Citrus Sinensis ID: 040713


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MPCAKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGGELPSLEEDGLPTNLHSLWIDGNKKIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPELKYFPEKGLPSSLLQLWIWGCPLIAEKCRKDGGQYWDLLTHIPSVSIANIWDFDDSTADD
cccccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccEEEEcccccccHHHHcccccccccccccEEEccccccccccccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEccEEEcccccccc
cccccccEEEEcccHcHcccccHccccccHHEEEEcccccccccccccccccEEEEcccccHHcccccccccccccccccEEEEcccccccccccccHcccccccccccccEEEEcccHHHHHHHHcccccccccEEEccEEEEccEEEEccccccc
mpcakltrleiydckrlealpkglhnltslqelkiggelpsleedglptnlhsLWIDGNKKIWKSMIERgrgfhrfsSLRHltisgcdddmvsfppelkyfpekglpsslLQLWIWGCPLIAEKCRKDGGQYWDLlthipsvsianiwdfddstadd
mpcakltrleiydcKRLEALPKGLHNLTSLQELKIGGELPSLEEDGLPTNLHSLWIDGNKKIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPELKYFPEKGLPSSLLQLWIWGCPLIAEKCRKDGGQYWDLLTHipsvsianiwdfddstadd
MPCAKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGGELPSLEEDGLPTNLHSLWIDGNKKIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPELKYFPEKGLPSSLLQLWIWGCPLIAEKCRKDGGQYWDLLTHIPSVSIANIWDFDDSTADD
****KLTRLEIYDCKRLEALPKGLHNLTSLQELKIGGELPSLEEDGLPTNLHSLWIDGNKKIWKSMIERGRGFHRFS**********************YFPEKGLPSSLLQLWIWGCPLIAEKCRKDGGQYWDLLTHIPSVSIANIWDF*******
MPCAKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGGELPSLEEDGLPTNLHSLWIDGNKKIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPELKYFPEKGLPSSLLQLWIWGCPLIAEKCRKDGGQYWDLLTHIPSVSIANIWDFD**T***
MPCAKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGGELPSLEEDGLPTNLHSLWIDGNKKIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPELKYFPEKGLPSSLLQLWIWGCPLIAEKCRKDGGQYWDLLTHIPSVSIANIWDFDDSTADD
MPCAKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGGELPSLEEDGLPTNLHSLWIDGNKKIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPELKYFPEKGLPSSLLQLWIWGCPLIAEKCRKDGGQYWDLLTHIPSVSIANIWDFDDS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPCAKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGGELPSLEEDGLPTNLHSLWIDGNKKIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPELKYFPEKGLPSSLLQLWIWGCPLIAEKCRKDGGQYWDLLTHIPSVSIANIWDFDDSTADD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.668 0.073 0.347 1e-06
Q7XBQ9970 Disease resistance protei N/A no 0.675 0.109 0.317 1e-05
Q7XA39988 Putative disease resistan N/A no 0.847 0.134 0.271 0.0003
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 63/118 (53%), Gaps = 13/118 (11%)

Query: 1    MPCAKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGG--ELPSLEEDGLPTNLHSLWIDG 58
            +P  KL+ + + +CK+L+ALP+ L  LTSL  L I    E+ ++   G P+NL +L I  
Sbjct: 1236 LPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISL 1295

Query: 59   NKKIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPELKYFPEKG-LPSSLLQLWI 115
              K+   +     G     +LR+L I G ++D+ S       FPE+G LP S+  L I
Sbjct: 1296 CDKLTPRI---EWGLRDLENLRNLEIDGGNEDIES-------FPEEGLLPKSVFSLRI 1343




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
356554923 1399 PREDICTED: putative disease resistance R 0.936 0.105 0.320 6e-17
400131587 1388 FB_MR5 [Malus x robusta] 0.853 0.096 0.343 7e-17
359495085 1345 PREDICTED: putative disease resistance p 0.891 0.104 0.333 3e-16
359487255 1336 PREDICTED: putative disease resistance p 0.936 0.110 0.326 1e-15
147777746 1199 hypothetical protein VITISV_010202 [Viti 0.891 0.116 0.333 1e-15
147770925 1361 hypothetical protein VITISV_018147 [Viti 0.891 0.102 0.333 5e-15
357456529 1114 Cc-nbs-lrr resistance protein [Medicago 0.840 0.118 0.390 1e-14
296085108 644 unnamed protein product [Vitis vinifera] 0.878 0.214 0.356 2e-14
359496871 1284 PREDICTED: putative disease resistance p 0.936 0.114 0.320 2e-14
147805811 1341 hypothetical protein VITISV_006249 [Viti 0.936 0.109 0.320 2e-14
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 96/206 (46%), Gaps = 59/206 (28%)

Query: 1    MPCAKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGGELPSLE---EDGLPTNLHSLWID 57
            +P + L+ L I  C++L ALP  ++NL SL+EL+IG   PS++   E   P NL SLWI+
Sbjct: 1203 LPASSLSELSIMSCEKLVALPNSMYNLDSLKELEIG-YCPSIQYFPEINFPDNLTSLWIN 1261

Query: 58   GNKK--------IWK------------------------------SMIERG--------- 70
             +          ++K                              S+  +G         
Sbjct: 1262 DHNACEAMFNWGLYKLSFLRDLTIIGGNLFMPLEKLGTMLPSTLTSLTVQGFPHLENLSS 1321

Query: 71   RGFHRFSSLRHLTISGCDDDMVSFPPELKYFPEKGLPSSLLQLWIWGCPLIAEKCRKDGG 130
             GFH+ +SL  L+I  C        P+L   PEKGLPSSLL+L+I  CP + E+CRKD G
Sbjct: 1322 EGFHKLTSLSKLSIYNC--------PKLLCLPEKGLPSSLLELYIQDCPFLKEQCRKDKG 1373

Query: 131  QYWDLLTHIPSVSIANIWDFDDSTAD 156
            + W  +  +P V I   + +D    D
Sbjct: 1374 RDWLKIADVPYVEIDGKFIYDSDYED 1399




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|359495085|ref|XP_003634909.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487255|ref|XP_002269744.2| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147777746|emb|CAN60302.1| hypothetical protein VITISV_010202 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770925|emb|CAN69703.1| hypothetical protein VITISV_018147 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357456529|ref|XP_003598545.1| Cc-nbs-lrr resistance protein [Medicago truncatula] gi|358344304|ref|XP_003636230.1| Cc-nbs-lrr resistance protein [Medicago truncatula] gi|355487593|gb|AES68796.1| Cc-nbs-lrr resistance protein [Medicago truncatula] gi|355502165|gb|AES83368.1| Cc-nbs-lrr resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|296085108|emb|CBI28603.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496871|ref|XP_002269699.2| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147805811|emb|CAN60543.1| hypothetical protein VITISV_006249 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.598 0.066 0.373 3.6e-07
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 131 (51.2 bits), Expect = 3.6e-07, P = 3.6e-07
 Identities = 37/99 (37%), Positives = 56/99 (56%)

Query:     1 MPCAKLTRLEIYDCKRLEALPKGLHNLTSLQELKI--GGELPSLEEDGLPTNLHSLWIDG 58
             +P  KL+ + + +CK+L+ALP+ L  LTSL  L I    E+ ++   G P+NL +L I  
Sbjct:  1236 LPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISL 1295

Query:    59 NKKIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPE 97
               K+    IE G       +LR+L I G ++D+ SFP E
Sbjct:  1296 CDKL-TPRIEWG--LRDLENLRNLEIDGGNEDIESFPEE 1331


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.140   0.461    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      157       157   0.00079  106 3  11 22  0.37    32
                                                     30  0.42    34


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  596 (63 KB)
  Total size of DFA:  176 KB (2101 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  14.98u 0.10s 15.08t   Elapsed:  00:00:03
  Total cpu time:  14.98u 0.10s 15.08t   Elapsed:  00:00:03
  Start:  Sat May 11 08:33:34 2013   End:  Sat May 11 08:33:37 2013


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00028656001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (1336 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.13
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.69
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.66
PRK15386 426 type III secretion protein GogB; Provisional 98.64
KOG0617264 consensus Ras suppressor protein (contains leucine 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.37
KOG0617264 consensus Ras suppressor protein (contains leucine 98.36
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.26
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.24
PRK15386 426 type III secretion protein GogB; Provisional 98.22
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.15
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.06
PLN03150623 hypothetical protein; Provisional 98.04
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.03
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.0
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.94
KOG0472 565 consensus Leucine-rich repeat protein [Function un 97.85
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.78
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.75
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.61
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.54
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.53
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.35
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.28
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.26
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.24
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.12
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.03
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 96.96
KOG4237 498 consensus Extracellular matrix protein slit, conta 96.94
PLN03150623 hypothetical protein; Provisional 96.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.81
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.74
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 96.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.53
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 96.4
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 95.97
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 95.81
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.81
KOG4237498 consensus Extracellular matrix protein slit, conta 95.62
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.3
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 95.23
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 94.57
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 93.99
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.81
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.74
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.46
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 93.17
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.49
KOG1947 482 consensus Leucine rich repeat proteins, some prote 91.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.41
KOG2123 388 consensus Uncharacterized conserved protein [Funct 89.98
KOG2982 418 consensus Uncharacterized conserved protein [Funct 89.82
KOG4341483 consensus F-box protein containing LRR [General fu 89.69
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.87
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 88.53
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 88.44
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 88.37
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 86.28
KOG2123 388 consensus Uncharacterized conserved protein [Funct 83.14
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 83.09
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.13  E-value=1.9e-10  Score=101.81  Aligned_cols=111  Identities=23%  Similarity=0.342  Sum_probs=76.2

Q ss_pred             CCcceEeeecCcCCcccCcccCCCCcccEEEeeC--cccCCCCCCCCCCccEEEecCCCCchhhhhhcc-----------
Q 040713            4 AKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGG--ELPSLEEDGLPTNLHSLWIDGNKKIWKSMIERG-----------   70 (157)
Q Consensus         4 ~~L~~L~l~~c~~l~~lp~~~~~l~~L~~L~l~~--~l~~lp~~~~~~~L~~L~i~~c~~l~~~lp~~~-----------   70 (157)
                      ++|+.|++++|..+..+|..++++++|+.|++++  .+..+|....+++|+.|++++|..+. .+|...           
T Consensus       778 ~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~-~~p~~~~nL~~L~Ls~n  856 (1153)
T PLN03210        778 PSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLR-TFPDISTNISDLNLSRT  856 (1153)
T ss_pred             ccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCccc-cccccccccCEeECCCC
Confidence            5889999999888888999999999999999987  78888876666788999998887775 554310           


Q ss_pred             ------ccCCCCCccCEEEEecCCCCCcccCcccccCCCCCCCCCccEEeeeCChhHH
Q 040713           71 ------RGFHRFSSLRHLTISGCDDDMVSFPPELKYFPEKGLPSSLLQLWIWGCPLIA  122 (157)
Q Consensus        71 ------~~l~~l~~L~~L~i~~~c~~l~~lp~~l~~lp~~~l~~~L~~L~i~~c~~l~  122 (157)
                            ..+..+++|+.|++.+ |+.++.+|..+..+      ++|+.+++.+|+.+.
T Consensus       857 ~i~~iP~si~~l~~L~~L~L~~-C~~L~~l~~~~~~L------~~L~~L~l~~C~~L~  907 (1153)
T PLN03210        857 GIEEVPWWIEKFSNLSFLDMNG-CNNLQRVSLNISKL------KHLETVDFSDCGALT  907 (1153)
T ss_pred             CCccChHHHhcCCCCCEEECCC-CCCcCccCcccccc------cCCCeeecCCCcccc
Confidence                  0133445555555555 55555544433333      456666666666554



syringae 6; Provisional

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-06
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 7e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-04
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
 Score = 44.3 bits (105), Expect = 5e-06
 Identities = 15/93 (16%), Positives = 34/93 (36%), Gaps = 17/93 (18%)

Query: 3   CAKLTRLEIYDCKRLEALPKGLHNLTSLQEL-----------KIGGELPSLEEDGLPTNL 51
              LT +E+Y+C  L  LP  L  L  +Q +           ++  +  +L +  +   +
Sbjct: 248 LKDLTDVEVYNCPNLTKLPTFLKALPEMQLINVACNRGISGEQLKDDWQALADAPVGEKI 307

Query: 52  HSLWIDGNKKIWKSMIERGRGFHRFSSLRHLTI 84
             ++I  N       ++          ++ L +
Sbjct: 308 QIIYIGYNN------LKTFPVETSLQKMKKLGM 334


>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.29
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.23
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.12
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.1
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.08
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.02
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.01
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.0
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.0
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.99
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.99
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.99
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.98
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.97
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.97
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.96
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.96
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.95
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.94
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.94
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.94
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.92
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.92
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.91
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.9
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.86
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.86
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.85
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.85
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 98.85
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.84
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.84
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.83
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.82
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.82
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.82
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.81
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.81
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.8
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.8
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.79
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.79
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.79
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.79
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.79
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.79
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.78
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.78
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.78
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.77
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.77
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.75
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 98.75
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.74
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.73
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.73
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.73
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.73
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.73
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.72
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.7
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.7
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 98.69
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.69
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.69
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.69
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.69
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.66
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.65
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.65
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.64
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.63
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.63
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.63
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.62
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.61
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.6
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.58
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.58
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.58
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.58
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.57
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.56
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.56
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.52
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.5
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.48
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.47
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.45
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.44
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.43
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.4
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.36
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.33
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.28
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.99
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.94
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.91
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.75
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.68
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 97.6
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.48
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.46
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.38
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.29
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.28
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.26
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.15
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.92
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.09
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 96.06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.0
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.97
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 95.88
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.85
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 93.96
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.12
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 91.6
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.45
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 89.75
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 87.38
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.35  E-value=4.7e-12  Score=96.60  Aligned_cols=107  Identities=21%  Similarity=0.345  Sum_probs=63.8

Q ss_pred             CCcceEeeecCcCCcccCcccCCCCcccEEEeeC-cccCCCCC-CCCCCccEEEecCCCCchhhhhhccccCCCCCccCE
Q 040713            4 AKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGG-ELPSLEED-GLPTNLHSLWIDGNKKIWKSMIERGRGFHRFSSLRH   81 (157)
Q Consensus         4 ~~L~~L~l~~c~~l~~lp~~~~~l~~L~~L~l~~-~l~~lp~~-~~~~~L~~L~i~~c~~l~~~lp~~~~~l~~l~~L~~   81 (157)
                      ++|++|++++| .++.+|.++..+++|++|++++ .+..+|.. +..++|+.|++++|.... .+|.   .+..+++|++
T Consensus       183 ~~L~~L~L~~n-~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~-~~p~---~~~~l~~L~~  257 (328)
T 4fcg_A          183 VNLQSLRLEWT-GIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALR-NYPP---IFGGRAPLKR  257 (328)
T ss_dssp             TTCCEEEEEEE-CCCCCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCC-BCCC---CTTCCCCCCE
T ss_pred             CCCCEEECcCC-CcCcchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchh-hhHH---HhcCCCCCCE
Confidence            45555555553 4445555556666666666666 55555442 123466667776665554 5555   3666667777


Q ss_pred             EEEecCCCCCcccCcccccCCCCCCCCCccEEeeeCChhHH
Q 040713           82 LTISGCDDDMVSFPPELKYFPEKGLPSSLLQLWIWGCPLIA  122 (157)
Q Consensus        82 L~i~~~c~~l~~lp~~l~~lp~~~l~~~L~~L~i~~c~~l~  122 (157)
                      |++++ |+..+.+|..+..+      ++|+.|++++|+.+.
T Consensus       258 L~L~~-n~~~~~~p~~~~~l------~~L~~L~L~~n~~~~  291 (328)
T 4fcg_A          258 LILKD-CSNLLTLPLDIHRL------TQLEKLDLRGCVNLS  291 (328)
T ss_dssp             EECTT-CTTCCBCCTTGGGC------TTCCEEECTTCTTCC
T ss_pred             EECCC-CCchhhcchhhhcC------CCCCEEeCCCCCchh
Confidence            77776 66666666555555      577777777776543



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.06
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.01
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.0
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.9
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.81
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.77
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.75
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.63
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.54
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.52
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.41
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.4
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 98.4
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.38
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.35
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.33
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.3
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.28
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.22
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.12
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.83
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.6
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.42
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.74
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 93.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 89.02
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 86.83
d2ca6a1 344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 82.38
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.06  E-value=1.5e-10  Score=78.34  Aligned_cols=103  Identities=18%  Similarity=0.270  Sum_probs=80.3

Q ss_pred             CCcceEeeecCcCCcccCcccCCCCcccEEEeeC-cccCCCCCCCCCCccEEEecCCCCchhhhhhccccCCCCCccCEE
Q 040713            4 AKLTRLEIYDCKRLEALPKGLHNLTSLQELKIGG-ELPSLEEDGLPTNLHSLWIDGNKKIWKSMIERGRGFHRFSSLRHL   82 (157)
Q Consensus         4 ~~L~~L~l~~c~~l~~lp~~~~~l~~L~~L~l~~-~l~~lp~~~~~~~L~~L~i~~c~~l~~~lp~~~~~l~~l~~L~~L   82 (157)
                      ..+++|+++++ +++.++.....+++|+.|++++ .+..++.-...++|+.|++++| .+. .++..  .+..+++|++|
T Consensus        18 ~~lr~L~L~~n-~I~~i~~~~~~l~~L~~L~Ls~N~i~~l~~~~~l~~L~~L~ls~N-~i~-~l~~~--~~~~l~~L~~L   92 (162)
T d1a9na_          18 VRDRELDLRGY-KIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNN-RIC-RIGEG--LDQALPDLTEL   92 (162)
T ss_dssp             TSCEEEECTTS-CCCSCCCGGGGTTCCSEEECCSSCCCEECCCCCCSSCCEEECCSS-CCC-EECSC--HHHHCTTCCEE
T ss_pred             CcCcEEECCCC-CCCccCccccccccCCEEECCCCCCCccCCcccCcchhhhhcccc-ccc-CCCcc--ccccccccccc
Confidence            47899999995 7888887667899999999999 8888765444579999999986 566 66653  34568999999


Q ss_pred             EEecCCCCCcccCc--ccccCCCCCCCCCccEEeeeCCh
Q 040713           83 TISGCDDDMVSFPP--ELKYFPEKGLPSSLLQLWIWGCP  119 (157)
Q Consensus        83 ~i~~~c~~l~~lp~--~l~~lp~~~l~~~L~~L~i~~c~  119 (157)
                      ++++  +.+..++.  .++.+      ++|++|++.+|+
T Consensus        93 ~L~~--N~i~~~~~l~~l~~l------~~L~~L~l~~N~  123 (162)
T d1a9na_          93 ILTN--NSLVELGDLDPLASL------KSLTYLCILRNP  123 (162)
T ss_dssp             ECCS--CCCCCGGGGGGGGGC------TTCCEEECCSSG
T ss_pred             eecc--ccccccccccccccc------cccchhhcCCCc
Confidence            9998  55665542  33444      789999999987



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure