Citrus Sinensis ID: 040774

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030-----
RDRHVLESIGSKTIGIDVLSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIAIVTLAKALRNKSIVSAWKEALRQLKKPSHWNFEGVLAKTYSAIELSYKYLREEELKQLFLQCSLMGSPQASMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDVAISIASRDYHVFTMRNEGDPRQWPDKKCSRISLYDNNISEIPQGWECPQLEFFYNFAPNNSPLQIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEELYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGILPSGFFSRKLERYRIVVGDTWDRFDKYKTRRTLKLKLNSRICLGEWRGMKNVEYLCLDELPGLTNVLHDLDGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQSLINLERICHGQLRAESFCNLKTIKVGSCHKLKNLFSFSIAKFLPNLKELKTTSTVEVEHNEIILENENHLYTPLSLFNEKLVLPKLEVLELRDINVAKIWHNQLSAAISCSVQNLTRLILEDCRKLKYVFSYSIAKRLGQLQHLEICRCPHLEEVVGKESGVEADPSFVFPRLTILKLHYLPELRAFYPGVHTLECPMLTKLEVYICDKLESFTSELYSLHENNEEGQLIDVPVPAPRPLFLVEKVLPSLEELRLSKNRDIAKIWQGPFPDYLSNKLKVLAIENDESEVLPPDLLERFHNLVNLELAYGSYKELFSNEGQVETHVGKLAQIRYLTLEHLNDLKHLWLWEQNSKLNTVFQNLETLSAHFCLNLTNLMPSSASFRCLKELRVCACEHLMNLVASSAAKNLVQLVRMTVRECNKITELVVASEGDAANDEIIFPKLMFLKLHRLQSLTTFCSANYTFKFPSLFYLSVRNCPKMKIFCGGVLSAPRLERVLLNGRICWDGDLNTTIQLSHYKT
ccHHHHHHccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccHHHHHHHccccccccHHHHHHHHHHccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEEccHHHHHHHHHHcccccEEEEEEcccccccccccEEEEEEEcccccccccccccccccEEcccccccccccccHHHHccccccEEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccEEcccccccHHccccccccccccHHHccccccccEEEEEEcccccccccccccccccccEEEccEEccccccccccEEEEEcccccccccccccccccEEEEccccccccccccccccccccccEEEEEEccccEEEcccccccccccccccEEEEEccccccEEccccccccccccccEEEEEcccccccccccccccccccccEEEEcccccccccccHHHccccccccccccccccccccccEEEEcccccccccccccccccccccccccEEEEcccccccccccccHHcccccccEEEEEcccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccccHHHHccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccEEEEEEEccccccccHHHHcccccccEEEEEccccEEEEcccccccccccccccccEEEEccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccEEEccccccccccccccccccEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcEEEEcccHHHHHHHHHccc
ccHHHHHHHcccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccHHEEEcHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcHHHcccccccEEEHHHHHHHHHHHHHccccEEEEEEccccccccccccEEEEEEEcccccccccccccccccEEEEcccccccccccHHHHHcccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccEEEEEcccccHHccHHHHccccccEEEEcccccccccccHHHHcccccEEEEEEccccccccccccccccccHHHHHHccHHHcHcccccccccccccHccHHHHHHcEccccccHccccccccccEEEEEcccccccccccccccccEEEEEccccccccccccccccccccEEEEEEccccccEccccccccccccccccEEEEcccccccEcccccccccccccccEEEEcccHHHcccccccHHccccccEEEEEccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEEcccccHHcccccccccccccccEEEEcccHHHHHHccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEccccccccccccccccccccccccEEEEccccccccccccccccccEEEEcccccHHccccccccccccccccEEEEccccccccccHHHHHcccccEEEEEcccEEEcccccccccccccccccccEEEEcccHcHHHcccccccccccccccccEEEEEcccccHccccccccccccccEEEEcccccHcccccccccHHHHHccEEEEcccccHHHHcccccccccccccccccccEEEEcccHcHHHccccccccccccccEEEEcccccccccccccccccccEEEEEcccccccccccHHEEEccccc
RDRHVLEsigsktigidvlSDEEAWTLFKKMAgdcaengelkSIATDVAKECGRLPIAIVTLAKALRNKSIVSAWKEALRQlkkpshwnfegVLAKTYSAIELSYKYLREEELKQLFLQCslmgspqaSMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDVAISIASRDYHvftmrnegdprqwpdkkcsrislydnniseipqgwecpqleffynfapnnsplqipdnifigmpklkvldFTRMrllslpssihLLTDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTqlklldlsncsklkviapnvlsnlSQLEELYMANCSIEWEVLGLSIERSNASLVElknlsrlttLEINIldagilpsgffsrklERYRIVVGDtwdrfdkyktRRTLKLKLNSriclgewrgmknveylcldelpgltnvlhdldgegfaELKHlnvqnnsnflcivdplqvrcgafpMLESVVLQSLINLERIchgqlraesfcnlktikvgschklknlfsfsiakflpnlkelkttstvevehneiilenenhlytplslfneklvlpklevlelRDINVAKIWHNQLSAAISCSVQNLTRLILEDCRKLKYVFSYSIAKRLGqlqhleicrcphleevvgkesgveadpsfvfprltilklhylpelrafypgvhtlecpmltkLEVYICDKLESFTSELYSLhenneegqlidvpvpaprplfLVEKVLPSLEELRLSKNRDiakiwqgpfpdylSNKLKVLAiendesevlppdLLERFHNLVNLELAYGSYKElfsnegqvetHVGKLAQIRYLTLEHLNDLKHLWLWEQNSKLNTVFQNLETLSAHFCLnltnlmpssasfrCLKELRVCACEHLMNLVASSAAKNLVQLVRMTVRECNKITELVvasegdaandeiifpKLMFLKLHRLQSLTTfcsanytfkfpslfylsvrncpkmkifcggvlsapRLERVLLngricwdgdlnttiqlshykt
rdrhvlesigsktigidvlsdEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIAIVTLAKALRNKSIVSAWKEALRqlkkpshwnfegVLAKTYSAIELSYKYLREEELKQLFLQCSLMGSPQASMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDVAISIASRDYHVFTmrnegdprqwpdkkCSRISLYDNNISEIPQGWECPQLEFFYNFAPNNSPLQIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEELYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINildagilpsgffsrkleryrivvgdtwdrfdkyktrrtlklklnsriclgewrgMKNVEYLCLDELPGLTNVLHDLDGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQSLINLERICHGQLRAESFCNLKTIKVGSCHKLKNLFSFSIAKFLPNLKELKTTSTVEVEHNEIILENENHLYTPLSLFNEKLVLPKLEVLELRDINVAKIWHNQLSAAISCSVQNLTRLILEDCRKLKYVFSYSIAKRLGQLQHLEICRCPHLEEVVGKESGVEADPSFVFPRLTILKLHYLPELRAFYPGVHTLECPMLTKLEVYICDKLESFTSELYSLHENNEEGQLIDVPVPAPRPLFLVEKVLPSLEELRLSKNRDIAKIWQGPFPDYLSNKLKVLAIENDESEVLPPDLLERFHNLVNLELAYGSYKELFSNEGQVETHVGKLAQIRYLTLEHLNDLKHLWLWEQNSKLNTVFQNLETLSAHFCLNLTNLMPSSASFRCLKELRVCACEHLMNLVASSAAKNLVQLVRMTVRECNKITElvvasegdaanDEIIFPKLMFLKLHRLQSLTTFCSANYTFKFPSLFYLSVRNCPKMKIFCGGVLSAPRLERVLLNgricwdgdlnttiqlshykt
RDRHVLESIGSKTIGIDVLSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIAIVTLAKALRNKSIVSAWKEALRQLKKPSHWNFEGVLAKTYSAIELSYKYLREEELKQLFLQCSLMGSPQASMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDVAISIASRDYHVFTMRNEGDPRQWPDKKCSRISLYDNNISEIPQGWECPQLEFFYNFAPNNSPLQIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEELYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGILPSGFFSRKLERYRIVVGDTWDRFDKYktrrtlklklNSRICLGEWRGMKNVEYLCLDELPGLTNVLHDLDGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQSLINLERICHGQLRAESFCNLKTIKVGSCHKLKNLFSFSIAKFLPNLKELKTTSTvevehneiilenenhlYTPLSLFNeklvlpklevlelRDINVAKIWHNQLSAAISCSVQNLTRLILEDCRKLKYVFSYSIAKRLGQLQHLEICRCPHLEEVVGKESGVEADPSFVFPRLTILKLHYLPELRAFYPGVHTLECPMLTKLEVYICDKLESFTSELYSLHENNEEGQLIDVPVPAPRPLFLVEKVLPSLEELRLSKNRDIAKIWQGPFPDYLSNKLKVLAIENDESEVLPPDLLERFHNLVNLELAYGSYKELFSNEGQVETHVGKLAQIRYLTLEHLNDLKHLWLWEQNSKLNTVFQNLETLSAHFCLNLTNLMPSSASFRCLKELRVCACEHLMNLVASSAAKNLVQLVRMTVRECNKITELVVASEGDAANDEIIFPKLMFLKLHRLQSLTTFCSANYTFKFPSLFYLSVRNCPKMKIFCGGVLSAPRLERVLLNGRICWDGDLNTTIQLSHYKT
********IGSKTIGIDVLSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIAIVTLAKALRNKSIVSAWKEALRQLKKPSHWNFEGVLAKTYSAIELSYKYLREEELKQLFLQCSLMGSPQASMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDVAISIASRDYHVFTMRNEGDPRQWPDKKCSRISLYDNNISEIPQGWECPQLEFFYNFAPNNSPLQIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEELYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGILPSGFFSRKLERYRIVVGDTWDRFDKYKTRRTLKLKLNSRICLGEWRGMKNVEYLCLDELPGLTNVLHDLDGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQSLINLERICHGQLRAESFCNLKTIKVGSCHKLKNLFSFSIAKFLPNLKELKTTSTVEVEHNEIILENENHLYTPLSLFNEKLVLPKLEVLELRDINVAKIWHNQLSAAISCSVQNLTRLILEDCRKLKYVFSYSIAKRLGQLQHLEICRCPHLEEVVGKESGVEADPSFVFPRLTILKLHYLPELRAFYPGVHTLECPMLTKLEVYICDKLESFTSELYSLHENNEEGQLIDVPVPAPRPLFLVEKVLPSLEELRLSKNRDIAKIWQGPFPDYLSNKLKVLAIENDESEVLPPDLLERFHNLVNLELAYGSYKELFSNEGQVETHVGKLAQIRYLTLEHLNDLKHLWLWEQNSKLNTVFQNLETLSAHFCLNLTNLMPSSASFRCLKELRVCACEHLMNLVASSAAKNLVQLVRMTVRECNKITELVVASEGDAANDEIIFPKLMFLKLHRLQSLTTFCSANYTFKFPSLFYLSVRNCPKMKIFCGGVLSAPRLERVLLNGRICWDGDLNTTIQL*****
RDRHVLESIGSKTIGIDVLSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIAIVTLAKALRNKSIVSAWKEALRQLKKPS**N**G*LAKTYSAIELSYKYLREEELKQLFLQCSLMGSPQASMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDVAISIASRDYHVFTMRNEGDPRQWPDKKCSRISLYDNNISEIPQGWECPQLEFFYNFAPNNSPLQIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEELYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGILPSGFFSRKLERYRIVVGDTWDRFDKYKTRRTLKLKLNSRICLGEWRGMKNVEYLCLDELPGLTNVLHDLDGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQSLINLERICHGQLRAESFCNLKTIKVGSCHKLKNLFSFSIAKFLPNLKELKTTSTVEVEHNEIILENENHLYTPLSLFNEKLVLPKLEVLELRDINVAKIWHNQL***ISCSVQNLTRLILEDCRKLKYVFSYSIAKRLGQLQHLEICRCPHLEEVVGKESGVEADPSFVFPRLTILKLHYLPELRAFYPGVHTLECPMLTKLEVYICDKLESFTSELYSLHENNEEGQLIDVPVPAPRPLFLVEKVLPSLEELRLSKNRDIAKIWQGPFPDYLSNKLKVLAIENDESEVLPPDLLERFHNLVNLELAYGSYKELFSNEGQVETHVGKLAQIRYLTLEHLNDLKHLWLWEQNSKLNTVFQNLETLSAHFCLNLTNLMPSSASFRCLKELRVCACEHLMNLVASSAAKNLVQLVRMTVRECNKITE*************IIFPKLMFLKLHRLQSLTTFCSANYTFKFPSLFYLSVRNCPKMKIFCGGVLSAPRLERVLLNGRICWDGDLNTTIQLSHY**
RDRHVLESIGSKTIGIDVLSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIAIVTLAKALRNKSIVSAWKEALRQLKKPSHWNFEGVLAKTYSAIELSYKYLREEELKQLFLQCSLMGSPQASMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDVAISIASRDYHVFTMRNEGDPRQWPDKKCSRISLYDNNISEIPQGWECPQLEFFYNFAPNNSPLQIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEELYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGILPSGFFSRKLERYRIVVGDTWDRFDKYKTRRTLKLKLNSRICLGEWRGMKNVEYLCLDELPGLTNVLHDLDGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQSLINLERICHGQLRAESFCNLKTIKVGSCHKLKNLFSFSIAKFLPNLKELKTTSTVEVEHNEIILENENHLYTPLSLFNEKLVLPKLEVLELRDINVAKIWHNQLSAAISCSVQNLTRLILEDCRKLKYVFSYSIAKRLGQLQHLEICRCPHLEEVVGKESGVEADPSFVFPRLTILKLHYLPELRAFYPGVHTLECPMLTKLEVYICDKLESFTSELYSLHENNEEGQLIDVPVPAPRPLFLVEKVLPSLEELRLSKNRDIAKIWQGPFPDYLSNKLKVLAIENDESEVLPPDLLERFHNLVNLELAYGSYKELFSNEGQVETHVGKLAQIRYLTLEHLNDLKHLWLWEQNSKLNTVFQNLETLSAHFCLNLTNLMPSSASFRCLKELRVCACEHLMNLVASSAAKNLVQLVRMTVRECNKITELVVASEGDAANDEIIFPKLMFLKLHRLQSLTTFCSANYTFKFPSLFYLSVRNCPKMKIFCGGVLSAPRLERVLLNGRICWDGDLNTTIQLSHYKT
*****LESIGSKTIGIDVLSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIAIVTLAKALRNKSIVSAWKEALRQLKKPSHWNFEGVLAKTYSAIELSYKYLREEELKQLFLQCSLMGSPQASMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDVAISIASRDYHVFTMRNEGDPRQWPDKKCSRISLYDNNISEIPQGWECPQLEFFYNFAPNNSPLQIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEELYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGILPSGFFSRKLERYRIVVGDTWDRFDKYKTRRTLKLKLNSRICLGEWRGMKNVEYLCLDELPGLTNVLHDLDGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQSLINLERICHGQLRAESFCNLKTIKVGSCHKLKNLFSFSIAKFLPNLKELKTTSTVEVEHNEIILENENHLYTPLSLFNEKLVLPKLEVLELRDINVAKIWHNQLSAAISCSVQNLTRLILEDCRKLKYVFSYSIAKRLGQLQHLEICRCPHLEEVVGKESGVEADPSFVFPRLTILKLHYLPELRAFYPGVHTLECPMLTKLEVYICDKLESFTSELYSLHENNEEGQLIDVPVPAPRPLFLVEKVLPSLEELRLSKNRDIAKIWQGPFPDYLSNKLKVLAIENDESEVLPPDLLERFHNLVNLELAYGSYKELFSNEGQVETHVGKLAQIRYLTLEHLNDLKHLWLWEQNSKLNTVFQNLETLSAHFCLNLTNLMPSSASFRCLKELRVCACEHLMNLVASSAAKNLVQLVRMTVRECNKITELVVASEGDAANDEIIFPKLMFLKLHRLQSLTTFCSANYTFKFPSLFYLSVRNCPKMKIFCGGVLSAPRLERVLLNGRICWDGDLNTTIQLSH***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RDRHVLESIGSKTIGIDVLSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIAIVTLAKALRNKSIVSAWKEALRQLKKPSHWNFEGVLAKTYSAIELSYKYLREEELKQLFLQCSLMGSPQASMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDVAISIASRDYHVFTMRNEGDPRQWPDKKCSRISLYDNNISEIPQGWECPQLEFFYNFAPNNSPLQIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEELYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGILPSGFFSRKLERYRIVVGDTWDRFDKYKTRRTLKLKLNSRICLGEWRGMKNVEYLCLDELPGLTNVLHDLDGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQSLINLERICHGQLRAESFCNLKTIKVGSCHKLKNLFSFSIAKFLPNLKELKTTSTVEVEHNEIILENENHLYTPLSLFNEKLVLPKLEVLELRDINVAKIWHNQLSAAISCSVQNLTRLILEDCRKLKYVFSYSIAKRLGQLQHLEICRCPHLEEVVGKESGVEADPSFVFPRLTILKLHYLPELRAFYPGVHTLECPMLTKLEVYICDKLESFTSELYSLHENNEEGQLIDVPVPAPRPLFLVEKVLPSLEELRLSKNRDIAKIWQGPFPDYLSNKLKVLAIENDESEVLPPDLLERFHNLVNLELAYGSYKELFSNEGQVETHVGKLAQIRYLTLEHLNDLKHLWLWEQNSKLNTVFQNLETLSAHFCLNLTNLMPSSASFRCLKELRVCACEHLMNLVASSAAKNLVQLVRMTVRECNKITELVVASEGDAANDEIIFPKLMFLKLHRLQSLTTFCSANYTFKFPSLFYLSVRNCPKMKIFCGGVLSAPRLERVLLNGRICWDGDLNTTIQLSHYKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1035 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.549 0.619 0.302 4e-50
Q9T048985 Disease resistance protei no no 0.558 0.586 0.289 2e-48
Q42484909 Disease resistance protei no no 0.515 0.587 0.258 2e-35
Q9LVT4843 Probable disease resistan no no 0.310 0.380 0.289 9e-27
Q940K0889 Probable disease resistan no no 0.309 0.359 0.273 6e-22
O64789925 Probable disease resistan no no 0.303 0.339 0.291 1e-20
Q9FG91848 Probable disease resistan no no 0.341 0.416 0.277 3e-20
Q9C8T9898 Putative disease resistan no no 0.357 0.412 0.263 3e-20
Q8RXS5888 Probable disease resistan no no 0.295 0.344 0.309 3e-20
P60839884 Probable disease resistan no no 0.258 0.303 0.301 5e-20
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  201 bits (510), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 190/629 (30%), Positives = 299/629 (47%), Gaps = 60/629 (9%)

Query: 11  SKTIGIDVLSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIAIVTLAKALRNKS 70
           ++ I +  L ++EAW LF    G+ A +  +K IA DV+ EC  LP+AI+T+ + LR K 
Sbjct: 264 NENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKP 323

Query: 71  IVSAWKEALRQLKK--PSHWNFEGVLAKTYSAIELSYKYLREEELKQLFLQCSLMGSPQA 128
            V  WK  L  LK+  PS    E    K +  ++LSY +L ++ +K  FL C+L     +
Sbjct: 324 QVEVWKHTLNLLKRSAPSIDTEE----KIFGTLKLSYDFL-QDNMKSCFLFCALFPEDYS 378

Query: 129 -SMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDV 187
             + +L+ Y +  G+L G    E+  ++   LV++LKD+CLL DG +     MHDVV D 
Sbjct: 379 IKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDF 438

Query: 188 AI---SIASRDYHVFTMRNEGDPRQWPDKKCS---RISLYDNNISEIPQGWECPQLEFFY 241
           AI   S     +H   M   G      DK  S   R+SL  N +  +P       +E   
Sbjct: 439 AIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNN-VIEGVETLV 497

Query: 242 NFAPNNSPL-QIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSC-QLEDI 299
                NS + ++P+      P L++LD + +R+ +LP S   L  LR+L L +C +L ++
Sbjct: 498 LLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNL 557

Query: 300 RVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEEL 359
             +  L KL+ L L  SAI +LP  +  L+ L+ + +SN  +L+ I    +  LS LE L
Sbjct: 558 PSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVL 617

Query: 360 YMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGILPSGF--FSRKLERYR 417
            MA  +  W + G   E   A+L E+  L  L  L I +LD       F   +++L +++
Sbjct: 618 DMAGSAYSWGIKGEERE-GQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQ 676

Query: 418 IVVGDTWDRFDKYKTRRTLKLKLNSRICLG-----------EWRGMKNVEYLCLDELPGL 466
            +          +   R++        CL             W  +++V  L L+   GL
Sbjct: 677 FL----------FSPIRSVSPPGTGEGCLAISDVNVSNASIGWL-LQHVTSLDLNYCEGL 725

Query: 467 TNVLHDL---DGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQSLINLERI 523
             +  +L       F  +K L++    + L +    + +   FP LE + L + +NLE I
Sbjct: 726 NGMFENLVTKSKSSFVAMKALSIHYFPS-LSLASGCESQLDLFPNLEELSLDN-VNLESI 783

Query: 524 CHGQLR---AESFCNLKTIKVGSCHKLKNLFSFSI-AKFLPNLKELKTTSTVEVEHNEII 579
             G+L          LK ++V  C +LK LFS  I A  LPNL+E+K  S + +E     
Sbjct: 784 --GELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLE----- 836

Query: 580 LENENHLYTPLSLFNEKLVLPKLEVLELR 608
            E  N    P+    E L LPKL V++L+
Sbjct: 837 -ELFNFSSVPVDFCAESL-LPKLTVIKLK 863
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1035
359488108 1436 PREDICTED: disease resistance protein At 0.979 0.706 0.398 0.0
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.928 0.717 0.414 1e-176
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.914 0.708 0.391 1e-168
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.916 0.708 0.387 1e-164
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.898 0.378 0.369 1e-159
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.916 0.721 0.373 1e-158
255563252 1603 Disease resistance protein RPS5, putativ 0.879 0.567 0.382 1e-155
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.685 0.619 0.432 1e-152
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.912 0.557 0.371 1e-152
359488095 1347 PREDICTED: probable disease resistance p 0.904 0.694 0.357 1e-147
>gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/1129 (39%), Positives = 632/1129 (55%), Gaps = 115/1129 (10%)

Query: 1    RDRHVL--ESIGSKTIGIDVLSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIA 58
            R+ H+L  E    K   +  L ++E W LFK  AG   EN EL+ IA DVAKEC  LP+A
Sbjct: 290  RNEHILSNEMDTQKDFRVQPLQEDETWILFKNTAGSI-ENPELQPIAVDVAKECAGLPLA 348

Query: 59   IVTLAKALRNKSIVSAWKEALRQLKKPSHWNFEGVLAKTYSAIELSYKYLREEELKQLFL 118
            IVT+AKAL+NK+ VS WK+AL+QLK  +  N  G+    YS+++LSY++L+  E+K  FL
Sbjct: 349  IVTVAKALKNKN-VSIWKDALQQLKSQTLTNVTGLTTNVYSSLKLSYEHLKGVEVKSFFL 407

Query: 119  QCSLMGSPQASMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWF 178
             C L+     S++DLLKY +GL + +G +T+EEA+++++ALVD LK +  LL+  ++ + 
Sbjct: 408  LCGLISQNDISIRDLLKYGVGLRLFQGTNTLEEAKNRIDALVDNLKSSNFLLETGHNAFV 467

Query: 179  SMHDVVSDVAISIASRDYHVFTMRN-----EGDPRQWPDKKCSRISLYDNNISEIPQGWE 233
             MHD+V   A  IAS  +HVFT++N     EG PR    +K + +SL+D +I E+P+G  
Sbjct: 468  RMHDLVRSTARKIASDQHHVFTLQNTTVRVEGWPRIDELQKVTWVSLHDCDIRELPEGLA 527

Query: 234  CPQLEFFYNFAPN-NSPLQIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLD 292
            CP+LE F  +  N NS +QIP+N F  M +LKVLD +RM+L SLP S H  T+LRTLCLD
Sbjct: 528  CPKLELFGCYDVNTNSAVQIPNNFFEEMKQLKVLDLSRMQLPSLPLSCHCRTNLRTLCLD 587

Query: 293  SCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSN 352
             C L +I +I EL+KLEILSL  S IE+LP EI QLT L+L DL    KLKVI P+V+S+
Sbjct: 588  GCNLGEIVIIAELKKLEILSLTYSDIEKLPREIAQLTHLRLFDLKGSYKLKVIPPDVISS 647

Query: 353  LSQLEELYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGILPSGFFSRK 412
            LSQLE+L M N   +WE  G    +SNA L ELK+LS LT+L+I I DA +LP       
Sbjct: 648  LSQLEDLCMENSFTQWEGEG----KSNACLAELKHLSHLTSLDIQIPDAKLLPKDIVFDT 703

Query: 413  LERYRIVVGDTWDRFDKYKTRRTLKL-KLNSRICL--GEWRGMKNVEYLCLDELPGLTNV 469
            L RYRI VGD W      +  +TL+L K ++ + L  G  + +K  E L L EL G TNV
Sbjct: 704  LVRYRIFVGDVWSWGGISEANKTLQLNKFDTSLHLVDGIIKLLKRTEDLHLRELCGGTNV 763

Query: 470  LHDLDGEGFAELKHLNVQNNSNFLCIVDPLQVRC--GAFPMLESVVLQSLINLERICHGQ 527
            L  LDGEGF +LKHLNV+++     IV+ + +    GAFP++E++ L  LINL+ +C GQ
Sbjct: 764  LSKLDGEGFLKLKHLNVESSPEIQYIVNSMDLTPSHGAFPVMETLSLNQLINLQEVCRGQ 823

Query: 528  LRAESFCNLKTIKVGSCHKLKNLFSFSIAKFLPNLKELKTT---STVEVEHNEIILENEN 584
              A SF  L+ ++V  C  LK LFS S+A+ L  L+E K T   S VE+         E+
Sbjct: 824  FPAGSFGCLRKVEVEDCDGLKFLFSLSVARGLSRLEETKVTRCKSMVEMVSQGRKEIKED 883

Query: 585  HLYTPL-----SL------------FNEKLVL------------PKLEVLELRD------ 609
             +  PL     SL            F E  VL            P L   E+RD      
Sbjct: 884  AVNVPLFPELRSLTLEDLPKLSNFCFEENPVLSKPASTIVGPSTPPLNQPEIRDGQLLFS 943

Query: 610  -------INVAKIWHNQLSAAISCSVQNLTRLILEDCRKLKYVFS----------YSIAK 652
                   +N+ K   + L       +QNL  L +E+C KL+ VF             +  
Sbjct: 944  LGGNLRSLNLKKCM-SLLKLFPPSLLQNLQELTVENCDKLEQVFDLEELNVDDGHVGLLP 1002

Query: 653  RLGQLQHLE------ICRCPHLEEVVGKESGVEADPSFVFPRLTILKLHYLPELRAFY-P 705
            +LG+L+ ++      IC C                 + +FP+L  + L +LP L +F  P
Sbjct: 1003 KLGKLRLIDLPKLRHICNCGSSRNHFPSSMASAPVGNIIFPKLFYISLGFLPNLTSFVSP 1062

Query: 706  GVHTLE------------------CPMLTKLEVYICDKLESFTSELYSLHENNEEGQLID 747
            G H+L+                   P+L +L V  C KL+ F  E  +  + + EG L D
Sbjct: 1063 GYHSLQRLHHADLDTPFPVLFDERWPLLEELRVSECYKLDVFAFETPTFQQRHGEGNL-D 1121

Query: 748  VPVPAPRPLFLVEKVLPSLEELRLSKNRDIAKIWQGPFPDYLSNKLKVLAIEN--DESEV 805
            +P+      FL     P+LEELRL  NRD  +IW   FP     +L+VL + +  D   V
Sbjct: 1122 MPL-----FFLPHVAFPNLEELRLGDNRD-TEIWPEQFPVDSFPRLRVLHVHDYRDILVV 1175

Query: 806  LPPDLLERFHNLVNLELAY-GSYKELFSNEG-QVETHVGKLAQIRYLTLEHLNDLKHLWL 863
            +P  +L+R HNL  L++    S KE+F  EG   E    +L ++R + L  L  L    L
Sbjct: 1176 IPSFMLQRLHNLEVLKVGSCSSVKEVFQLEGLDEENQAKRLGRLREIELHDLPGLTR--L 1233

Query: 864  WEQNSKLNTVFQNLETLSAHFCLNLTNLMPSSASFRCLKELRVCACEHLMNLVASSAAKN 923
            W++NS+     Q+LE+L    C +L NL+PSS SF+ L  L V +C  L +L++ S AK+
Sbjct: 1234 WKENSEPGLDLQSLESLEVWNCGSLINLVPSSVSFQNLATLDVQSCGSLRSLISPSVAKS 1293

Query: 924  LVQLVRMTVRECNKITELVVASEGDAANDEIIFPKLMFLKLHRLQSLTTFCSANYTFKFP 983
            LV+L  + +   + + E VVA+EG  A DEI F KL  ++L  L +LT+F S  Y F FP
Sbjct: 1294 LVKLKTLKIGRSDMMEE-VVANEGGEATDEITFYKLQHMELLYLPNLTSFSSGGYIFSFP 1352

Query: 984  SLFYLSVRNCPKMKIFCGGVLSAPRLERVLL-NGRICWDGDLNTTIQLS 1031
            SL  + V+ CPKMK+F   +++ PRL+R+ + +    W  DLNT I  S
Sbjct: 1353 SLEQMLVKECPKMKMFSPSLVTPPRLKRIKVGDEEWPWQDDLNTAIHNS 1401

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488095|ref|XP_002270726.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1035
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.526 0.593 0.309 1.5e-60
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.494 0.519 0.296 1.4e-50
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.302 0.344 0.289 4.8e-35
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.344 0.423 0.293 3e-32
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.347 0.407 0.289 7.4e-27
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.505 0.581 0.272 2e-25
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.486 0.563 0.274 1.2e-24
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.502 0.682 0.267 7.9e-24
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.492 0.599 0.254 2e-23
TAIR|locus:2170892848 AT5G43730 [Arabidopsis thalian 0.517 0.632 0.252 2.7e-23
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 555 (200.4 bits), Expect = 1.5e-60, Sum P(2) = 1.5e-60
 Identities = 180/582 (30%), Positives = 282/582 (48%)

Query:    11 SKTIGIDVLSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIAIVTLAKALRNKS 70
             ++ I +  L ++EAW LF    G+ A +  +K IA DV+ EC  LP+AI+T+ + LR K 
Sbjct:   264 NENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKP 323

Query:    71 IVSAWKEALRQLKK--PSHWNFEGVLAKTYSAIELSYKYLREEELKQLFLQCSLMGSPQA 128
              V  WK  L  LK+  PS    E    K +  ++LSY +L ++ +K  FL C+L     +
Sbjct:   324 QVEVWKHTLNLLKRSAPSIDTEE----KIFGTLKLSYDFL-QDNMKSCFLFCALFPEDYS 378

Query:   129 -SMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGINSYWFSMHDVVSDV 187
               + +L+ Y +  G+L G    E+  ++   LV++LKD+CLL DG +     MHDVV D 
Sbjct:   379 IKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDF 438

Query:   188 AI---SIASRDYHVFTMRNEGDPRQWP-DKKCS---RISLYDNNISEIPQGWECPQLEFF 240
             AI   S     +H   M   G   ++P DK  S   R+SL  N +  +P       +E  
Sbjct:   439 AIWFMSSQGEGFHSLVMAGRG-LIEFPQDKFVSSVQRVSLMANKLERLPNN-VIEGVETL 496

Query:   241 YNFAPNNSPL-QIPDNIFIGMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSCQ-LED 298
                   NS + ++P+      P L++LD + +R+ +LP S   L  LR+L L +C+ L +
Sbjct:   497 VLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRN 556

Query:   299 IRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEE 358
             +  +  L KL+ L L  SAI +LP  +  L+ L+ + +SN  +L+ I    +  LS LE 
Sbjct:   557 LPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEV 616

Query:   359 LYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGILPSGFFS--RKLERY 416
             L MA  +  W + G   E   A+L E+  L  L  L I +LD       F S  ++L ++
Sbjct:   617 LDMAGSAYSWGIKGEERE-GQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKF 675

Query:   417 RIVVGDTWDRFDKYXXXX-XXXXXXN-SRICLGEWRGMKNVEYLCLDELPGLTNVLHDL- 473
             + +                      N S   +G W  +++V  L L+   GL  +  +L 
Sbjct:   676 QFLFSPIRSVSPPGTGEGCLAISDVNVSNASIG-WL-LQHVTSLDLNYCEGLNGMFENLV 733

Query:   474 --DGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQSLINLERICHGQLRA- 530
                   F  +K L++    + L +    + +   FP LE + L + +NLE I  G+L   
Sbjct:   734 TKSKSSFVAMKALSIHYFPS-LSLASGCESQLDLFPNLEELSLDN-VNLESI--GELNGF 789

Query:   531 --ESFCNLKTIKVGSCHKLKNLFSFSI-AKFLPNLKELKTTS 569
                    LK ++V  C +LK LFS  I A  LPNL+E+K  S
Sbjct:   790 LGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVS 831
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.08360002
cc-nbs-lrr resistance protein (1338 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1035
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 5e-15
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score = 76.2 bits (188), Expect = 5e-15
 Identities = 38/126 (30%), Positives = 56/126 (44%), Gaps = 7/126 (5%)

Query: 1   RDRHVLESIG--SKTIGIDVLSDEEAWTLFKKMAG--DCAENGELKSIATDVAKECGRLP 56
           R   V   +G  SK   ++ L  EE+W LF       +     EL+ +A ++ ++C  LP
Sbjct: 136 RSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLP 195

Query: 57  IAIVTLAKALRNKSIVSAWKEALRQLKKPSHWNFEGVLAKTYSAIELSYKYLREEELKQL 116
           +A+  L   L  KS V  W+  L QL           L +  S + LSY  L    LK+ 
Sbjct: 196 LALKVLGGLLAFKSTVQEWEHVLEQLNN--ELAGRDGLNEVLSILSLSYDNLP-MHLKRC 252

Query: 117 FLQCSL 122
           FL  +L
Sbjct: 253 FLYLAL 258

Length = 285
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1035
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.9
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.82
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.82
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG4237498 consensus Extracellular matrix protein slit, conta 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.48
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.45
KOG4237498 consensus Extracellular matrix protein slit, conta 99.42
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.36
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.34
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.31
KOG4341483 consensus F-box protein containing LRR [General fu 99.3
KOG4341483 consensus F-box protein containing LRR [General fu 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.97
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.88
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.84
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.67
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.63
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.6
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.55
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.45
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.32
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.32
PLN03150623 hypothetical protein; Provisional 98.24
PLN03150623 hypothetical protein; Provisional 98.21
PRK15386 426 type III secretion protein GogB; Provisional 98.18
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.07
PRK15386 426 type III secretion protein GogB; Provisional 98.06
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.99
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.98
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.94
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.91
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.87
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.76
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.74
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.73
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.64
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.63
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.62
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.55
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.38
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.27
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.07
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.84
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.79
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.82
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.55
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.43
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.32
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.31
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.18
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.11
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.1
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.9
PRK04841903 transcriptional regulator MalT; Provisional 92.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.39
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.79
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.86
smart0037026 LRR Leucine-rich repeats, outliers. 87.86
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.15
smart0037026 LRR Leucine-rich repeats, outliers. 83.15
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 81.27
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=3.5e-58  Score=544.21  Aligned_cols=361  Identities=32%  Similarity=0.505  Sum_probs=289.9

Q ss_pred             CCHHHHhh-cCC-eeEeCCCCCHHHHHHHHHHhhCCC--CCChhhHHHHHHHHHHhCCchhHHHHHHHHHhcCCChhHHH
Q 040774            1 RDRHVLES-IGS-KTIGIDVLSDEEAWTLFKKMAGDC--AENGELKSIATDVAKECGRLPIAIVTLAKALRNKSIVSAWK   76 (1035)
Q Consensus         1 R~~~v~~~-~~~-~~~~l~~L~~~~~~~Lf~~~a~~~--~~~~~l~~~~~~i~~~c~glPla~~~~g~~L~~~~~~~~W~   76 (1035)
                      |+++||.. |++ ..++++.|+++|||+||++.||+.  ...+.++++|++||+||+|+|||++++|+.|+.|+++++|+
T Consensus       297 Rs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~  376 (889)
T KOG4658|consen  297 RSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWR  376 (889)
T ss_pred             ccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHH
Confidence            89999998 898 999999999999999999999743  34456999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCCCCCccchhhhhhHHHHHhhhccChhhhhHHHhcccccC-CCcccHHHHHHHHHHcCcccCCCcHHHHHHH
Q 040774           77 EALRQLKKPSHWNFEGVLAKTYSAIELSYKYLREEELKQLFLQCSLMG-SPQASMQDLLKYAIGLGILKGVSTVEEARDK  155 (1035)
Q Consensus        77 ~~l~~l~~~~~~~~~~~~~~i~~~L~lSY~~Lp~~~lk~cFly~s~Fp-~~~~~~~~Li~~w~a~g~~~~~~~~~~~~~~  155 (1035)
                      ++.+.+.+...-++.++++.|+++|++|||+||.+ +|.||+|||+|| ||.|++++||.+|+||||+.+....+.+++.
T Consensus       377 ~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~  455 (889)
T KOG4658|consen  377 RALNVLKSSLAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDV  455 (889)
T ss_pred             HHHccccccccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcc
Confidence            99998877634345667788999999999999965 999999999999 9999999999999999999876666778899


Q ss_pred             HHHHHHHHHHhccccccc---CcceeehhhhHHHHHHHHHc-----ccceEEEecCCCCCCCCCC----CCccEEEecCC
Q 040774          156 VNALVDQLKDACLLLDGI---NSYWFSMHDVVSDVAISIAS-----RDYHVFTMRNEGDPRQWPD----KKCSRISLYDN  223 (1035)
Q Consensus       156 ~~~~~~~L~~~sl~~~~~---~~~~~~mHdl~~dla~~v~~-----~e~~~~~~~~~~~~~~~~~----~~~~~l~l~~~  223 (1035)
                      |.+|+.+|+++++++..+   +..+|+|||+|||||.++|+     +|+.++  .++......+.    ..+|++++.+|
T Consensus       456 G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv--~~~~~~~~~~~~~~~~~~rr~s~~~~  533 (889)
T KOG4658|consen  456 GYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIV--SDGVGLSEIPQVKSWNSVRRMSLMNN  533 (889)
T ss_pred             hHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEE--ECCcCccccccccchhheeEEEEecc
Confidence            999999999999999875   44689999999999999999     666443  32211222221    68899999999


Q ss_pred             CCCCCCCCCCCCCcceeeccCCCC-CCCCCChhhhcCCCCccEEEccCC-cCccCcccccCCCCCcEEEcCCCCCCCccc
Q 040774          224 NISEIPQGWECPQLEFFYNFAPNN-SPLQIPDNIFIGMPKLKVLDFTRM-RLLSLPSSIHLLTDLRTLCLDSCQLEDIRV  301 (1035)
Q Consensus       224 ~~~~l~~~~~~~~Lr~L~l~~~~~-~~~~i~~~~f~~~~~Lr~L~Ls~~-~i~~lp~~i~~L~~Lr~L~L~~~~l~~l~~  301 (1035)
                      .+..++....+++|++|.+.+ +. ....++..+|..++.||||||++| .+.++|++|++|.|||||+++++.      
T Consensus       534 ~~~~~~~~~~~~~L~tLll~~-n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~------  606 (889)
T KOG4658|consen  534 KIEHIAGSSENPKLRTLLLQR-NSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTG------  606 (889)
T ss_pred             chhhccCCCCCCccceEEEee-cchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCC------
Confidence            999999999999999999998 33 378899999999999999999976 466889988888877777666655      


Q ss_pred             ccCCCCCcEEecccCcCCcchHhhccCCcCCEEcccCCccccccChhhhcCCCCCcEEEccCCccceeeccccccccccC
Q 040774          302 IGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEELYMANCSIEWEVLGLSIERSNAS  381 (1035)
Q Consensus       302 i~~L~~L~~L~L~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~  381 (1035)
                                      ++.+|.++++|.+|++|++..+..+..+ ++.+..|.+||+|.+......         .....
T Consensus       607 ----------------I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~-~~i~~~L~~Lr~L~l~~s~~~---------~~~~~  660 (889)
T KOG4658|consen  607 ----------------ISHLPSGLGNLKKLIYLNLEVTGRLESI-PGILLELQSLRVLRLPRSALS---------NDKLL  660 (889)
T ss_pred             ----------------ccccchHHHHHHhhheeccccccccccc-cchhhhcccccEEEeeccccc---------cchhh
Confidence                            5566666666666666666666544444 333555777777766554321         11344


Q ss_pred             HHhhcCCCCCCEEEEe
Q 040774          382 LVELKNLSRLTTLEIN  397 (1035)
Q Consensus       382 ~~~l~~L~~L~~L~l~  397 (1035)
                      +.++.++++|+.+.+.
T Consensus       661 l~el~~Le~L~~ls~~  676 (889)
T KOG4658|consen  661 LKELENLEHLENLSIT  676 (889)
T ss_pred             HHhhhcccchhhheee
Confidence            5556666666655553

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1035
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 1e-05
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 1e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 1e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 2e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-05
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-05
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-05
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 5e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 1e-04
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 1e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 1e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 2e-04
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 69/154 (44%), Gaps = 14/154 (9%)
Query: 284 TDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLK 343
           T L  L LD C+L  ++V G L  L  L L  + ++ LP+    L  L +LD+S  ++L 
Sbjct: 56  TRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVS-FNRLT 114
Query: 344 VIAPNVLSNLSQLEELYMANCSIEWEVLGL--------SIERSNASLVE-----LKNLSR 390
            +    L  L +L+ELY+    ++    GL         +  +N +L E     L  L  
Sbjct: 115 SLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLEN 174
Query: 391 LTTLEINILDAGILPSGFFSRKLERYRIVVGDTW 424
           L TL +       +P GFF   L  +  + G+ W
Sbjct: 175 LDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPW 208
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1035
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 8e-25
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 4e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  109 bits (273), Expect = 8e-25
 Identities = 27/203 (13%), Positives = 62/203 (30%), Gaps = 12/203 (5%)

Query: 1   RDRHVLESIGSKTIGIDV--LSDEEAWTLFKKMAGDCAENGELKSIATDVAKECGRLPIA 58
           RD  +  +       I+V  L  +E +   +          + + +     +     P  
Sbjct: 273 RDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPAT 332

Query: 59  IVTLAKALRNKSIVSAWKEALRQLKKPSHWNFEGVLAKTYS----AIELSYKYLREEELK 114
           ++   K+   K+      +   +L+       E +   +Y     A++   + L  +E +
Sbjct: 333 LMMFFKSCEPKT-FEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVL-SDEDR 390

Query: 115 QLFLQCSLMGSPQASMQDLLKYAIGLGILKGVSTVEEARDKVNALVDQLKDACLLLDGIN 174
                  +M         L    I + I    +  E+  D+V   + +L     LL G  
Sbjct: 391 SALAFAVVMPPGVDIPVKLWSCVIPVDICS--NEEEQLDDEVADRLKRLSKRGALLSGKR 448

Query: 175 S--YWFSMHDVVSDVAISIASRD 195
                F +  ++      +    
Sbjct: 449 MPVLTFKIDHIIHMFLKHVVDAQ 471
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1035
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.79
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 99.77
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.77
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.76
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.76
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.76
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.76
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.7
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.7
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.68
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.67
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.66
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.66
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.66
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.65
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.64
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.62
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.61
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.59
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.57
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.56
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.55
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.54
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.53
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.52
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.51
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.5
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.48
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.48
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.48
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.47
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.45
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.44
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.42
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.39
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.38
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.36
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.36
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.25
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.21
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.17
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.0
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.0
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.9
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.78
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.76
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.67
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.65
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.59
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.54
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.3
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.2
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.84
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.81
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.78
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.76
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.72
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.83
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.81
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.16
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 94.68
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.64
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.56
2fna_A357 Conserved hypothetical protein; structural genomic 93.96
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 91.84
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 91.4
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 83.92
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.3e-39  Score=398.66  Aligned_cols=638  Identities=16%  Similarity=0.079  Sum_probs=399.5

Q ss_pred             CCccEEEecCCCCCC----CCCCC-CCCCcceeeccCCCCCCCCCChhhhcCCCCccEEEccCCcCc-cCcc--cccCCC
Q 040774          213 KKCSRISLYDNNISE----IPQGW-ECPQLEFFYNFAPNNSPLQIPDNIFIGMPKLKVLDFTRMRLL-SLPS--SIHLLT  284 (1035)
Q Consensus       213 ~~~~~l~l~~~~~~~----l~~~~-~~~~Lr~L~l~~~~~~~~~i~~~~f~~~~~Lr~L~Ls~~~i~-~lp~--~i~~L~  284 (1035)
                      .+++.++++++.+..    ++..+ .+++|+.+++..  +....+|.. |.++++|++|||++|.+. .+|.  .+++++
T Consensus        50 ~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~--~~~~~l~~~-~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~  126 (768)
T 3rgz_A           50 DKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSN--SHINGSVSG-FKCSASLTSLDLSRNSLSGPVTTLTSLGSCS  126 (768)
T ss_dssp             TEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTT--SCEEECCCC-CCCCTTCCEEECCSSEEEEEGGGGGGGGGCT
T ss_pred             CcEEEEECCCCCcCCccCccChhHhccCcccccCCcC--CCcCCCchh-hccCCCCCEEECCCCcCCCcCCChHHHhCCC
Confidence            578888888877653    44333 667777777765  333334444 578888999999888887 4676  888888


Q ss_pred             CCcEEEcCCCCCCCc--c-cccCCCCCcEEecccCcCCcc-hHh---hccCCcCCEEcccCCccccccChhhhcCCCCCc
Q 040774          285 DLRTLCLDSCQLEDI--R-VIGELRKLEILSLQASAIEQL-PME---IGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLE  357 (1035)
Q Consensus       285 ~Lr~L~L~~~~l~~l--~-~i~~L~~L~~L~L~~~~l~~l-p~~---i~~L~~L~~L~l~~~~~l~~lp~~~l~~L~~L~  357 (1035)
                      +|++|++++|.+...  . .++++++|++|++++|.++.. |..   ++++++|++|++++|. +....+  ++++++|+
T Consensus       127 ~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~-l~~~~~--~~~l~~L~  203 (768)
T 3rgz_A          127 GLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNK-ISGDVD--VSRCVNLE  203 (768)
T ss_dssp             TCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSE-EESCCB--CTTCTTCC
T ss_pred             CCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCc-ccccCC--cccCCcCC
Confidence            899999988887643  3 337888899999988888744 444   6788888899888887 554443  47888888


Q ss_pred             EEEccCCccceeeccccccccccCHHhhcCCCCCCEEEEeecCCCC-CCCccccccccEEEEEEccccccCCcccccchh
Q 040774          358 ELYMANCSIEWEVLGLSIERSNASLVELKNLSRLTTLEINILDAGI-LPSGFFSRKLERYRIVVGDTWDRFDKYKTRRTL  436 (1035)
Q Consensus       358 ~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~L~l~~~~~~~-~~~~~~~~~L~~l~~~~~~~~~~~~~~~~~~~l  436 (1035)
                      +|++++|.+.           . .+..++++++|++|++++|.... +|..                             
T Consensus       204 ~L~Ls~n~l~-----------~-~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-----------------------------  242 (768)
T 3rgz_A          204 FLDVSSNNFS-----------T-GIPFLGDCSALQHLDISGNKLSGDFSRA-----------------------------  242 (768)
T ss_dssp             EEECCSSCCC-----------S-CCCBCTTCCSCCEEECCSSCCCSCHHHH-----------------------------
T ss_pred             EEECcCCcCC-----------C-CCcccccCCCCCEEECcCCcCCCcccHH-----------------------------
Confidence            8888888876           2 22337888888888888877432 2211                             


Q ss_pred             hhccCCceeeccccCccccceeecccccCccccccccCccccCCccEEEeecCCccceeccCCccccCcCcccceeeccc
Q 040774          437 KLKLNSRICLGEWRGMKNVEYLCLDELPGLTNVLHDLDGEGFAELKHLNVQNNSNFLCIVDPLQVRCGAFPMLESVVLQS  516 (1035)
Q Consensus       437 ~l~~~~~i~~~~~~~l~~L~~L~L~~~~~~~~~l~~l~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~  516 (1035)
                                  +.++++|++|+++++... ...+..   .+++|++|++++|.-...++   ......+++|++|++.+
T Consensus       243 ------------l~~l~~L~~L~Ls~n~l~-~~~~~~---~l~~L~~L~L~~n~l~~~ip---~~~~~~~~~L~~L~Ls~  303 (768)
T 3rgz_A          243 ------------ISTCTELKLLNISSNQFV-GPIPPL---PLKSLQYLSLAENKFTGEIP---DFLSGACDTLTGLDLSG  303 (768)
T ss_dssp             ------------TTTCSSCCEEECCSSCCE-ESCCCC---CCTTCCEEECCSSEEEESCC---CCSCTTCTTCSEEECCS
T ss_pred             ------------HhcCCCCCEEECCCCccc-CccCcc---ccCCCCEEECcCCccCCccC---HHHHhhcCcCCEEECcC
Confidence                        445567777777776432 223322   47788888888776211111   11223347888888877


Q ss_pred             ccccccccccccccCCCCCcceEEEeecCCCcccCChhhhhcCCCCceEEecccCcccchhhhhccccccccCccccccc
Q 040774          517 LINLERICHGQLRAESFCNLKTIKVGSCHKLKNLFSFSIAKFLPNLKELKTTSTVEVEHNEIILENENHLYTPLSLFNEK  596 (1035)
Q Consensus       517 ~~~l~~~~~~~~~~~~l~~L~~L~l~~c~~L~~l~~~~~~~~l~~L~~L~l~~c~~l~~~~~~l~~l~~~~~~~~~~~~~  596 (1035)
                      +.--..+   +...+.+++|++|++.+|.-...++ ...+..+++|++|++++|.....   +...+.            
T Consensus       304 n~l~~~~---p~~~~~l~~L~~L~L~~n~l~~~ip-~~~l~~l~~L~~L~Ls~n~l~~~---~p~~l~------------  364 (768)
T 3rgz_A          304 NHFYGAV---PPFFGSCSLLESLALSSNNFSGELP-MDTLLKMRGLKVLDLSFNEFSGE---LPESLT------------  364 (768)
T ss_dssp             SEEEECC---CGGGGGCTTCCEEECCSSEEEEECC-HHHHTTCTTCCEEECCSSEEEEC---CCTTHH------------
T ss_pred             CcCCCcc---chHHhcCCCccEEECCCCcccCcCC-HHHHhcCCCCCEEeCcCCccCcc---ccHHHH------------
Confidence            6422222   1224567788888888764322333 22356788888888888764211   111111            


Q ss_pred             cccC-CcceeeccccccccccccCccccccccCCcccEEEEccCCCcccccChhHHhhcCCCcEEEEecccccccccccc
Q 040774          597 LVLP-KLEVLELRDINVAKIWHNQLSAAISCSVQNLTRLILEDCRKLKYVFSYSIAKRLGQLQHLEICRCPHLEEVVGKE  675 (1035)
Q Consensus       597 ~~~~-~L~~L~L~~~~l~~~~~~~~~~~~p~~~~~L~~L~l~~c~~l~~l~~~~~~~~l~~L~~L~i~~c~~l~~l~~~~  675 (1035)
                       .++ +|+.|++++|.+.........   ...+++|+.|++.+| .++...|.. +..+++|+.|++++|.....++   
T Consensus       365 -~l~~~L~~L~Ls~N~l~~~~~~~~~---~~~~~~L~~L~L~~n-~l~~~~p~~-l~~l~~L~~L~Ls~N~l~~~~p---  435 (768)
T 3rgz_A          365 -NLSASLLTLDLSSNNFSGPILPNLC---QNPKNTLQELYLQNN-GFTGKIPPT-LSNCSELVSLHLSFNYLSGTIP---  435 (768)
T ss_dssp             -HHTTTCSEEECCSSEEEEECCTTTT---CSTTCCCCEEECCSS-EEEEECCGG-GGGCTTCCEEECCSSEEESCCC---
T ss_pred             -hhhcCCcEEEccCCCcCCCcChhhh---hcccCCccEEECCCC-ccccccCHH-HhcCCCCCEEECcCCcccCccc---
Confidence             134 788888888866532221111   012567888888888 455444433 4778888888888875322222   


Q ss_pred             ccccCCCceeccccCeeecccCCcccccccCCcccCCCCcceeeeecCCcccccccccccccccccCCccccCCCCCCCC
Q 040774          676 SGVEADPSFVFPRLTILKLHYLPELRAFYPGVHTLECPMLTKLEVYICDKLESFTSELYSLHENNEEGQLIDVPVPAPRP  755 (1035)
Q Consensus       676 ~~~~~~~~~~~~~L~~L~L~~~~~L~~~~~~~~~~~~~~L~~L~i~~c~~l~~lp~~~~~~~~~~~~~~~~~l~~~~~~~  755 (1035)
                           .....+++|+.|+++++.-...++...  ..+++|++|++++|.....+|...                      
T Consensus       436 -----~~l~~l~~L~~L~L~~n~l~~~~p~~~--~~l~~L~~L~L~~N~l~~~~p~~l----------------------  486 (768)
T 3rgz_A          436 -----SSLGSLSKLRDLKLWLNMLEGEIPQEL--MYVKTLETLILDFNDLTGEIPSGL----------------------  486 (768)
T ss_dssp             -----GGGGGCTTCCEEECCSSCCCSCCCGGG--GGCTTCCEEECCSSCCCSCCCGGG----------------------
T ss_pred             -----HHHhcCCCCCEEECCCCcccCcCCHHH--cCCCCceEEEecCCcccCcCCHHH----------------------
Confidence                 234456788888888865433444322  236788888888876443332211                      


Q ss_pred             ccccccccCCceeEecccccCccccccCCCCcccCCCccEEEeecCCCcCCCchHHhhcCCceEEEEEeCccceecccCC
Q 040774          756 LFLVEKVLPSLEELRLSKNRDIAKIWQGPFPDYLSNKLKVLAIENDESEVLPPDLLERFHNLVNLELAYGSYKELFSNEG  835 (1035)
Q Consensus       756 ~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~i~c~~l~~l~~~~~  835 (1035)
                           ..+++|+.|++++|. ++...+..+  ..+++|+.|++++|.+....+..+..+++|+.|+++.|.+....    
T Consensus       487 -----~~l~~L~~L~L~~N~-l~~~~p~~~--~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~i----  554 (768)
T 3rgz_A          487 -----SNCTNLNWISLSNNR-LTGEIPKWI--GRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTI----  554 (768)
T ss_dssp             -----GGCTTCCEEECCSSC-CCSCCCGGG--GGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBC----
T ss_pred             -----hcCCCCCEEEccCCc-cCCcCChHH--hcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcC----
Confidence                 347788888888666 332222222  45778888888666555333345577888888888866665221    


Q ss_pred             cccccccccccccccccc-----------------------------------ccccCce-----eeeccCCCccccccc
Q 040774          836 QVETHVGKLAQIRYLTLE-----------------------------------HLNDLKH-----LWLWEQNSKLNTVFQ  875 (1035)
Q Consensus       836 ~~~~~~~~l~~L~~L~l~-----------------------------------~c~~L~~-----L~i~~~~~~~~~~l~  875 (1035)
                        |..+.....+..+.+.                                   .++.+..     -.+.+..+..+..++
T Consensus       555 --p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~  632 (768)
T 3rgz_A          555 --PAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNG  632 (768)
T ss_dssp             --CGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSB
T ss_pred             --ChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccc
Confidence              1111111111111111                                   1111110     012223355567788


Q ss_pred             ccceEEeecccCccccCCCcccccCccEEEeccCCCCcchhhhhhhhcccccceEeeccccccceeeccccccCCCCccc
Q 040774          876 NLETLSAHFCLNLTNLMPSSASFRCLKELRVCACEHLMNLVASSAAKNLVQLVRMTVRECNKITELVVASEGDAANDEII  955 (1035)
Q Consensus       876 ~L~~L~i~~C~~l~~l~~~~~~~~~L~~L~i~~c~~L~~l~~~~~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~~~~~~~  955 (1035)
                      +|+.|+++++.--..+|..++.+++|+.|+++++. ++..+ +..++++++|+.|+++++ +++...|..       ...
T Consensus       633 ~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~-l~g~i-p~~l~~L~~L~~LdLs~N-~l~g~ip~~-------l~~  702 (768)
T 3rgz_A          633 SMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHND-ISGSI-PDEVGDLRGLNILDLSSN-KLDGRIPQA-------MSA  702 (768)
T ss_dssp             CCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSC-CCSCC-CGGGGGCTTCCEEECCSS-CCEECCCGG-------GGG
T ss_pred             cccEEECcCCcccccCCHHHhccccCCEEeCcCCc-cCCCC-ChHHhCCCCCCEEECCCC-cccCcCChH-------HhC
Confidence            89999999887766888888899999999996654 55333 345588899999999994 466553443       456


Q ss_pred             cccccccccccccccceeccCCceeeCCccCEEEEecCCCccccc
Q 040774          956 FPKLMFLKLHRLQSLTTFCSANYTFKFPSLFYLSVRNCPKMKIFC 1000 (1035)
Q Consensus       956 l~sL~~L~l~~c~~L~~l~~~~~~~~~~~L~~L~i~~C~~l~~~p 1000 (1035)
                      +++|+.|++++++--..+|.+..   +..+....+.|||.+.-.|
T Consensus       703 l~~L~~L~ls~N~l~g~iP~~~~---~~~~~~~~~~gN~~Lcg~~  744 (768)
T 3rgz_A          703 LTMLTEIDLSNNNLSGPIPEMGQ---FETFPPAKFLNNPGLCGYP  744 (768)
T ss_dssp             CCCCSEEECCSSEEEEECCSSSS---GGGSCGGGGCSCTEEESTT
T ss_pred             CCCCCEEECcCCcccccCCCchh---hccCCHHHhcCCchhcCCC
Confidence            88999999999877667776543   5555556677888876544
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1035
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 61.6 bits (148), Expect = 2e-10
 Identities = 30/181 (16%), Positives = 59/181 (32%), Gaps = 29/181 (16%)

Query: 204 EGDPRQWPDKKCSRISLYDNNISEIPQGWECPQLEFFYNFAPNNSPLQIPDNIFIGMPKL 263
                         +SL  N + +I        L        NN    +      G+ KL
Sbjct: 210 SDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLA--NNQISNLAP--LSGLTKL 265

Query: 264 KVLDFTRMRLLSLPSSIHL---------------------LTDLRTLCLDSCQLEDIRVI 302
             L     ++ ++     L                     L +L  L L    + DI  +
Sbjct: 266 TELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPV 325

Query: 303 GELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSNCSKLKVIAPNVLSNLSQLEELYMA 362
             L KL+ L    + +  +   +  LT +  L   +  ++  + P  L+NL+++ +L + 
Sbjct: 326 SSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHN-QISDLTP--LANLTRITQLGLN 381

Query: 363 N 363
           +
Sbjct: 382 D 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1035
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.71
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.7
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.69
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.66
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.61
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.53
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.53
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.33
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.33
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.3
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.29
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.05
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.89
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.87
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.86
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.78
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.47
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.68
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.65
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.53
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.16
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.27
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.77  E-value=2.9e-17  Score=182.73  Aligned_cols=102  Identities=25%  Similarity=0.406  Sum_probs=64.0

Q ss_pred             CCCCccEEEccCCcCccCcccccCCCCCcEEEcCCCCCCCcccccCCCCCcEEecccCcCCcchHhhccCCcCCEEcccC
Q 040774          259 GMPKLKVLDFTRMRLLSLPSSIHLLTDLRTLCLDSCQLEDIRVIGELRKLEILSLQASAIEQLPMEIGQLTQLKLLDLSN  338 (1035)
Q Consensus       259 ~~~~Lr~L~Ls~~~i~~lp~~i~~L~~Lr~L~L~~~~l~~l~~i~~L~~L~~L~L~~~~l~~lp~~i~~L~~L~~L~l~~  338 (1035)
                      .+.+|++|+++++.|+.+ +.+..+++|++|++++|+++.++.++++++|++|++++|.+..++. ++.+++|+.|++++
T Consensus        42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~~~  119 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP-LANLTNLTGLTLFN  119 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCS
T ss_pred             HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCccccCCcccccccccccccccccc-cccccccccccccc
Confidence            345677777777777666 3566677777777777777766667777777777777776666553 66667777777666


Q ss_pred             CccccccChhhhcCCCCCcEEEccCCc
Q 040774          339 CSKLKVIAPNVLSNLSQLEELYMANCS  365 (1035)
Q Consensus       339 ~~~l~~lp~~~l~~L~~L~~L~l~~~~  365 (1035)
                      +. ...++.  ......+..+....+.
T Consensus       120 ~~-~~~~~~--~~~~~~~~~~~~~~~~  143 (384)
T d2omza2         120 NQ-ITDIDP--LKNLTNLNRLELSSNT  143 (384)
T ss_dssp             SC-CCCCGG--GTTCTTCSEEEEEEEE
T ss_pred             cc-cccccc--cccccccccccccccc
Confidence            55 444443  3344455555544443
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure