Citrus Sinensis ID: 040546

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MVLLQQLERGVKPVQSYYNSMTYLKQLSLTQGSISSNIICYPSLISKPISKVEAKELAAKKHSEAERRRRLRINDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQRTVREQKALCQVHEECVFPSEANELSLRNCNRDRGMLKVTLSCEDQPELMSDLSRALRSVKGRLVRAEMVPVGGRIKCVLWVQGFKGNEGMVMLKRALNLVIDRPVSPGNSSKLRFYH
cccHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccEEEEEEEccccccHHHHHHHHHHccccEEEEEEEEEEccEEEEEEEEEEEccccHHHHHHHHHHHHHcccccccccccccccc
cEEEEcccccccccccccccHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEcccccccHHHHHHHHHHHHHccccccccccccccc
MVLLQQLERGVKPVQSYYNSMTYLKQLSltqgsissniicypsliskpiSKVEAKELAAKKHSEAERRRRLRINDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQRTVREQKALCQVheecvfpseanelslrncnrdrgmlkvtlscedqpeLMSDLSRALRSVKGRLVRAEMVPVGGRIKCVLWvqgfkgneGMVMLKRALNLvidrpvspgnssklrfyh
mvllqqlergvkpVQSYYNSMTYLKQLSLTQGSISSNIICYPSLISKPISKVEAKELaakkhseaerrrrlrindqydnlrkilpnlvkvdkasvLAKTIKTVRELQRTVREQKALCQVheecvfpseanelslrncNRDRGMLKVTLSCEDQPELMSDLSRALRSVKgrlvraemvpvggrikCVLWVQGFKGNEGMVMLKRALNlvidrpvspgnssklrfyh
MVLLQQLERGVKPVQSYYNSMTYLKQLSLTQGSISSNIICYPSLISKPISKVEAKELAAKKHSEAERRRRLRINDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQRTVREQKALCQVHEECVFPSEANELSLRNCNRDRGMLKVTLSCEDQPELMSDLSRALRSVKGRLVRAEMVPVGGRIKCVLWVQGFKGNEGMVMLKRALNLVIDRPVSPGNSSKLRFYH
**********VKPVQSYYNSMTYLKQLSLTQGSISSNIICYPSLISKPI**********************RINDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQRTVREQKALCQVHEECVFPSEANELSLRNCNRDRGMLKVTLSC***********RALRSVKGRLVRAEMVPVGGRIKCVLWVQGFKGNEGMVMLKRALNLVID***************
**********************************************************************LRINDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQ**********************************GMLKVTLSCEDQPELMSDLSRALRSVKGRLVRAEMVPVGGRIKCVLWVQGFKG*****MLKRAL********************
MVLLQQLERGVKPVQSYYNSMTYLKQLSLTQGSISSNIICYPSLISKPISKVEA************RRRRLRINDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQRTVREQKALCQVHEECVFPSEANELSLRNCNRDRGMLKVTLSCEDQPELMSDLSRALRSVKGRLVRAEMVPVGGRIKCVLWVQGFKGNEGMVMLKRALNLVIDRPVSPGNSSKLRFYH
MVLL***ERGVKPVQSYYNSMT*L*******************************************RRRLRINDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQRTVREQKALCQV*EECVFPSEANELSLRNCNRDRGMLKVTLSCEDQPELMSDLSRALRSVKGRLVRAEMVPVGGRIKCVLWVQGFKGNEGMVMLKRALNLVIDR**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLLQQLERGVKPVQSYYNSMTYLKQLSLTQGSISSNIICYPSLISKPISKVEAKELAAKKHSEAERRRRLRINDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQRTVREQKALCQVHEECVFPSEANELSLRNCNRDRGMLKVTLSCEDQPELMSDLSRALRSVKGRLVRAEMVPVGGRIKCVLWVQGFKGNEGMVMLKRALNLVIDRPVSPGNSSKLRFYH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
P0CB25256 Transcription factor bHLH yes no 0.813 0.714 0.446 1e-41
Q9LET0230 Putative transcription fa no no 0.697 0.682 0.388 7e-20
Q9S7Y1368 Transcription factor bHLH no no 0.586 0.358 0.416 5e-19
Q9LS08344 Transcription factor AIG1 no no 0.586 0.383 0.415 1e-17
O80674253 Transcription factor bHLH no no 0.844 0.750 0.370 1e-16
Q9XEF0254 Transcription factor bHLH no no 0.577 0.511 0.335 1e-16
P13027612 Anthocyanin regulatory R- N/A no 0.262 0.096 0.45 8e-07
Q84TK1458 Transcription factor bHLH no no 0.248 0.122 0.392 1e-06
Q9ZPY8566 Transcription factor ABA- no no 0.222 0.088 0.46 1e-06
O23487467 Transcription factor bHLH no no 0.235 0.113 0.433 2e-06
>sp|P0CB25|BH131_ARATH Transcription factor bHLH131 OS=Arabidopsis thaliana GN=BHLH131 PE=2 SV=1 Back     alignment and function desciption
 Score =  169 bits (429), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 124/195 (63%), Gaps = 12/195 (6%)

Query: 6   QLERGVKPVQSYYNSMTYLKQLS---LTQGSISSNIICYPSLISKPISKVEAKELAAKKH 62
           QLE+G++P+   YN   Y   +        + SS +      ++KP SK E+KE+AAKKH
Sbjct: 37  QLEQGMRPISRCYNPTAYSTTMGRSFFAGAATSSKLFSRGFSVTKPKSKTESKEVAAKKH 96

Query: 63  SEAERRRRLRINDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQRTVREQKALCQVHEE 122
           S+AERRRRLRIN Q+  LR ILPNLVK DKASVL +T++   EL++ V++          
Sbjct: 97  SDAERRRRLRINSQFATLRTILPNLVKQDKASVLGETVRYFNELKKMVQDIPTT------ 150

Query: 123 CVFPSEANELSLRNCNRDRGMLKVTLSCEDQPELMSDLSRALRSVKGRLVRAEMVPVGGR 182
              PS  + L L +CN +R + +V  SC D+  LMS+++ ++++VK + VRAE++ VGGR
Sbjct: 151 ---PSLEDNLRLDHCNNNRDLARVVFSCSDREGLMSEVAESMKAVKAKAVRAEIMTVGGR 207

Query: 183 IKCVLWVQGFKGNEG 197
            KC L+VQG  GNEG
Sbjct: 208 TKCALFVQGVNGNEG 222

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LET0|BH107_ARATH Putative transcription factor bHLH107 OS=Arabidopsis thaliana GN=BHLH107 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7Y1|BH030_ARATH Transcription factor bHLH30 OS=Arabidopsis thaliana GN=BHLH30 PE=1 SV=1 Back     alignment and function description
>sp|Q9LS08|BH032_ARATH Transcription factor AIG1 OS=Arabidopsis thaliana GN=BHLH32 PE=1 SV=1 Back     alignment and function description
>sp|O80674|BH106_ARATH Transcription factor bHLH106 OS=Arabidopsis thaliana GN=BHLH106 PE=2 SV=1 Back     alignment and function description
>sp|Q9XEF0|BH051_ARATH Transcription factor bHLH51 OS=Arabidopsis thaliana GN=BHLH51 PE=2 SV=1 Back     alignment and function description
>sp|P13027|ARRS_MAIZE Anthocyanin regulatory R-S protein OS=Zea mays GN=R-S PE=2 SV=1 Back     alignment and function description
>sp|Q84TK1|BH010_ARATH Transcription factor bHLH10 OS=Arabidopsis thaliana GN=BHLH10 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPY8|AIB_ARATH Transcription factor ABA-INDUCIBLE bHLH-TYPE OS=Arabidopsis thaliana GN=AIB PE=2 SV=2 Back     alignment and function description
>sp|O23487|BH003_ARATH Transcription factor bHLH3 OS=Arabidopsis thaliana GN=BHLH3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
357485571 531 Transcription factor bHLH131 [Medicago t 0.92 0.389 0.486 1e-46
297802128225 predicted protein [Arabidopsis lyrata su 0.911 0.911 0.436 3e-43
257096239256 RecName: Full=Transcription factor bHLH1 0.813 0.714 0.446 6e-40
42567496 1513 basic helix-loop-helix domain-containing 0.813 0.120 0.446 2e-39
4467113 1496 hypothetical protein [Arabidopsis thalia 0.835 0.125 0.420 4e-38
255579702246 conserved hypothetical protein [Ricinus 0.942 0.861 0.421 6e-35
449451601216 PREDICTED: transcription factor bHLH131- 0.733 0.763 0.462 1e-30
224067074242 predicted protein [Populus trichocarpa] 0.888 0.826 0.394 1e-29
225459105 553 PREDICTED: uncharacterized protein LOC10 0.88 0.358 0.378 8e-27
116268417238 hypothetical protein [Prunus persica] 0.893 0.844 0.373 1e-26
>gi|357485571|ref|XP_003613073.1| Transcription factor bHLH131 [Medicago truncatula] gi|355514408|gb|AES96031.1| Transcription factor bHLH131 [Medicago truncatula] Back     alignment and taxonomy information
 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/216 (48%), Positives = 145/216 (67%), Gaps = 9/216 (4%)

Query: 9   RGVKPVQSYYNSMTYLKQLSLTQGSISSNIICYPSLISKPISKVEAKELAAKKHSEAERR 68
           +G++ V++YYN    + + + +   IS     + S  SK  SK E K LAAKKHSEAE+R
Sbjct: 323 QGMQHVRNYYNGEAQMLRSNFSSSFISQT---FKSSFSKQRSKAENKLLAAKKHSEAEKR 379

Query: 69  RRLRINDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQRTVREQKALCQVHEECVFPSE 128
           RR+RIN QYD LR ILPNL+K DKAS+L +TIK V++L++   + +      +E  FPS 
Sbjct: 380 RRMRINGQYDTLRSILPNLIKKDKASILVETIKQVKDLKKKASKLEDSHGTSKEIKFPSG 439

Query: 129 ANELSLRNCNRDRGMLKVTLSCEDQPELMSDLSRALRSVKGRLVRAEMVPVGGRIKCVLW 188
           A++L+L  CN D G++K TLSCED+P LMS +SRAL S+K ++V+ EMV VGGR + VLW
Sbjct: 440 ADKLNLEKCNDDEGLVKATLSCEDRPGLMSSISRALLSMKAKVVKVEMVTVGGRTRSVLW 499

Query: 189 VQGFKGNEGMVMLKRALNLVIDRPVSPGNSSKLRFY 224
           VQG + NE + MLK  L +V+ +P     S K+R Y
Sbjct: 500 VQGVE-NESLGMLKSTLKVVMHKP-----SFKMRQY 529

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297802128|ref|XP_002868948.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297314784|gb|EFH45207.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|257096239|sp|P0CB25.1|BH131_ARATH RecName: Full=Transcription factor bHLH131; AltName: Full=Basic helix-loop-helix protein 131; Short=AtbHLH131; Short=bHLH 131; AltName: Full=bHLH transcription factor bHLH131 gi|33111975|emb|CAE12174.1| putative bHLH131 transcription factor [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42567496|ref|NP_195520.2| basic helix-loop-helix domain-containing protein [Arabidopsis thaliana] gi|332661471|gb|AEE86871.1| basic helix-loop-helix domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4467113|emb|CAB37547.1| hypothetical protein [Arabidopsis thaliana] gi|7270790|emb|CAB80472.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255579702|ref|XP_002530690.1| conserved hypothetical protein [Ricinus communis] gi|223529746|gb|EEF31685.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449451601|ref|XP_004143550.1| PREDICTED: transcription factor bHLH131-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224067074|ref|XP_002302342.1| predicted protein [Populus trichocarpa] gi|222844068|gb|EEE81615.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225459105|ref|XP_002283873.1| PREDICTED: uncharacterized protein LOC100250519 [Vitis vinifera] Back     alignment and taxonomy information
>gi|116268417|gb|ABJ96374.1| hypothetical protein [Prunus persica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
TAIR|locus:2063203253 AT2G41130 "AT2G41130" [Arabido 0.844 0.750 0.370 6.1e-23
TAIR|locus:2012393368 AT1G68810 "AT1G68810" [Arabido 0.595 0.364 0.417 1.3e-22
TAIR|locus:2103560230 AT3G56770 "AT3G56770" [Arabido 0.782 0.765 0.381 1.3e-22
TAIR|locus:2085964344 BHLH32 "AT3G25710" [Arabidopsi 0.586 0.383 0.429 1.9e-21
UNIPROTKB|Q7F7Z2258 Os01g0159800 "ESTs C26093(C116 0.933 0.813 0.315 4.4e-20
UNIPROTKB|Q6ZA99345 P0431A03.9 "Os08g0432800 prote 0.613 0.4 0.401 1.2e-19
UNIPROTKB|Q6ESL3363 OJ1294_G06.8 "DNA binding prot 0.253 0.157 0.586 1.7e-19
UNIPROTKB|Q7XZF8268 OSJNBb0033J23.9 "Helix-loop-he 0.608 0.511 0.324 8.1e-19
UNIPROTKB|Q69MD0215 OSJNBb0019B14.23 "BHLH-like pr 0.56 0.586 0.383 1.2e-17
UNIPROTKB|Q9FTQ1267 P0665D10.21 "DNA binding prote 0.693 0.584 0.337 1.2e-17
TAIR|locus:2063203 AT2G41130 "AT2G41130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 265 (98.3 bits), Expect = 6.1e-23, P = 6.1e-23
 Identities = 76/205 (37%), Positives = 113/205 (55%)

Query:    17 YYNSMTYLKQLSLTQGSISSNIICYPSLISKPISKVEAKE--LAA-KKHSEAERRRRLRI 73
             Y  S  Y+  +    GS SS    YP  IS  I +  A++  LAA + H EAERRRR RI
Sbjct:    24 YCVSGDYMTTMQSLCGSSSSTSSYYPLAISG-IGETMAQDRALAALRNHKEAERRRRERI 82

Query:    74 NDQYDNLRKILPNLVKVDKASVLAKTIKTVRELQRTVREQKALCQVHEECVFPSEANELS 133
             N   + LR +L    K DKA++LAK ++ VREL++   E        ++ + PSE +E+S
Sbjct:    83 NSHLNKLRNVLSCNSKTDKATLLAKVVQRVRELKQQTLETSD----SDQTLLPSETDEIS 138

Query:   134 LRN----CNRDRGMLKVTLSCEDQPELMSDLSRALRSVKGRLVRAEMVPVGGRIKCVLWV 189
             + +     N    + K +L CED+ +L+ DL   L+S+  + +RAEMV +GGR + VL V
Sbjct:   139 VLHFGDYSNDGHIIFKASLCCEDRSDLLPDLMEILKSLNMKTLRAEMVTIGGRTRSVLVV 198

Query:   190 QGFK---GNEGMVMLKRALNLVIDR 211
                K   G E +  L+ AL  +++R
Sbjct:   199 AADKEMHGVESVHFLQNALKSLLER 223
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0009941 "chloroplast envelope" evidence=IDA
TAIR|locus:2012393 AT1G68810 "AT1G68810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103560 AT3G56770 "AT3G56770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085964 BHLH32 "AT3G25710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7F7Z2 Os01g0159800 "ESTs C26093(C11622)" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZA99 P0431A03.9 "Os08g0432800 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ESL3 OJ1294_G06.8 "DNA binding protein-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XZF8 OSJNBb0033J23.9 "Helix-loop-helix DNA-binding domain containing protein, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q69MD0 OSJNBb0019B14.23 "BHLH-like protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q9FTQ1 P0665D10.21 "DNA binding protein-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 4e-09
smart0035353 smart00353, HLH, helix loop helix domain 1e-08
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 4e-08
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 0.001
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information 
 Score = 50.5 bits (122), Expect = 4e-09
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 60  KKHSEAERRRRLRINDQYDNLRKILPNL--VKVDKASVLAKTIKTVRELQ 107
           K H+E ERRRR RIND ++ LR++LP     K+ KA +L   I+ ++ LQ
Sbjct: 3   KAHNERERRRRDRINDAFEELRELLPTPPNKKLSKAEILRLAIEYIKHLQ 52

Length = 52
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.48
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.47
smart0035353 HLH helix loop helix domain. 99.43
KOG1318411 consensus Helix loop helix transcription factor EB 99.15
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 99.15
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 99.07
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.98
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.9
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.81
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 98.77
KOG4304250 consensus Transcriptional repressors of the hairy/ 98.69
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 98.66
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 98.44
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 98.4
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 98.37
KOG0561 373 consensus bHLH transcription factor [Transcription 98.3
PRK05007884 PII uridylyl-transferase; Provisional 98.27
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 98.21
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 98.16
PRK01759854 glnD PII uridylyl-transferase; Provisional 98.12
PRK00275895 glnD PII uridylyl-transferase; Provisional 98.07
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 98.04
PRK04374869 PII uridylyl-transferase; Provisional 98.0
PRK03059856 PII uridylyl-transferase; Provisional 97.86
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 97.86
PRK05092931 PII uridylyl-transferase; Provisional 97.81
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 97.8
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 97.79
PRK03381774 PII uridylyl-transferase; Provisional 97.77
PRK01759854 glnD PII uridylyl-transferase; Provisional 97.71
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 97.69
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 97.67
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 97.65
PRK05007884 PII uridylyl-transferase; Provisional 97.63
PRK03381774 PII uridylyl-transferase; Provisional 97.61
PLN0321793 transcription factor ATBS1; Provisional 97.58
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 97.57
KOG4029228 consensus Transcription factor HAND2/Transcription 97.49
PRK03059856 PII uridylyl-transferase; Provisional 97.49
PRK0019490 hypothetical protein; Validated 97.45
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.4
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 97.39
PRK04374869 PII uridylyl-transferase; Provisional 97.32
PRK00275 895 glnD PII uridylyl-transferase; Provisional 97.28
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 97.28
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.27
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 97.27
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 97.25
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.22
PRK05092 931 PII uridylyl-transferase; Provisional 97.06
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 96.82
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 96.76
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.68
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 96.25
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 96.08
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 96.05
PRK04435147 hypothetical protein; Provisional 95.98
PRK08577136 hypothetical protein; Provisional 95.77
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 95.74
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 95.7
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 95.67
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 95.5
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 95.38
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 95.31
KOG3910632 consensus Helix loop helix transcription factor [T 95.19
PRK11589 190 gcvR glycine cleavage system transcriptional repre 95.14
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 95.13
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 95.09
cd0211660 ACT ACT domains are commonly involved in specifica 95.08
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 94.97
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 94.81
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 94.56
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 93.91
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 93.86
PRK07334403 threonine dehydratase; Provisional 93.73
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 93.7
COG383090 ACT domain-containing protein [Signal transduction 93.59
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 93.58
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 93.49
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 93.16
KOG4447173 consensus Transcription factor TWIST [Transcriptio 93.11
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 92.37
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 92.31
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 92.29
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 92.04
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 92.03
COG4492150 PheB ACT domain-containing protein [General functi 91.78
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 91.75
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 91.57
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 91.32
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 90.97
KOG4395285 consensus Transcription factor Atonal, contains HT 90.72
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 90.64
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 90.62
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 90.49
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 89.83
PRK00227693 glnD PII uridylyl-transferase; Provisional 89.78
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 89.65
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 89.43
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 89.12
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 89.08
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 88.83
PRK00227693 glnD PII uridylyl-transferase; Provisional 88.18
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 86.81
CHL00100174 ilvH acetohydroxyacid synthase small subunit 86.67
KOG3898254 consensus Transcription factor NeuroD and related 85.53
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 84.98
PRK11899279 prephenate dehydratase; Provisional 84.77
PRK11589190 gcvR glycine cleavage system transcriptional repre 84.38
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 83.62
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 83.16
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 81.9
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information 
Probab=99.48  E-value=8.4e-14  Score=95.33  Aligned_cols=53  Identities=43%  Similarity=0.713  Sum_probs=50.0

Q ss_pred             HhhhccHHHHHHHHHHHHhHHHHHhhCCCC---CcCChhhhhHHHHHHHHHHHHHH
Q 040546           58 AAKKHSEAERRRRLRINDQYDNLRKILPNL---VKVDKASVLAKTIKTVRELQRTV  110 (225)
Q Consensus        58 ~~~~h~~~Er~RR~~in~~~~~Lr~lvP~~---~k~dK~sil~~ai~yi~~L~~~~  110 (225)
                      .+..|+.+||+||++||+.|..|+++||..   .+.||++||..||+||+.|+.++
T Consensus         4 ~r~~~~~~Er~RR~~~n~~~~~L~~llp~~~~~~k~~k~~iL~~a~~yI~~L~~~~   59 (60)
T cd00083           4 RREAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELL   59 (60)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHh
Confidence            567899999999999999999999999977   89999999999999999999876

A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 3e-10
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 2e-09
1hlo_A80 Protein (transcription factor MAX); transcriptiona 3e-09
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 3e-09
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 7e-09
4f3l_A 361 Mclock, circadian locomoter output cycles protein 6e-07
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 2e-05
1a0a_A63 BHLH, protein (phosphate system positive regulator 7e-04
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
 Score = 53.9 bits (130), Expect = 3e-10
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 62  HSEAERRRRLRINDQYDNLRKILPNL-VKVDKASVLAKTIKTVRELQRTVREQKA 115
           H+  E+R R  IND+   L+ ++     K++K++VL K I  +R LQ + ++ K 
Sbjct: 10  HNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQ 64
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.7
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.63
4ati_A118 MITF, microphthalmia-associated transcription fact 99.6
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.59
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.59
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.58
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.58
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.58
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.57
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.5
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.48
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.25
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.21
4f3l_A 361 Mclock, circadian locomoter output cycles protein 99.11
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.98
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.7
4ath_A83 MITF, microphthalmia-associated transcription fact 98.68
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.17
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.8
1u8s_A 192 Glycine cleavage system transcriptional repressor, 97.42
2nyi_A 195 Unknown protein; protein structure initiative, PSI 97.31
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 97.08
2nyi_A195 Unknown protein; protein structure initiative, PSI 96.79
1u8s_A192 Glycine cleavage system transcriptional repressor, 96.51
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 96.22
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 96.1
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 95.82
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 95.41
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 95.19
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 95.12
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 94.22
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 93.31
2pc6_A165 Probable acetolactate synthase isozyme III (small; 93.28
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 92.8
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 91.68
3luy_A329 Probable chorismate mutase; structural genomics, A 80.08
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.70  E-value=2.6e-17  Score=119.98  Aligned_cols=63  Identities=29%  Similarity=0.354  Sum_probs=58.2

Q ss_pred             HHHhhhccHHHHHHHHHHHHhHHHHHhhCCCC-CcCChhhhhHHHHHHHHHHHHHHHHHHhhhc
Q 040546           56 ELAAKKHSEAERRRRLRINDQYDNLRKILPNL-VKVDKASVLAKTIKTVRELQRTVREQKALCQ  118 (225)
Q Consensus        56 ~~~~~~h~~~Er~RR~~in~~~~~Lr~lvP~~-~k~dK~sil~~ai~yi~~L~~~~~~l~~~~~  118 (225)
                      ..++.+|+.+||+||++||+.|..|++|||.. .|+||++||.+||+||+.|+.+++.|+.+..
T Consensus         4 ~~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~   67 (82)
T 1am9_A            4 GEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENL   67 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34678999999999999999999999999987 8999999999999999999999999987654
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 9e-09
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 2e-08
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 3e-08
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 3e-08
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 8e-08
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 2e-07
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 3e-07
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 1e-06
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myod B/HLH domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 48.3 bits (115), Expect = 9e-09
 Identities = 13/55 (23%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 60  KKHSEAERRRRLRINDQYDNLRKILPNL--VKVDKASVLAKTIKTVRELQRTVRE 112
           K  +  ERRR  ++N+ ++ L++   +    ++ K  +L   I+ +  LQ  +R+
Sbjct: 14  KAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD 68
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.58
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.57
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.55
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.47
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.9
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 97.84
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 97.26
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 96.9
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 95.35
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 94.5
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 92.23
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 90.89
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 90.52
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 90.12
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 89.61
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 88.97
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 88.56
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.63  E-value=2.2e-16  Score=112.74  Aligned_cols=63  Identities=29%  Similarity=0.354  Sum_probs=57.2

Q ss_pred             HHHhhhccHHHHHHHHHHHHhHHHHHhhCCCC-CcCChhhhhHHHHHHHHHHHHHHHHHHhhhc
Q 040546           56 ELAAKKHSEAERRRRLRINDQYDNLRKILPNL-VKVDKASVLAKTIKTVRELQRTVREQKALCQ  118 (225)
Q Consensus        56 ~~~~~~h~~~Er~RR~~in~~~~~Lr~lvP~~-~k~dK~sil~~ai~yi~~L~~~~~~l~~~~~  118 (225)
                      +..+.+|+.+||+||++||+.|..|++|||.. .|+||++||.+||+||+.|+.+++.|..+..
T Consensus         4 ~~kR~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~   67 (80)
T d1am9a_           4 GEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENL   67 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45678999999999999999999999999975 6899999999999999999999999876543
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure