15
 Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 2  SGSNQKQWSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLEL 61
          +  + + WS +ENKAFE  +A+Y  +   + W  +   V  +T +E+K H++ L+ED++ 
Sbjct: 4  TRGSGRPWSAKENKAFERALAVY-DKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKY 62

Query: 62 IEFGFEPV 69
          IE G  P 
Sbjct: 63 IESGKVPF 70
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.96
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.96
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.87
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 99.87
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.86
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.69
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.64
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.55
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.51
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.48
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.47
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.45
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.43
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.42
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.42
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.35
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.35
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.32
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.31
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.29
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.28
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.27
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.21
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.2
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.83
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.19
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.18
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.17
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.15
2crg_A70 Metastasis associated protein MTA3; transcription 99.13
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.12
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.12
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.1
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.03
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.01
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.0
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.96
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.91
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.75
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.74
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.73
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.68
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.64
1ofc_X 304 ISWI protein; nuclear protein, chromatin remodelin 98.59
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.49
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.43
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.36
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.63
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.84
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.8
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 97.7
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.56
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.4
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 97.25
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 96.95
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.78
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.96
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 95.66
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.69
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 90.83
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 88.77
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 86.8
2cxy_A125 BAF250B subunit, HBAF250B; DNA-binding domain, str 83.64
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.96  E-value=1.7e-30  Score=160.69  Aligned_cols=69  Identities=14%  Similarity=0.318  Sum_probs=65.4

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhhccCCCchHHHHHHHhCCCCCHHHHHHHHHHHHHHHhhhhcCCCCCCCC
Q 040518            1 MSGSNQKQWSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEPVSID   72 (81)
Q Consensus         1 ~~~~s~~~WT~eE~k~fE~aL~~~~p~~~~~RWekIA~~vpgKS~~ev~~ry~~L~~dv~~Ie~g~v~~P~~   72 (81)
                      |++++...||.||+++|++||++| |.++++||++||++| |||++||++||+.|++|+ .||+|+||||+|
T Consensus         3 ~~~~~~~~WT~eE~k~fe~al~~~-p~~t~~RW~~IA~~l-gRt~~eV~~~y~~L~~d~-~~~~G~vp~P~~   71 (72)
T 2cqq_A            3 SGSSGAPEWTEEDLSQLTRSMVKF-PGGTPGRWEKIAHEL-GRSVTDVTTKAKQLKDSV-TCSPGMVSGPSS   71 (72)
T ss_dssp             CCCCCCCCCCHHHHHHHHHHHHHS-CTTCTTHHHHHHHHH-TSCHHHHHHHHHHHHHSC-CCCSCCCSCSCC
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHC-CCCCCcHHHHHHHHh-CCCHHHHHHHHHHHHHhc-CccCCCCCCCCC
Confidence            567777899999999999999999 999999999999998 999999999999999997 689999999998
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cxy_A BAF250B subunit, HBAF250B; DNA-binding domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Homo sapiens} PDB: 2eh9_A 1ryu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 81
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-09
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 8e-06
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 7e-05
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 0.004
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]

 Score = 46.5 bits (110), Expect = 2e-09
 Identities = 24/62 (38%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 7  KQWSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGF 66
          + WS +ENKAFE  +A+Y K    + W  +   V  +T +E+K H++ L+ED++ IE G 
Sbjct: 2  RPWSAKENKAFERALAVYDK-DTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGK 60

Query: 67 EP 68
           P
Sbjct: 61 VP 62
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.94
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.87
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.76
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.45
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.44
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.42
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.41
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.39
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.37
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.24
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.23
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.19
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.16
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.07
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.05
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.92
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 98.84
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 98.03
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 98.01
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 94.68
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 94.38
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 91.23
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 89.27
d1lvaa364 C-terminal fragment of elongation factor SelB {Moo 88.48
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 86.52
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 84.74
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 84.53
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 84.18
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 83.73
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 82.8
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 82.59
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 82.29
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 81.74
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 80.95
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]

Probab=99.94  E-value=3.9e-27  Score=139.82  Aligned_cols=63  Identities=37%  Similarity=0.694  Sum_probs=60.9

Q ss_pred             CCCCCHHHHHHHHHHHHhhccCCCchHHHHHHHhCCCCCHHHHHHHHHHHHHHHhhhhcCCCCC
Q 040518            6 QKQWSWEENKAFENGVALYYKEGQDEEWVKIHSLVPTKTIDEIKVHFKKLMEDLELIEFGFEPV   69 (81)
Q Consensus         6 ~~~WT~eE~k~fE~aL~~~~p~~~~~RWekIA~~vpgKS~~ev~~ry~~L~~dv~~Ie~g~v~~   69 (81)
                      ++.||.|||++|+.|+++| +.+.++||.+||..|||||..||++||+.|++||+.||+|+|||
T Consensus         1 G~~WT~eEd~~L~~~v~~~-~~~~~~~W~~Ia~~l~gRt~~qc~~r~~~L~~dik~iesg~vpf   63 (63)
T d2cjja1           1 GRPWSAKENKAFERALAVY-DKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF   63 (63)
T ss_dssp             CCSCCHHHHHHHHHHHHHS-CTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred             CcCCCHHHHHHHHHHHHHH-CCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHHhhccccCCCCC
Confidence            3579999999999999999 99999999999999999999999999999999999999999997
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure