Citrus Sinensis ID: 040671

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MELLRLSKFKFQLQALIAETRHLKEKENSATEEIHLLVQKQKRNEEEYSRNLKELQSELASTNELCQKLERKVSYLQNDNALLENKQKELKETINRLLQYRENFLSAYEESTCDMKRAIETRDRKLTVLHEKINSHLTLFDSIEKEAFSIKQVVDNVECVPYLQKTLSAKDVVIQNLISEKEALHLEVGKLGIILQRIQDAIATMNQEDNNAFHTALMLKENCNDIGTVNEDTRWLDRVKDANYNGGERSPSKASSLTAPENRASPLCQKHIALGSQFRENNNFSSCVPELAGSLQDPESDSSEQQSSTNILMRISAKDVKDTCVVSAHHPDSECSMTQAETSKESRLNSNAAFQFHF
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHccccHHHccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccHcHHHHHHHHcHHHHcHHHHHHHHHHHHHHHHHHcccccHHHHcccccccccccHHHHHHcccccHHcccccccccccHHcccccccccccHHHHHHHcccccEEccccccccEEEEEccccccHHHcccccHHHHHHccEEEcHcc
MELLRLSKFKFQLQALIAETRHLKEKENSATEEIHLLVQKQKRNEEEYSRNLKELQSELASTNELCQKLERKVSYLQNDNALLENKQKELKETINRLLQYRENFLSAYEESTCDMKRAIETRDRKLTVLHEKINSHLTLFDSIEKEAFSIKQVVDnvecvpylqktlsaKDVVIQNLISEKEALHLEVGKLGIILQRIQDAIATMNQEDNNAFHTALMLKEncndigtvnedtrwLDRVKdanynggerspskassltapenrasplcqkhialgsqfrennnfsscvpelagslqdpesdsseqqsSTNILMRIsakdvkdtcvvsahhpdsecsmtqaetskesrlnsnaafqfhf
mellrlskfkfQLQALIAETRhlkekensateEIHLLVQKQKRNEEEYSRNLKELQSELASTNELCQKLERKVSYLQNDNALLENKQKELKETINRLLQYRENFLSAYEESTCDMKRAIETRDRKLTVLHEKINSHLTLFDSIEKEAFSIKQVVDNVECVPYLQKTLSAKDVVIQNLISEKEALHLEVGKLGIILQRIQDAIATMNQEDNNAFHTALMLKENCNDIGtvnedtrwlDRVKDanynggerspskassltapeNRASPLCQKHIALGSQFRENNNFSSCVPELAGSLQDPESDSSEQQSSTNILMRISAKDVKDTCVVSAHhpdsecsmtqaetskesrlnsnaafqfhf
MELLRLSKFKFQLQALIAETRHLKEKENSATEEIHLLVQKQKRNEEEYSRNLKELQSELASTNELCQKLERKVSYLQNDNALLENKQKELKETINRLLQYRENFLSAYEESTCDMKRAIETRDRKLTVLHEKINSHLTLFDSIEKEAFSIKQVVDNVECVPYLQKTLSAKDVVIQNLISEKEALHLEVGKLGIILQRIQDAIATMNQEDNNAFHTALMLKENCNDIGTVNEDTRWLDRVKDANYNGGERSPSKASSLTAPENRASPLCQKHIALGSQFRENNNFSSCVPELAGslqdpesdsseqqssTNILMRISAKDVKDTCVVSAHHPDSECSMTQAETSKESRLNSNAAFQFHF
*******KFKFQLQALIA******************************************************VSYLQ***ALL******LKETINRLLQYRENFLSAYEESTCDMKRAIETRDRKLTVLHEKINSHLTLFDSIEKEAFSIKQVVDNVECVPYLQKTLSAKDVVIQNLISEKEALHLEVGKLGIILQRIQDAIATMNQEDNNAFHTALMLKENCNDIGTVNEDTRWLDRVK***********************************************************************************CV*********************************
****R*SKFKF**********************************************************************************************************************************************************************************KLGIILQRIQ************************************************************************************************************************VKDTCVVSAH************************FQFHF
MELLRLSKFKFQLQALIAETRHLKEKENSATEEIHLLVQKQKRNEEEYSRNLKELQSELASTNELCQKLERKVSYLQNDNALLENKQKELKETINRLLQYRENFLSAYEESTCDMKRAIETRDRKLTVLHEKINSHLTLFDSIEKEAFSIKQVVDNVECVPYLQKTLSAKDVVIQNLISEKEALHLEVGKLGIILQRIQDAIATMNQEDNNAFHTALMLKENCNDIGTVNEDTRWLDRVKDANYN*****************RASPLCQKHIALGSQFRENNNFSSCVPE******************TNILMRISAKDVKDTCVVSAH******************LNSNAAFQFHF
MELLRLSKFKFQLQALIAETRHLKEKENSATEEIHLLVQKQKRNEEEYSRNLKELQSELASTNELCQKLERKVSYLQNDNALLENKQKELKETINRLLQYRENFLSAYEESTCDMKRAIETRDRKLTVLHEKINSHLTLFDSIEKEAFSIKQVVDNVECVPYLQKTLSAKDVVIQNLISEKEALHLEVGKLGIILQRIQDAIATMNQEDNNAFHTALMLKENCNDIGTVNEDTRWLDRVKDANYNGG******************PLCQKHIALGSQFRENNNFSSCVPELAGSLQD*ESDS*EQQS*TNILMRISAKDVKDTCVVSAHHPDSECSM*****SKESRLNSNA*FQ**F
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELLRLSKFKFQxxxxxxxxxxxxxxxxxxxxxIHLLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFLSAYEESTCDMKRAIETRDRKLTVLHEKINSHLTLFDSIEKEAFSIKQVVDNVECVPYLQKTLSAKDVVIQNLISEKEALHLEVGKLGIILQRIQDAIATMNQEDNNAFHTALMLKENCNDIGTVNEDTRWLDRVKDANYNGGERSPSKASSLTAPENRASPLCQKHIALGSQFRENNNFSSCVPELAGSLQDPESDSSEQQSSTNILMRISAKDVKDTCVVSAHHPDSECSMTQAETSKESRLNSNAAFQFHF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
224102471334 predicted protein [Populus trichocarpa] 0.899 0.964 0.495 5e-76
255558298169 hypothetical protein RCOM_0699210 [Ricin 0.441 0.934 0.734 2e-59
356497820290 PREDICTED: uncharacterized protein LOC10 0.578 0.713 0.488 3e-53
359473394299 PREDICTED: uncharacterized protein LOC10 0.497 0.595 0.635 1e-50
296086465182 unnamed protein product [Vitis vinifera] 0.469 0.923 0.629 4e-50
357486403418 hypothetical protein MTR_5g037260 [Medic 0.405 0.346 0.6 6e-42
240254053431 uncharacterized protein [Arabidopsis tha 0.441 0.366 0.465 4e-35
356501950331 PREDICTED: uncharacterized protein LOC10 0.407 0.441 0.545 1e-34
357140438306 PREDICTED: uncharacterized protein LOC10 0.432 0.506 0.419 5e-21
413934228394 hypothetical protein ZEAMMB73_282077 [Ze 0.444 0.403 0.298 2e-18
>gi|224102471|ref|XP_002312690.1| predicted protein [Populus trichocarpa] gi|222852510|gb|EEE90057.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  290 bits (743), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 176/355 (49%), Positives = 228/355 (64%), Gaps = 33/355 (9%)

Query: 1   MELLRLSKFKFQLQALIAETRHLKEKENSATEEIHLLVQKQKRNEEEYSRNLKELQSELA 60
           MELL+LSKFK QLQAL  E   L+E+E SATE+  +L+QKQK+ +EEY R L+ELQSELA
Sbjct: 1   MELLKLSKFKLQLQALAIEVGGLREREQSATEQCRILIQKQKQTDEEYRRQLQELQSELA 60

Query: 61  STNELCQKLERKVSYLQNDNALLENKQKELKETINRLLQYRENFLSAYEESTCDMKRAIE 120
           S+NEL QKL RKVSYLQNDNALLE+K K+LK TI  LLQ +E+F+++Y+E TC+MKR+IE
Sbjct: 61  SSNELHQKLLRKVSYLQNDNALLEDKHKDLKGTIQSLLQSKESFVNSYQELTCEMKRSIE 120

Query: 121 TRDRKLTVLHEKINSHLTLFDSIEKEAFSIKQVVDNVECVPYLQKTLSAKD--------- 171
             +RKL VL EKINSHL+LFDSIE+EA SIKQ+VD V+ +   ++   A           
Sbjct: 121 AGNRKLIVLSEKINSHLSLFDSIEREALSIKQLVDKVQLLVSEKEGWLAYGARWTRFLLL 180

Query: 172 -VVIQNLISEKEALHLEVGKLGIILQRIQDAIATMNQEDNNAFHTALMLKENCNDIGTVN 230
            +    L+   +ALH EVG L IILQ+IQ+ +  MN+ED   F + L  + +C D+    
Sbjct: 181 KMYFLFLMLYNQALHCEVGGLAIILQKIQETVVNMNEEDKRLFSSLLECQGDC-DMVVTK 239

Query: 231 EDTRWLDRVKDANYNGGERSPSKASSLTAPENRASPLCQKHIALGSQFRENNNFSSCVPE 290
           EDT   DR++D   N GE SP+KASS+   ENR +        +G+      +  +C P 
Sbjct: 240 EDT---DRIEDFVQNSGEPSPNKASSMGTGENRVTR------RIGASM----DMPTCSP- 285

Query: 291 LAGSLQDPESDSSEQQSSTNILMRISAKDVKDTCVVSAHHPDSECSMTQAETSKE 345
               LQ P    SE  S+ N    IS  + K  C   AHH DSECS TQAETS++
Sbjct: 286 ----LQSP---CSELHSAANG-PSISVNNAKVNCTAIAHHLDSECSTTQAETSQD 332

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255558298|ref|XP_002520176.1| hypothetical protein RCOM_0699210 [Ricinus communis] gi|223540668|gb|EEF42231.1| hypothetical protein RCOM_0699210 [Ricinus communis] Back     alignment and taxonomy information
>gi|356497820|ref|XP_003517755.1| PREDICTED: uncharacterized protein LOC100786247 [Glycine max] Back     alignment and taxonomy information
>gi|359473394|ref|XP_003631295.1| PREDICTED: uncharacterized protein LOC100855041 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296086465|emb|CBI32054.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357486403|ref|XP_003613489.1| hypothetical protein MTR_5g037260 [Medicago truncatula] gi|355514824|gb|AES96447.1| hypothetical protein MTR_5g037260 [Medicago truncatula] Back     alignment and taxonomy information
>gi|240254053|ref|NP_001031019.4| uncharacterized protein [Arabidopsis thaliana] gi|332190457|gb|AEE28578.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356501950|ref|XP_003519786.1| PREDICTED: uncharacterized protein LOC100819958 [Glycine max] Back     alignment and taxonomy information
>gi|357140438|ref|XP_003571775.1| PREDICTED: uncharacterized protein LOC100831746 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|413934228|gb|AFW68779.1| hypothetical protein ZEAMMB73_282077 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
TAIR|locus:1009023076431 AT1G10417 "AT1G10417" [Arabido 0.337 0.280 0.636 5.9e-42
RGD|708579 813 Tax1bp1 "Tax1 (human T-cell le 0.620 0.273 0.229 1.8e-05
UNIPROTKB|F1LS64 813 Tax1bp1 "Tax1-binding protein 0.620 0.273 0.229 1.8e-05
POMBASE|SPBC3D6.04c 689 mad1 "mitotic spindle checkpoi 0.675 0.351 0.271 1.9e-05
CGD|CAL0001468 895 SYS3 [Candida albicans (taxid: 0.670 0.268 0.220 2.7e-05
UNIPROTKB|Q59UF5 895 SYS3 "Potential GRIP domain Go 0.670 0.268 0.220 2.7e-05
UNIPROTKB|Q3A9A0155 CHY_2490 "Conserved domain pro 0.357 0.825 0.246 2.9e-05
TIGR_CMR|CHY_2490155 CHY_2490 "conserved domain pro 0.357 0.825 0.246 2.9e-05
DICTYBASE|DDB_G0290503 1492 DDB_G0290503 [Dictyostelium di 0.561 0.134 0.239 4.9e-05
UNIPROTKB|F1SB10830 F1SB10 "Uncharacterized protei 0.544 0.234 0.241 6.7e-05
TAIR|locus:1009023076 AT1G10417 "AT1G10417" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 383 (139.9 bits), Expect = 5.9e-42, Sum P(2) = 5.9e-42
 Identities = 77/121 (63%), Positives = 97/121 (80%)

Query:    38 VQKQKRNEEEYSRNLKELQSELASTNELCQKLERKVSYLQNDNALLENKQKELKETINRL 97
             + KQK+ EE+  R ++ELQ++LAS+ E  + LERKVSYLQND +LLENKQ ELK TI  L
Sbjct:    80 INKQKQTEEDCIRKVQELQADLASSRETQEALERKVSYLQNDYSLLENKQSELKTTIQNL 139

Query:    98 LQYRENFLSAYEESTCDMKRAIETRDRKLTVLHEKINSHLTLFDSIEKEAFSIKQVVDNV 157
             LQ RE+FL+AY+ES C+MK +IE RDRK+ +LHEKI SHLTLFDSIEKEA  IK+V+  V
Sbjct:   140 LQSRESFLNAYQESFCEMKCSIEARDRKILMLHEKITSHLTLFDSIEKEASVIKKVIHEV 199

Query:   158 E 158
             +
Sbjct:   200 Q 200
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
RGD|708579 Tax1bp1 "Tax1 (human T-cell leukemia virus type I) binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LS64 Tax1bp1 "Tax1-binding protein 1 homolog" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
POMBASE|SPBC3D6.04c mad1 "mitotic spindle checkpoint protein Mad1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0001468 SYS3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59UF5 SYS3 "Potential GRIP domain Golgi protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q3A9A0 CHY_2490 "Conserved domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2490 CHY_2490 "conserved domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290503 DDB_G0290503 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1SB10 F1SB10 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.004
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.004
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.004
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information 
 Score = 47.4 bits (113), Expect = 1e-05
 Identities = 42/208 (20%), Positives = 90/208 (43%), Gaps = 14/208 (6%)

Query: 5   RLSKFKFQLQALIAETRHLKEKENSATEEIHLLVQKQKRNEEEYSRNLKELQSELASTNE 64
           +L K + +L++L  E R L++       ++  L    +R  EE  R L  L+ EL     
Sbjct: 682 QLEKLEEELKSLKNELRSLEDLLEELRRQLEEL----ERQLEELKRELAALEEELEQLQS 737

Query: 65  LCQKLERKVSYLQNDNALLENKQKELKETINRLLQYRENFLSAYEESTCDMKRAIETRDR 124
             ++LE ++  L+ +   L+ + +EL+E +  L +         EE     +   E  + 
Sbjct: 738 RLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEE 797

Query: 125 KLTVLHEKINSHLTLFDSIEKEAFSIKQVVDNVECVPYLQKTLSAKDVVIQNLISEKEAL 184
               L E++       D++E+E  S++Q  +       L++ +   +  I+ L  + + L
Sbjct: 798 ----LEEELEEAERRLDALERELESLEQRRER------LEQEIEELEEEIEELEEKLDEL 847

Query: 185 HLEVGKLGIILQRIQDAIATMNQEDNNA 212
             E+ +L   L+ +++ +  +  E    
Sbjct: 848 EEELEELEKELEELKEELEELEAEKEEL 875

Length = 1163
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 358
PRK11637428 AmiB activator; Provisional 96.97
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 96.36
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 96.05
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 95.9
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 95.71
PRK03918 880 chromosome segregation protein; Provisional 95.58
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 95.36
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 95.26
PRK02224 880 chromosome segregation protein; Provisional 95.13
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 94.96
PRK02224 880 chromosome segregation protein; Provisional 94.32
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 94.07
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 93.99
TIGR006061311 rad50 rad50. This family is based on the phylogeno 93.77
KOG0996 1293 consensus Structural maintenance of chromosome pro 93.71
PF13851201 GAS: Growth-arrest specific micro-tubule binding 93.68
TIGR006061311 rad50 rad50. This family is based on the phylogeno 93.67
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.46
PRK11637428 AmiB activator; Provisional 93.13
PF04108412 APG17: Autophagy protein Apg17 ; InterPro: IPR0072 93.06
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 92.93
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 92.84
PRK04778569 septation ring formation regulator EzrA; Provision 92.77
PF00038312 Filament: Intermediate filament protein; InterPro: 92.75
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 92.54
PF05701522 WEMBL: Weak chloroplast movement under blue light; 92.21
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 91.89
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 91.52
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 90.92
PHA02562562 46 endonuclease subunit; Provisional 90.77
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 90.72
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 90.59
PF05911769 DUF869: Plant protein of unknown function (DUF869) 90.16
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 90.15
KOG3584348 consensus cAMP response element binding protein an 90.0
PF09766355 FimP: Fms-interacting protein; InterPro: IPR019163 89.63
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 89.61
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 89.27
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 88.36
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 87.99
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 87.32
PF0917797 Syntaxin-6_N: Syntaxin 6, N-terminal; InterPro: IP 87.1
PRK09039343 hypothetical protein; Validated 86.54
PF15066527 CAGE1: Cancer-associated gene protein 1 family 86.4
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 86.27
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 86.12
PF05218182 DUF713: Protein of unknown function (DUF713); Inte 85.85
PF10205102 KLRAQ: Predicted coiled-coil domain-containing pro 85.74
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 85.49
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 85.05
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 85.02
COG2433652 Uncharacterized conserved protein [Function unknow 84.76
KOG0971 1243 consensus Microtubule-associated protein dynactin 84.7
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 84.63
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 84.45
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 84.28
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 84.07
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 83.81
PF121281201 DUF3584: Protein of unknown function (DUF3584); In 83.74
PRK09039343 hypothetical protein; Validated 83.54
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 83.49
KOG0249 916 consensus LAR-interacting protein and related prot 83.29
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 83.26
KOG0933 1174 consensus Structural maintenance of chromosome pro 83.15
PF10174775 Cast: RIM-binding protein of the cytomatrix active 82.45
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 82.11
PRK10884206 SH3 domain-containing protein; Provisional 81.76
PF01920106 Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 81.67
PRK10884206 SH3 domain-containing protein; Provisional 81.62
PRK04863 1486 mukB cell division protein MukB; Provisional 81.32
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 80.94
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 80.81
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 80.37
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 80.3
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 80.22
>PRK11637 AmiB activator; Provisional Back     alignment and domain information 
Probab=96.97  E-value=0.098  Score=51.13  Aligned_cols=43  Identities=19%  Similarity=0.249  Sum_probs=31.9

Q ss_pred             hhhhhhhhhHHHHHhhhhHHHHHHhhhhHHHHHHHHHHHHHhc
Q 040671          163 LQKTLSAKDVVIQNLISEKEALHLEVGKLGIILQRIQDAIATM  205 (358)
Q Consensus       163 LqKsllvKD~~I~~L~sekqAl~~El~~leiiLqrfQd~~s~m  205 (358)
                      |+.....|...+..|-.+++....++..|+.-.++++..+..+
T Consensus       210 L~~~k~e~~~~l~~L~~~~~~~~~~l~~l~~~~~~L~~~I~~l  252 (428)
T PRK11637        210 LEQARNERKKTLTGLESSLQKDQQQLSELRANESRLRDSIARA  252 (428)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4444455566788888888888888888888888888777655

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF04108 APG17: Autophagy protein Apg17 ; InterPro: IPR007240 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>PF09766 FimP: Fms-interacting protein; InterPro: IPR019163 This entry represents Thoc5 which is one of the subunits of the THO complex, which additionally contains: HPR1, Thoc2, Thoc6 and Thoc7 Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF09177 Syntaxin-6_N: Syntaxin 6, N-terminal; InterPro: IPR015260 Members of this entry, which are found in the amino terminus of various SNARE proteins, adopt a structure consisting of an antiparallel three-helix bundle Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF05218 DUF713: Protein of unknown function (DUF713); InterPro: IPR007883 This family contains proteins of unknown function from Caenorhabditis species Back     alignment and domain information
>PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-04
3ghg_C411 Fibrinogen gamma chain; triple-stranded coiled coi 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 52.9 bits (126), Expect = 1e-07
 Identities = 46/305 (15%), Positives = 97/305 (31%), Gaps = 88/305 (28%)

Query: 50  RNLKELQSELASTNELCQKLERKVSYLQNDNALLENKQKELKETINRLLQYRENFLSAYE 109
           +N    ++ L    +L  +++   +   + ++ ++ +   ++  + RLL+ +      YE
Sbjct: 190 KNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKP-----YE 244

Query: 110 ES------TCDMKRAIE-----------TRDRKLT-VLHEKINSHLTLFDSIEKEAFSIK 151
                     +  +A             TR +++T  L     +H++L         +  
Sbjct: 245 NCLLVLLNVQN-AKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDH--HSMTLTPD 301

Query: 152 QVVDNVECVPYLQKTLSAK--DVVIQNLISEKEALHLEVGKLGIILQRIQDAIATMNQED 209
           +V           K+L  K  D   Q+L  E    +     L II               
Sbjct: 302 EV-----------KSLLLKYLDCRPQDLPREVLTTNPRR--LSII--------------- 333

Query: 210 NNAFHTALMLKENCNDIGTVNEDTRWLDRVKDANYNGGERSPSKAS--SLTAPENRASPL 267
                 A  +++             W D  K  N +       ++S   L   E R    
Sbjct: 334 ------AESIRDGLA---------TW-DNWKHVNCDKLTTI-IESSLNVLEPAEYRK--- 373

Query: 268 CQKHIALGSQFRENNNFSSCVPELAGSLQDPESDSSEQQSSTNILMRIS--AKDVKDTCV 325
               +++   F  + +    +P +  SL   +   S+     N L + S   K  K++  
Sbjct: 374 MFDRLSV---FPPSAH----IPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKES-T 425

Query: 326 VSAHH 330
           +S   
Sbjct: 426 ISIPS 430
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 96.21
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 94.72
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 94.66
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 93.84
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.7
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 93.42
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 92.97
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 92.15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 89.16
4hpq_C413 ATG17, KLTH0D15642P; autophagy, protein transport; 88.91
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 87.79
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 87.59
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 86.54
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 86.36
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 86.23
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 82.37
1zxa_A67 CGMP-dependent protein kinase 1, alpha isozyme; pa 81.23
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 80.34
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
Probab=96.21  E-value=0.37  Score=38.91  Aligned_cols=51  Identities=24%  Similarity=0.328  Sum_probs=23.5

Q ss_pred             HHHHhHHHHHHHhhhcHHHHHHHHhhhhhhccchHHHHHhHHHHHHHHHHH
Q 040671           47 EYSRNLKELQSELASTNELCQKLERKVSYLQNDNALLENKQKELKETINRL   97 (358)
Q Consensus        47 e~~Re~~ELqaElas~~E~~qkLE~kIk~Lenen~~LEkn~keLK~ti~~L   97 (358)
                      ....++..++.++......+.+++..+..++.....++.....+...+..+
T Consensus        59 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  109 (284)
T 1c1g_A           59 KYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLFEEELDRAQERLATA  109 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            334444444444444444444444444444444444444444444444433
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4hpq_C ATG17, KLTH0D15642P; autophagy, protein transport; 3.06A {Lachancea thermotolerans cbs 6340} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure
>1zxa_A CGMP-dependent protein kinase 1, alpha isozyme; parallel coiled coil dimer, transferase; NMR {Homo sapiens} Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
d1lvfa_106 Syntaxin 6, SNAP-25 homolog {Rat (Rattus norvegicu 80.51
>d1lvfa_ a.47.2.1 (A:) Syntaxin 6, SNAP-25 homolog {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All alpha proteins
fold: STAT-like
superfamily: t-snare proteins
family: t-snare proteins
domain: Syntaxin 6, SNAP-25 homolog
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=80.51  E-value=4.9  Score=30.16  Aligned_cols=61  Identities=20%  Similarity=0.285  Sum_probs=37.2

Q ss_pred             hHHHHHHHhhhcHHHHHHHHhhhhhhccchHHHHHhHHHHHHHHHHHHHhhHHHHHHHhhhhhhhHhhh
Q 040671           51 NLKELQSELASTNELCQKLERKVSYLQNDNALLENKQKELKETINRLLQYRENFLSAYEESTCDMKRAI  119 (358)
Q Consensus        51 e~~ELqaElas~~E~~qkLE~kIk~Lenen~~LEkn~keLK~ti~~LLQSRE~Fi~~Ye~stcemk~sI  119 (358)
                      -..||+..+.+...-+.-||+.|...+.+-+.---.        ..-|+.|..||.+++.---.|+-.|
T Consensus        43 ~~~eL~~~l~siewdL~dLe~av~~ve~np~kf~l~--------~~ei~~Rr~fi~~~~~~I~~~~~~l  103 (106)
T d1lvfa_          43 TTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLD--------ATELSIRKAFITSTRQIVRDMKDQM  103 (106)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHSSGGGGTCC--------HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhHHHHHHHHHHHHHhCHHhcCCC--------HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            355666666666666666666666665543321101        2338899999999997655555443