Citrus Sinensis ID: 040965


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLERAIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLGALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAGIRKIPAYSLIEA
cHHHHHHcccHHHHHHHHccccccccEEHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHccccccccEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHcccccccccHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccc
cccEEEccccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEc
midgyvkngdmDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMgnvnlvrpneATYVSVLSSCAglvnegglylgkqvhgyILRNEIVLSVFMGTALIDLYGKVGCLERAIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFmrsmpfepdaSVLGALLGACKIHGAVDLCHEVGRRLLelqpkhcgryVVLSNIHAGLERWNRATDLRKAMVEAGIRkipaysliea
midgyvkngdmDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLERAIRVFKSMVIKDVCTWNAMISslasnsreKEALVMFDEMKEKGLRANEITFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLGALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAgirkipaysliea
MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLERAIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLGALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAGIRKIPAYSLIEA
*********DMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLERAIRVFKSMVIKDVCTWNAMISSLA*******ALVMFDEMKEKGLRANEITFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLGALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAGIRKIPAYSL***
MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLERAIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLGALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAGIRKIPAYSLIEA
MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLERAIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLGALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAGIRKIPAYSLIEA
MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLERAIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLGALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAGIRKIPAYSLIEA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLERAIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLGALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAGIRKIPAYSLIEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query311 2.2.26 [Sep-21-2011]
Q9SY75467 Putative pentatricopeptid yes no 0.990 0.659 0.545 2e-94
Q9FJY7 620 Pentatricopeptide repeat- no no 0.977 0.490 0.433 1e-70
Q9SX45596 Pentatricopeptide repeat- no no 0.980 0.511 0.425 2e-68
Q9FIF7544 Putative pentatricopeptid no no 0.977 0.558 0.434 4e-67
Q9LSB8687 Putative pentatricopeptid no no 0.980 0.443 0.396 2e-66
Q9SY02 781 Pentatricopeptide repeat- no no 0.980 0.390 0.406 2e-65
Q9FG16 622 Pentatricopeptide repeat- no no 0.980 0.490 0.396 2e-64
Q9FI80 646 Pentatricopeptide repeat- no no 0.980 0.472 0.412 4e-64
Q9FNN7511 Pentatricopeptide repeat- no no 0.974 0.592 0.399 8e-64
A8MQA3 595 Pentatricopeptide repeat- no no 0.967 0.505 0.397 9e-64
>sp|Q9SY75|PPR30_ARATH Putative pentatricopeptide repeat-containing protein At1g10330 OS=Arabidopsis thaliana GN=PCMP-E71 PE=3 SV=1 Back     alignment and function desciption
 Score =  346 bits (887), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 169/310 (54%), Positives = 233/310 (75%), Gaps = 2/310 (0%)

Query: 1   MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVN-LV 59
           ++D   +NG+MD A   F+ M   DVVSWT++INGF + G   +A+ VF  M+ N   ++
Sbjct: 158 LLDACGRNGEMDYAFEYFQRMPVTDVVSWTTVINGFSKKGLHAKALMVFGEMIQNERAVI 217

Query: 60  RPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLER 119
            PNEAT+VSVLSSCA   ++GG+ LGKQ+HGY++  EI+L+  +GTAL+D+YGK G LE 
Sbjct: 218 TPNEATFVSVLSSCANF-DQGGIRLGKQIHGYVMSKEIILTTTLGTALLDMYGKAGDLEM 276

Query: 120 AIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTACAR 179
           A+ +F  +  K VC WNA+IS+LASN R K+AL MF+ MK   +  N IT +A+LTACAR
Sbjct: 277 ALTIFDQIRDKKVCAWNAIISALASNGRPKQALEMFEMMKSSYVHPNGITLLAILTACAR 336

Query: 180 AQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLG 239
           ++LV+LG++LF S+  +++++P  EHYGCVVDL+GRAGLL +A  F++S+PFEPDASVLG
Sbjct: 337 SKLVDLGIQLFSSICSEYKIIPTSEHYGCVVDLIGRAGLLVDAANFIQSLPFEPDASVLG 396

Query: 240 ALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAG 299
           ALLGACKIH   +L + VG++L+ LQP+HCG+YV LS  +A    W+ A  +RKAM+EAG
Sbjct: 397 ALLGACKIHENTELGNTVGKQLIGLQPQHCGQYVALSTFNALDSNWSEAEKMRKAMIEAG 456

Query: 300 IRKIPAYSLI 309
           IRKIPAYS++
Sbjct: 457 IRKIPAYSVL 466





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description
>sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protein At1g50270 OS=Arabidopsis thaliana GN=PCMP-E42 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIF7|PP435_ARATH Putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E41 PE=3 SV=1 Back     alignment and function description
>sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containing protein At3g15930 OS=Arabidopsis thaliana GN=PCMP-E51 PE=3 SV=2 Back     alignment and function description
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q9FNN7|PP371_ARATH Pentatricopeptide repeat-containing protein At5g08510 OS=Arabidopsis thaliana GN=PCMP-E20 PE=2 SV=1 Back     alignment and function description
>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
255567729 524 pentatricopeptide repeat-containing prot 0.993 0.589 0.693 1e-123
224115616 474 predicted protein [Populus trichocarpa] 0.993 0.651 0.683 1e-122
359485621 454 PREDICTED: LOW QUALITY PROTEIN: putative 0.996 0.682 0.678 1e-119
359485617 531 PREDICTED: putative pentatricopeptide re 1.0 0.585 0.676 1e-119
147809483 480 hypothetical protein VITISV_041924 [Viti 0.987 0.639 0.675 1e-117
449453704 477 PREDICTED: putative pentatricopeptide re 0.996 0.649 0.627 1e-108
449528931 477 PREDICTED: LOW QUALITY PROTEIN: putative 0.996 0.649 0.627 1e-108
357474431 470 hypothetical protein MTR_4g078750 [Medic 0.993 0.657 0.595 1e-105
356515150 503 PREDICTED: putative pentatricopeptide re 0.996 0.616 0.582 1e-104
297739174265 unnamed protein product [Vitis vinifera] 0.836 0.981 0.678 1e-98
>gi|255567729|ref|XP_002524843.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535903|gb|EEF37563.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  448 bits (1152), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/313 (69%), Positives = 255/313 (81%), Gaps = 4/313 (1%)

Query: 1   MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGN----V 56
           M+D Y KN DM SAILLF+ MLKRDVVSWT++I+GF R+G F EAI  F+ M+ +    +
Sbjct: 157 MLDAYAKNNDMGSAILLFKRMLKRDVVSWTTVISGFSRSGLFREAINFFRVMIAHEDVSL 216

Query: 57  NLVRPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGC 116
            LV+PNEATYVSVLSSCA L   G L+LGKQ+HG I+RNE+VL+VF+GTALID YGKVGC
Sbjct: 217 GLVKPNEATYVSVLSSCASLDEGGSLFLGKQMHGSIIRNEVVLTVFIGTALIDFYGKVGC 276

Query: 117 LERAIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTA 176
           L  AIRVF SM IK +C+WNAMIS LA+N REK+AL MF+ M+EKG   NE+TFV VLTA
Sbjct: 277 LNSAIRVFNSMTIKQICSWNAMISCLANNGREKQALDMFEMMEEKGPSPNEVTFVVVLTA 336

Query: 177 CARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDAS 236
           C RA+LV+ G+ LF SM   + V PIMEHYGCVVDLLGRAGLL EA E +RSMPFEPDAS
Sbjct: 337 CTRAKLVQFGMRLFQSMWSDYSVKPIMEHYGCVVDLLGRAGLLREASEIIRSMPFEPDAS 396

Query: 237 VLGALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMV 296
           VLGALLGACKIHGA  L +EVG RLL LQP HCG++V+LSNI+AGLE+W+ A D+RKAMV
Sbjct: 397 VLGALLGACKIHGANKLANEVGGRLLRLQPLHCGQFVLLSNINAGLEKWSVAADVRKAMV 456

Query: 297 EAGIRKIPAYSLI 309
           EAGI K+PAYSLI
Sbjct: 457 EAGISKVPAYSLI 469




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224115616|ref|XP_002332100.1| predicted protein [Populus trichocarpa] gi|222874920|gb|EEF12051.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359485621|ref|XP_003633297.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g10330-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485617|ref|XP_003633296.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g10330-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147809483|emb|CAN60147.1| hypothetical protein VITISV_041924 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449453704|ref|XP_004144596.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g10330-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449528931|ref|XP_004171455.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g10330-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357474431|ref|XP_003607500.1| hypothetical protein MTR_4g078750 [Medicago truncatula] gi|355508555|gb|AES89697.1| hypothetical protein MTR_4g078750 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356515150|ref|XP_003526264.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g10330-like [Glycine max] Back     alignment and taxonomy information
>gi|297739174|emb|CBI28825.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
TAIR|locus:2012858467 AT1G10330 "AT1G10330" [Arabido 0.990 0.659 0.545 3.1e-90
TAIR|locus:2154855 620 AT5G66520 "AT5G66520" [Arabido 0.977 0.490 0.433 3.2e-65
TAIR|locus:2011892596 AT1G50270 "AT1G50270" [Arabido 0.980 0.511 0.425 6.9e-63
TAIR|locus:2093920687 AT3G15930 "AT3G15930" [Arabido 0.980 0.443 0.396 1e-61
TAIR|locus:2144143 622 AT5G06540 [Arabidopsis thalian 0.980 0.490 0.396 4.3e-61
TAIR|locus:2140235 781 AT4G02750 [Arabidopsis thalian 0.980 0.390 0.406 1.9e-60
TAIR|locus:2154389 646 LPA66 "LOW PSII ACCUMULATION 6 0.977 0.470 0.414 2.4e-60
TAIR|locus:2159602511 AT5G08510 "AT5G08510" [Arabido 0.974 0.592 0.399 3.1e-60
TAIR|locus:2141171857 AT4G21300 [Arabidopsis thalian 0.980 0.355 0.395 1e-59
TAIR|locus:4010713895 595 AT4G21065 "AT4G21065" [Arabido 0.967 0.505 0.397 1e-59
TAIR|locus:2012858 AT1G10330 "AT1G10330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 900 (321.9 bits), Expect = 3.1e-90, P = 3.1e-90
 Identities = 169/310 (54%), Positives = 233/310 (75%)

Query:     1 MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVN-LV 59
             ++D   +NG+MD A   F+ M   DVVSWT++INGF + G   +A+ VF  M+ N   ++
Sbjct:   158 LLDACGRNGEMDYAFEYFQRMPVTDVVSWTTVINGFSKKGLHAKALMVFGEMIQNERAVI 217

Query:    60 RPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLER 119
              PNEAT+VSVLSSCA   ++GG+ LGKQ+HGY++  EI+L+  +GTAL+D+YGK G LE 
Sbjct:   218 TPNEATFVSVLSSCANF-DQGGIRLGKQIHGYVMSKEIILTTTLGTALLDMYGKAGDLEM 276

Query:   120 AIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTACAR 179
             A+ +F  +  K VC WNA+IS+LASN R K+AL MF+ MK   +  N IT +A+LTACAR
Sbjct:   277 ALTIFDQIRDKKVCAWNAIISALASNGRPKQALEMFEMMKSSYVHPNGITLLAILTACAR 336

Query:   180 AQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLG 239
             ++LV+LG++LF S+  +++++P  EHYGCVVDL+GRAGLL +A  F++S+PFEPDASVLG
Sbjct:   337 SKLVDLGIQLFSSICSEYKIIPTSEHYGCVVDLIGRAGLLVDAANFIQSLPFEPDASVLG 396

Query:   240 ALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAG 299
             ALLGACKIH   +L + VG++L+ LQP+HCG+YV LS  +A    W+ A  +RKAM+EAG
Sbjct:   397 ALLGACKIHENTELGNTVGKQLIGLQPQHCGQYVALSTFNALDSNWSEAEKMRKAMIEAG 456

Query:   300 IRKIPAYSLI 309
             IRKIPAYS++
Sbjct:   457 IRKIPAYSVL 466


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2154855 AT5G66520 "AT5G66520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011892 AT1G50270 "AT1G50270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093920 AT3G15930 "AT3G15930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144143 AT5G06540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154389 LPA66 "LOW PSII ACCUMULATION 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159602 AT5G08510 "AT5G08510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141171 AT4G21300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713895 AT4G21065 "AT4G21065" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SY75PPR30_ARATHNo assigned EC number0.54510.99030.6595yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01930032
hypothetical protein (474 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-80
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-62
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-35
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-31
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-29
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-26
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-13
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-10
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-07
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
pfam1285434 pfam12854, PPR_1, PPR repeat 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.003
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  259 bits (663), Expect = 4e-80
 Identities = 123/311 (39%), Positives = 189/311 (60%), Gaps = 9/311 (2%)

Query: 1   MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGF-VRNGCFGEAICVFKNMMGNVNLV 59
           +I+ Y K   +D A+ +F N+ ++DV+SWTSII G  + N CF EA+  F+ M+  +   
Sbjct: 430 LIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCF-EALIFFRQMLLTL--- 485

Query: 60  RPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLER 119
           +PN  T ++ LS+CA +   G L  GK++H ++LR  I    F+  AL+DLY + G +  
Sbjct: 486 KPNSVTLIAALSACARI---GALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNY 542

Query: 120 AIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTACAR 179
           A   F S   KDV +WN +++   ++ +   A+ +F+ M E G+  +E+TF+++L AC+R
Sbjct: 543 AWNQFNSHE-KDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSR 601

Query: 180 AQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLG 239
           + +V  GLE FHSM  K+ + P ++HY CVVDLLGRAG L+EA  F+  MP  PD +V G
Sbjct: 602 SGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWG 661

Query: 240 ALLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAG 299
           ALL AC+IH  V+L     + + EL P   G Y++L N++A   +W+    +RK M E G
Sbjct: 662 ALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENG 721

Query: 300 IRKIPAYSLIE 310
           +   P  S +E
Sbjct: 722 LTVDPGCSWVE 732


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 311
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PRK11788389 tetratricopeptide repeat protein; Provisional 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.92
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.88
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.86
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.86
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.85
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.84
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.84
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.82
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.81
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.78
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.78
KOG1126638 consensus DNA-binding cell division cycle control 99.78
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.78
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.77
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.75
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.74
PRK14574 822 hmsH outer membrane protein; Provisional 99.73
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.71
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.71
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.7
KOG2076 895 consensus RNA polymerase III transcription factor 99.7
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.7
PRK14574 822 hmsH outer membrane protein; Provisional 99.69
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.68
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.66
KOG0547606 consensus Translocase of outer mitochondrial membr 99.65
KOG2003 840 consensus TPR repeat-containing protein [General f 99.65
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.65
KOG1126638 consensus DNA-binding cell division cycle control 99.64
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.64
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.62
PRK12370553 invasion protein regulator; Provisional 99.58
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.56
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.56
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.53
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.53
PRK12370553 invasion protein regulator; Provisional 99.53
PRK11189296 lipoprotein NlpI; Provisional 99.5
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.5
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.49
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.49
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.49
KOG1129478 consensus TPR repeat-containing protein [General f 99.48
KOG2003 840 consensus TPR repeat-containing protein [General f 99.47
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.47
PF1304150 PPR_2: PPR repeat family 99.46
KOG1129478 consensus TPR repeat-containing protein [General f 99.46
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.45
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.45
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.44
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.43
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.42
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.42
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.41
PF1304150 PPR_2: PPR repeat family 99.41
PRK11189296 lipoprotein NlpI; Provisional 99.39
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.39
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.38
KOG2076 895 consensus RNA polymerase III transcription factor 99.36
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.34
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.33
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.32
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.3
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.29
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.28
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.28
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.27
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.24
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.22
KOG1125579 consensus TPR repeat-containing protein [General f 99.21
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.21
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.18
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.17
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.08
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.04
PRK10370198 formate-dependent nitrite reductase complex subuni 99.04
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.03
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 99.02
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.02
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.0
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.98
PRK04841 903 transcriptional regulator MalT; Provisional 98.98
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.98
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.97
KOG1125579 consensus TPR repeat-containing protein [General f 98.95
PRK15359144 type III secretion system chaperone protein SscB; 98.93
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.93
PRK15359144 type III secretion system chaperone protein SscB; 98.93
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.92
PRK10370198 formate-dependent nitrite reductase complex subuni 98.91
PLN02789320 farnesyltranstransferase 98.91
PF1285434 PPR_1: PPR repeat 98.89
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.87
PF1285434 PPR_1: PPR repeat 98.87
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.87
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.87
PRK04841 903 transcriptional regulator MalT; Provisional 98.86
PLN02789320 farnesyltranstransferase 98.85
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.85
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.84
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.78
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.78
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.77
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.75
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.74
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.73
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.73
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.72
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.72
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.72
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.71
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.7
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.7
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.7
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.67
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.65
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.63
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.63
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.61
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.55
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.53
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.53
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.51
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 98.51
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.5
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.49
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.49
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.49
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.49
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.48
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.45
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.42
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.41
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.41
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.4
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.4
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.38
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.37
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.37
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.35
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.34
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.33
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.32
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.32
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.29
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.26
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.25
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.25
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.23
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.22
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.21
KOG0553304 consensus TPR repeat-containing protein [General f 98.21
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.2
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.2
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.18
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.17
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.17
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.16
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.14
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.14
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.14
KOG0553304 consensus TPR repeat-containing protein [General f 98.1
PF1337173 TPR_9: Tetratricopeptide repeat 98.08
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.08
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.05
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.02
COG4700251 Uncharacterized protein conserved in bacteria cont 97.99
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.99
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.99
PRK10803263 tol-pal system protein YbgF; Provisional 97.98
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.98
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.96
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.95
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.95
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.94
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.93
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.92
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.92
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.89
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.88
PF12688120 TPR_5: Tetratrico peptide repeat 97.85
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.84
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.83
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.81
PF12688120 TPR_5: Tetratrico peptide repeat 97.78
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.77
PRK15331165 chaperone protein SicA; Provisional 97.76
PRK10803263 tol-pal system protein YbgF; Provisional 97.76
COG4700251 Uncharacterized protein conserved in bacteria cont 97.76
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.75
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.64
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.62
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.6
PF1343134 TPR_17: Tetratricopeptide repeat 97.53
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.52
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 97.52
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.51
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.5
PF1337173 TPR_9: Tetratricopeptide repeat 97.5
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.49
PF1342844 TPR_14: Tetratricopeptide repeat 97.49
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.49
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.47
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.46
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.45
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.45
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.44
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.43
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.4
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.38
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.37
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.35
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.32
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.29
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.22
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.14
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.13
PRK15331165 chaperone protein SicA; Provisional 97.09
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.09
PF13512142 TPR_18: Tetratricopeptide repeat 97.08
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.08
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.07
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.05
KOG1941 518 consensus Acetylcholine receptor-associated protei 97.05
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.05
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.04
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.98
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.91
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.88
PF13512142 TPR_18: Tetratricopeptide repeat 96.84
PRK11906458 transcriptional regulator; Provisional 96.72
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.71
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.68
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.63
smart00299140 CLH Clathrin heavy chain repeat homology. 96.62
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.59
KOG3941 406 consensus Intermediate in Toll signal transduction 96.55
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.53
KOG4555175 consensus TPR repeat-containing protein [Function 96.53
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.5
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.46
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.46
COG3629280 DnrI DNA-binding transcriptional activator of the 96.35
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.33
KOG1585308 consensus Protein required for fusion of vesicles 96.33
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.21
KOG4555175 consensus TPR repeat-containing protein [Function 96.18
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.18
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.11
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.09
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.09
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.03
KOG4234271 consensus TPR repeat-containing protein [General f 96.02
KOG3941406 consensus Intermediate in Toll signal transduction 96.0
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.98
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.87
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.83
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.8
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.7
PRK11619 644 lytic murein transglycosylase; Provisional 95.68
PF1342844 TPR_14: Tetratricopeptide repeat 95.67
PRK11906458 transcriptional regulator; Provisional 95.66
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.55
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.46
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.41
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.38
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.35
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.33
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.26
KOG1586288 consensus Protein required for fusion of vesicles 95.21
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.95
KOG4648 536 consensus Uncharacterized conserved protein, conta 94.76
COG3629280 DnrI DNA-binding transcriptional activator of the 94.75
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.7
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 94.7
KOG4648 536 consensus Uncharacterized conserved protein, conta 94.66
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.47
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.46
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.45
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.42
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.3
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.3
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 94.26
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.24
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 94.22
PRK09687280 putative lyase; Provisional 94.21
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.2
KOG1258577 consensus mRNA processing protein [RNA processing 94.19
PF06552186 TOM20_plant: Plant specific mitochondrial import r 94.18
PF1343134 TPR_17: Tetratricopeptide repeat 94.16
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.11
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 94.01
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 94.0
smart00299140 CLH Clathrin heavy chain repeat homology. 93.9
KOG1585308 consensus Protein required for fusion of vesicles 93.85
COG3947361 Response regulator containing CheY-like receiver a 93.81
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.69
KOG4234271 consensus TPR repeat-containing protein [General f 93.63
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.61
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.44
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.23
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.23
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.05
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 93.02
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 92.99
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 92.88
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 92.67
KOG4570 418 consensus Uncharacterized conserved protein [Funct 92.58
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 92.49
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 92.42
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.33
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.17
COG5159 421 RPN6 26S proteasome regulatory complex component [ 91.88
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 91.51
PF06552186 TOM20_plant: Plant specific mitochondrial import r 91.21
COG2976207 Uncharacterized protein conserved in bacteria [Fun 91.18
COG1747 711 Uncharacterized N-terminal domain of the transcrip 91.12
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.1
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.88
KOG4570 418 consensus Uncharacterized conserved protein [Funct 90.85
COG4455 273 ImpE Protein of avirulence locus involved in tempe 90.71
PRK10941269 hypothetical protein; Provisional 90.64
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 90.64
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.62
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 90.06
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 89.71
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.33
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 89.19
COG1747 711 Uncharacterized N-terminal domain of the transcrip 89.04
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.98
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 88.88
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.63
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.28
COG4455 273 ImpE Protein of avirulence locus involved in tempe 88.26
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 88.21
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 88.14
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 87.96
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 87.82
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 87.8
PRK12798421 chemotaxis protein; Reviewed 87.4
PF13929292 mRNA_stabil: mRNA stabilisation 87.37
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 87.29
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 87.02
KOG1586288 consensus Protein required for fusion of vesicles 86.92
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 86.83
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.71
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 86.69
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 86.61
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 86.4
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 86.3
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 85.96
KOG4507 886 consensus Uncharacterized conserved protein, conta 85.73
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 85.6
KOG1550552 consensus Extracellular protein SEL-1 and related 85.19
PF09986214 DUF2225: Uncharacterized protein conserved in bact 85.1
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.91
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 84.58
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 84.49
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 84.23
COG3947361 Response regulator containing CheY-like receiver a 84.17
KOG4507 886 consensus Uncharacterized conserved protein, conta 84.07
KOG1258 577 consensus mRNA processing protein [RNA processing 83.73
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 83.26
PF09477116 Type_III_YscG: Bacterial type II secretion system 82.99
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 82.94
PF13762145 MNE1: Mitochondrial splicing apparatus component 82.75
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 82.64
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 82.42
PRK09687280 putative lyase; Provisional 82.19
KOG2041 1189 consensus WD40 repeat protein [General function pr 82.16
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 81.61
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 81.21
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 81.12
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 81.07
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 80.23
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.2e-56  Score=396.09  Aligned_cols=306  Identities=34%  Similarity=0.603  Sum_probs=298.0

Q ss_pred             ChhhhhhcCChHHHHHHHHHhccccHHHHHHHHHHHHhcCCHhHHHHHHHHhhcCCCCCCCchHHHHHHHHHhhhhhhcC
Q 040965            1 MIDGYVKNGDMDSAILLFENMLKRDVVSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNEATYVSVLSSCAGLVNEG   80 (311)
Q Consensus         1 li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~p~~~~~~~ll~~~~~~~~~~   80 (311)
                      ||++|++.|++++|.++|+.|.++|..+||++|.+|++.|++++|+++|++|.+.|  +.||..||+.++.+|+.   .|
T Consensus       265 Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g--~~pd~~t~~~ll~a~~~---~g  339 (697)
T PLN03081        265 LIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSG--VSIDQFTFSIMIRIFSR---LA  339 (697)
T ss_pred             HHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcC--CCCCHHHHHHHHHHHHh---cc
Confidence            57899999999999999999999999999999999999999999999999999999  99999999999998876   55


Q ss_pred             cchhHHHHHHHHhhccCCchHHHHHHHHHHHhhcCCHHHHHHHHHHcccchHhhHHHHHHHHHcCCCHHHHHHHHHHHHH
Q 040965           81 GLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLERAIRVFKSMVIKDVCTWNAMISSLASNSREKEALVMFDEMKE  160 (311)
Q Consensus        81 ~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~  160 (311)
                      ++++|.+++..|.+.|++||..++++|+++|++.|++++|.++|++|.++|..+||+||.+|++.|+.++|.++|++|.+
T Consensus       340 ~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~~  419 (697)
T PLN03081        340 LLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIA  419 (697)
T ss_pred             chHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCcHHHHHHHHHHHHccccHHHHHHHHHHhhccCCCccchhhHHHHHHHHHhcCCHHHHHHHHHhCCCCCCcchHHH
Q 040965          161 KGLRANEITFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPFEPDASVLGA  240 (311)
Q Consensus       161 ~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~p~~~~~~~  240 (311)
                      .|+.||..||+.++.+|.+.|++++|.++|+.|.+.+++.|+..+|+.++++|++.|++++|.+++++|+..|+..+|++
T Consensus       420 ~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~~~  499 (697)
T PLN03081        420 EGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAA  499 (697)
T ss_pred             hCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHHHH
Confidence            99999999999999999999999999999999988779999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCChhHHHHHHHHHHhcCCCchhHHHHHHHHHhccchhHHHHHHHHHHHHccCCCCCccccccC
Q 040965          241 LLGACKIHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAGIRKIPAYSLIEA  311 (311)
Q Consensus       241 l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~~  311 (311)
                      |+.+|...|+++.|..+++++.+..|++..+|..|+..|.+.|+|++|.+++++|.+.|+.++|++||+++
T Consensus       500 Ll~a~~~~g~~~~a~~~~~~l~~~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~  570 (697)
T PLN03081        500 LLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEV  570 (697)
T ss_pred             HHHHHHHcCCcHHHHHHHHHHhCCCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCCccCCCeeEEEE
Confidence            99999999999999999999999999988899999999999999999999999999999999999999874



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF09477 Type_III_YscG: Bacterial type II secretion system chaperone protein (type_III_yscG); InterPro: IPR013348 YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion) Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 66.8 bits (161), Expect = 2e-12
 Identities = 24/184 (13%), Positives = 53/184 (28%), Gaps = 10/184 (5%)

Query: 59  VRPNEATYVSVLSSCAGLVNEGGLYLGKQVHGYILRNEIVLSVFMGTALIDLYGKVGCLE 118
             P E     +L    G ++          H    + ++        A          L 
Sbjct: 88  ESPWEEQLARLLQEAPGKLSLDVEQAPSGQH---SQAQLSGQQQRLLAFFKCCLLTDQLP 144

Query: 119 RAIRVFKSM-------VIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFV 171
            A  +            +  +  +NA++   A     KE + +   +K+ GL  + +++ 
Sbjct: 145 LAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYA 204

Query: 172 AVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSMPF 231
           A L    R       +E     + +  +         ++    RA +L    +   +   
Sbjct: 205 AALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSL 264

Query: 232 EPDA 235
            P  
Sbjct: 265 PPQL 268


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.98
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.9
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.89
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.88
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.86
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.86
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.86
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.86
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.83
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.82
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.81
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.8
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.79
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.79
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.78
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.78
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.78
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.78
3u4t_A272 TPR repeat-containing protein; structural genomics 99.76
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.75
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.75
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.75
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.74
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.74
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.74
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.74
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.74
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.74
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.74
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.73
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.73
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.73
3u4t_A272 TPR repeat-containing protein; structural genomics 99.73
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.73
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.72
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.72
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.72
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.71
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.7
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.7
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.7
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.69
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.68
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.66
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.66
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.65
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.64
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.64
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.63
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.63
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.62
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.61
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.61
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.6
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.6
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.59
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.59
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.58
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.57
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.57
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.57
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.56
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.52
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.49
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.49
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.48
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.47
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.46
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.46
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.44
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.44
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.42
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.41
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.39
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.36
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.36
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.34
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.34
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.32
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.3
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.3
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.3
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.28
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.27
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.26
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.26
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.25
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.24
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.24
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.24
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.22
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.2
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.19
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.18
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.17
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.16
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.16
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.16
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.15
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.15
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.12
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.12
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.12
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.09
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.08
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.06
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.04
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.04
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.02
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.01
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.0
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.0
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.0
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.98
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.97
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.96
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.95
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.94
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.93
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.93
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.93
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 98.92
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.89
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.89
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.88
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.88
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.88
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.87
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.87
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.86
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.86
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.86
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.85
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.85
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.85
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.84
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.84
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.82
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.81
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.8
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.79
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.78
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.78
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.78
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.78
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.74
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.74
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.71
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.7
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.7
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.7
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.7
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.69
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.69
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.69
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.67
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.67
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.65
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.64
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.64
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.63
3k9i_A117 BH0479 protein; putative protein binding protein, 98.63
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.62
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.6
3k9i_A117 BH0479 protein; putative protein binding protein, 98.59
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.57
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.56
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.55
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.53
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.49
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.47
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.4
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.39
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.36
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.33
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.3
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.24
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.24
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.19
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.19
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.14
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.12
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.12
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.12
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.09
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.03
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.98
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.95
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.94
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.9
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.89
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.82
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.79
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.68
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.64
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.39
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.38
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.3
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.23
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.22
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.11
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.06
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 97.04
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.03
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.89
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.86
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.66
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.64
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 96.62
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.55
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.55
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.53
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.53
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.51
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.89
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.82
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.76
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.69
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 95.62
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.11
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.06
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.84
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.83
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 94.62
3lpz_A 336 GET4 (YOR164C homolog); protein targeting, tail-an 94.6
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.59
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.77
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 93.7
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 93.41
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.13
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.01
2uwj_G115 Type III export protein PSCG; virulence, chaperone 92.93
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.77
2p58_C116 Putative type III secretion protein YSCG; type III 92.68
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.67
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 92.64
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 92.06
2p58_C116 Putative type III secretion protein YSCG; type III 91.33
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 90.76
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.44
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 90.29
2uwj_G115 Type III export protein PSCG; virulence, chaperone 89.8
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.4
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 88.93
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 88.72
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 88.37
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 88.07
2ion_A152 PDCD4, programmed cell death 4, PDCD4; alpha-helic 87.24
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 86.26
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 85.18
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 84.69
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 83.65
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 82.82
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 82.12
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 81.89
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 81.32
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=4.6e-33  Score=237.13  Aligned_cols=187  Identities=13%  Similarity=0.108  Sum_probs=176.2

Q ss_pred             HHHHHHHHHHHhcCCHhHHHHHHHHhhcCCCCCCCchHHHHHHHHHhhhhh------hcCcchhHHHHHHHHhhccCCch
Q 040965           27 VSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNEATYVSVLSSCAGLV------NEGGLYLGKQVHGYILRNEIVLS  100 (311)
Q Consensus        27 ~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~p~~~~~~~ll~~~~~~~------~~~~~~~a~~~~~~~~~~~~~~~  100 (311)
                      ..++.+|++|++.|++++|+++|++|.+.|  +.||..||+++|.+|+..+      +.+.++.|.++|++|.+.|+.||
T Consensus        27 ~~l~~~id~c~k~G~~~~A~~lf~~M~~~G--v~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd  104 (501)
T 4g26_A           27 ALLKQKLDMCSKKGDVLEALRLYDEARRNG--VQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVVPN  104 (501)
T ss_dssp             HHHHHHHHHTTTSCCHHHHHHHHHHHHHHT--CCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCCCC
T ss_pred             HHHHHHHHHHHhCCCHHHHHHHHHHHHHcC--CCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCCCC
Confidence            468889999999999999999999999999  9999999999999987543      23457899999999999999999


Q ss_pred             HHHHHHHHHHHhhcCCHHHHHHHHHHc----ccchHhhHHHHHHHHHcCCCHHHHHHHHHHHHHcCCCCcHHHHHHHHHH
Q 040965          101 VFMGTALIDLYGKVGCLERAIRVFKSM----VIKDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEITFVAVLTA  176 (311)
Q Consensus       101 ~~~~~~l~~~~~~~g~~~~A~~~~~~~----~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~l~~~  176 (311)
                      ..+|++++.+|++.|++++|.++|++|    ..||..+|+++|.+|++.|++++|.++|++|.+.|+.||..||++|+.+
T Consensus       105 ~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~  184 (501)
T 4g26_A          105 EATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKV  184 (501)
T ss_dssp             HHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHH
Confidence            999999999999999999999999999    5679999999999999999999999999999999999999999999999


Q ss_pred             HHccccHHHHHHHHHHhhccCCCccchhhHHHHHHHHHhc
Q 040965          177 CARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRA  216 (311)
Q Consensus       177 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  216 (311)
                      |++.|+.++|.++|++|.+. +..|+..||+.++..|+..
T Consensus       185 ~~~~g~~d~A~~ll~~Mr~~-g~~ps~~T~~~l~~~F~s~  223 (501)
T 4g26_A          185 SMDTKNADKVYKTLQRLRDL-VRQVSKSTFDMIEEWFKSE  223 (501)
T ss_dssp             HHHTTCHHHHHHHHHHHHHH-TSSBCHHHHHHHHHHHHSH
T ss_pred             HhhCCCHHHHHHHHHHHHHh-CCCcCHHHHHHHHHHHhcC
Confidence            99999999999999999887 9999999999999998763



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure
>2ion_A PDCD4, programmed cell death 4, PDCD4; alpha-helical, antitumor protein; 1.57A {Mus musculus} SCOP: a.118.1.14 PDB: 2ios_A 2iol_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.78
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.74
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.54
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.54
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.44
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.43
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.43
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.42
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.42
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.4
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.4
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.33
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.13
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.13
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.01
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.97
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.96
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.95
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.94
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.93
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.89
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.86
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.83
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.76
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.68
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.64
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.64
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.62
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.62
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.57
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.52
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.51
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.49
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.47
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.41
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.41
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.27
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.23
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.12
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.1
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.07
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.06
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.98
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.97
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.94
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.9
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.77
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.72
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 97.21
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.2
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.98
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.75
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.64
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.1
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.91
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 93.59
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 92.11
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 91.83
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 86.24
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=3.3e-22  Score=163.75  Aligned_cols=287  Identities=12%  Similarity=0.090  Sum_probs=234.2

Q ss_pred             hhhhhcCChHHHHHHHHHhcc--c-cHHHHHHHHHHHHhcCCHhHHHHHHHHhhcCCCCCCCch-HHHHHHHHHhhhhhh
Q 040965            3 DGYVKNGDMDSAILLFENMLK--R-DVVSWTSIINGFVRNGCFGEAICVFKNMMGNVNLVRPNE-ATYVSVLSSCAGLVN   78 (311)
Q Consensus         3 ~~~~~~g~~~~A~~~~~~~~~--~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~p~~-~~~~~ll~~~~~~~~   78 (311)
                      +.+.+.|++++|++.|+++.+  | ++.++..+..+|.+.|++++|+..|+++.+    ..|+. ..+..+..++..   
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~----~~p~~~~a~~~l~~~~~~---   79 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIK----QNPLLAEAYSNLGNVYKE---   79 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH----HCTTCHHHHHHHHHHHHH---
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH----hCCCCHHHHHHHHHHhhh---
Confidence            457788999999999999843  3 677899999999999999999999999987    44554 455555544333   


Q ss_pred             cCcchhHHHHHHHHhhccCC------------------------------------------------------------
Q 040965           79 EGGLYLGKQVHGYILRNEIV------------------------------------------------------------   98 (311)
Q Consensus        79 ~~~~~~a~~~~~~~~~~~~~------------------------------------------------------------   98 (311)
                      .|++++|...+....+....                                                            
T Consensus        80 ~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (388)
T d1w3ba_          80 RGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYL  159 (388)
T ss_dssp             HTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHH
T ss_pred             hccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHH
Confidence            56688888877766553221                                                            


Q ss_pred             -------chHHHHHHHHHHHhhcCCHHHHHHHHHHccc---chHhhHHHHHHHHHcCCCHHHHHHHHHHHHHcCCCCcHH
Q 040965           99 -------LSVFMGTALIDLYGKVGCLERAIRVFKSMVI---KDVCTWNAMISSLASNSREKEALVMFDEMKEKGLRANEI  168 (311)
Q Consensus        99 -------~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~~~~~  168 (311)
                             .+...+..+...+...|++++|...+++...   .+..+|..+...+...|++++|...+++....+ +.+..
T Consensus       160 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~  238 (388)
T d1w3ba_         160 KAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAV  238 (388)
T ss_dssp             HHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHH
T ss_pred             HhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHH
Confidence                   1234455667778888999999999987743   356788889999999999999999999988764 44677


Q ss_pred             HHHHHHHHHHccccHHHHHHHHHHhhccCCCccchhhHHHHHHHHHhcCCHHHHHHHHHhC--CCCCCcchHHHHHHHHH
Q 040965          169 TFVAVLTACARAQLVELGLELFHSMLGKFEVVPIMEHYGCVVDLLGRAGLLSEAKEFMRSM--PFEPDASVLGALLGACK  246 (311)
Q Consensus       169 ~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~--~~~p~~~~~~~l~~~~~  246 (311)
                      .+..+...+.+.|++++|...|+++++.  .+-+..++..+..++...|++++|.+.++..  ..+.+...+..+...+.
T Consensus       239 ~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~  316 (388)
T d1w3ba_         239 VHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKR  316 (388)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHH
Confidence            7888889999999999999999999864  2234568889999999999999999999988  33456677888888999


Q ss_pred             hcCChhHHHHHHHHHHhcCCCchhHHHHHHHHHhccchhHHHHHHHHHHHHcc
Q 040965          247 IHGAVDLCHEVGRRLLELQPKHCGRYVVLSNIHAGLERWNRATDLRKAMVEAG  299 (311)
Q Consensus       247 ~~g~~~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~  299 (311)
                      ..|++++|...++++++..|+++.++..++.+|.+.|++++|...|++..+..
T Consensus       317 ~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~  369 (388)
T d1w3ba_         317 EQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRIS  369 (388)
T ss_dssp             TTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTC
T ss_pred             HCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999988754



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure