Citrus Sinensis ID: 041016


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------
MANLSLLLATLLLSFSILNSTCLCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNLKQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQWLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPAFGSDSLVGHVDISSNRFSGEVPSSFGVTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSLQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPSILPTLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLKSLNLSYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGRIPESPQMDRQIDPVIYANNSGLCGMQIQVVCPEDVQPPPDS
ccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEcccccccEEEEEEccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccEEEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEccccEEEEEccccccccccccEEEccccEEEEcccccccccccccEEEccccccEEEccccccccccccEEEccccccEEccccccccccccEEEccccccEEEccccccccccEEEccccEEEEcccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccccHHHHHHcccccccccccccccccccEEEEEEEEEEcccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEcccccccEEEEEcccEEEcccccccEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEccccccEEEccHHHHcccccccEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccccccccccEEEEEccccccccccHHHHccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHccHHHHHHHHccccccccccccccEHEEcccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHccccccccHHHHccccccccccccccccccccccccc
MANLSLLLATLLLSFSILnstclccpeDQKAALLEFKSLvlgdladnssADAMLGGLetwnsssdccrwemvrcrsrgpsqevtgldlnnlfpldsivtsVVLAPIFRIRSLMTLDLsynsmqgevpgtgfanltrltyldlkdnnlngsipsqlfnlrylefLDLSANAIEGKLSSRVAGLKNLkqlilddnliqgqipaeignltnlhkLSLRqnkfsggiplslLQLRKLETLDLQRnslsgeipedigTLANITILALSnnaltgaipqSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKslylggnklkwndnvsivpkcmltelslrscsvrgsiplwlstqteltfldlsenelegtypqwlselnlgtvilsdnmltgslppplfesrnlSVLVLSRnnfsgelpetigqSTSVMVLMLSsnnfsghvpkSISNIYRLLVLdlsnnsfsgefpafgsdslvghvdissnrfsgevpssFGVTILMLSLSenkfsgqlpqnlsnlsllqhldlhdnnltgefPAFLSQLSSLQVLNLRNTALegsitdglsnltslqildlsnnnllgkipssfgnlqgmidtpsilptlpeifsfpVEIQDLIVNWknskrglsskSLAIYSLMDlsnnqlsgeipsslgslkglKSLNLSYNqlqgnipstfgnlEILETLDLshnslsgkipQTFAKLQQLTSLYLsnnklsgripespqmdrqidpviyannsglcgmqiqvvcpedvqpppds
MANLSLLLATLLLSFSILNSTCLCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNLKQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQWLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPAFGSDSLVGHVDISSNRFSGEVPSSFGVTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSLQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPSILPTLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLKSLNLSYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLsgripespqmdrQIDPVIYANNSGLCGMQIQVvcpedvqpppds
MANlslllatlllsfsilNSTCLCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNLKQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQWLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPAFGSDSLVGHVDISSNRFSGEVPSSFGVTILMLSLSENKFSGQLPqnlsnlsllqhldlhdnnlTGEFPAFlsqlsslqVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPSILPTLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPsslgslkglkslnlsYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGRIPESPQMDRQIDPVIYANNSGLCGMQIQVVCPEDVQPPPDS
***LSLLLATLLLSFSILNSTCLCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNLKQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQWLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPAFGSDSLVGHVDISSNRFSGEVPSSFGVTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSLQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPSILPTLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDL*****************GLKSLNLSYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLS*****************IDPVIYANNSGLCGMQIQVVCP*********
**NLSLLLATLLLSFSILNSTCL**PEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNLKQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQWLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPAFGSDSLVGHVDISSNRFSGEVPSSFGVTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSLQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDT*****TLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLKSLNLSYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGRIPESPQMDRQIDPVIYANNSGLCGM****************
MANLSLLLATLLLSFSILNSTCLCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNLKQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQWLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPAFGSDSLVGHVDISSNRFSGEVPSSFGVTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSLQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPSILPTLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLKSLNLSYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGRIPESPQMDRQIDPVIYANNSGLCGMQIQVVCPE********
*ANLSLLLATLLLSFSILNSTCLCCPEDQKAALLEFKSLVLGD****SSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNLKQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQWLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPAFGSDSLVGHVDISSNRFSGEVPSSFGVTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSLQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPSILPTLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLKSLNLSYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGRIPESPQMDRQIDPVIYANNSGLCGMQIQVVC**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANLSLLLATLLLSFSILNSTCLCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNLKQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQWLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPAFGSDSLVGHVDISSNRFSGEVPSSFGVTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSLQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPSILPTLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLKSLNLSYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGRIPESPQMDRQIDPVIYANNSGLCGMQIQVVCPEDVQPPPDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query757 2.2.26 [Sep-21-2011]
Q8VZG8 1045 Probable LRR receptor-lik no no 0.858 0.622 0.327 5e-84
Q9C9H7847 Receptor-like protein 12 no no 0.936 0.837 0.329 1e-83
Q9LVP0 1102 Probable leucine-rich rep no no 0.885 0.607 0.346 1e-81
Q9FL28 1173 LRR receptor-like serine/ no no 0.805 0.520 0.328 3e-80
Q9LP24 1120 Probable leucine-rich rep no no 0.776 0.525 0.357 2e-79
C0LGQ5 1249 LRR receptor-like serine/ no no 0.886 0.537 0.329 6e-79
O49318 1124 Probable leucine-rich rep no no 0.896 0.604 0.320 2e-78
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.896 0.542 0.328 1e-76
Q9LYN8 1192 Leucine-rich repeat recep no no 0.821 0.521 0.323 2e-75
C0LGV1 1135 LRR receptor-like serine/ no no 0.819 0.546 0.333 2e-74
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function desciption
 Score =  313 bits (801), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 242/739 (32%), Positives = 360/739 (48%), Gaps = 89/739 (12%)

Query: 6   LLLATLLLSFSILNSTCLCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSD 65
           LL+ +++LS S   S  +    ++  ALL++KS        N ++ + L      N+SS 
Sbjct: 31  LLIISIVLSCSFAVSATV----EEANALLKWKSTF-----TNQTSSSKLSSWVNPNTSSF 81

Query: 66  CCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGE 125
           C  W  V C                                  + S++ L+L+   ++G 
Sbjct: 82  CTSWYGVACS---------------------------------LGSIIRLNLTNTGIEGT 108

Query: 126 VPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNL 185
                F++L  LT++DL  N  +G+I         LE+ DLS N + G++   +  L NL
Sbjct: 109 FEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDLSINQLVGEIPPELGDLSNL 168

Query: 186 KQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSG 245
             L L +N + G IP+EIG LT + ++++  N  +G IP S   L KL  L L  NSLSG
Sbjct: 169 DTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINSLSG 228

Query: 246 EIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGM 305
            IP +IG L N+  L L  N LTG IP S  N+  +  L +  N LSGEI   + ++  +
Sbjct: 229 SIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTAL 288

Query: 306 KSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEG 365
            +L L  NKL      ++     L  L L    + GSIP  L     +  L++SEN+L G
Sbjct: 289 DTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTG 348

Query: 366 TYPQWLSELN-LGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSV 424
             P    +L  L  + L DN L+G +PP +  S  L+VL L  NNF+G LP+TI +   +
Sbjct: 349 PVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICRGGKL 408

Query: 425 MVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEF-PAFGSDSLVGHVDISSNRFSG 483
             L L  N+F G VPKS+ +   L+ +    NSFSG+   AFG    +  +D+S+N F G
Sbjct: 409 ENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFSGDISEAFGVYPTLNFIDLSNNNFHG 468

Query: 484 EVPSSFGVT--ILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSL 541
           ++ +++  +  ++   LS N  +G +P  + N++ L  LDL  N +TGE P  +S ++ +
Sbjct: 469 QLSANWEQSQKLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSNRITGELPESISNINRI 528

Query: 542 QVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPSILPTLPE 601
             L L    L G I  G+  LT+L+ LDLS+N    +IP +  N             LP 
Sbjct: 529 SKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNN-------------LPR 575

Query: 602 IFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLKSLNLS 661
           ++                              M+LS N L   IP  L  L  L+ L+LS
Sbjct: 576 LY-----------------------------YMNLSRNDLDQTIPEGLTKLSQLQMLDLS 606

Query: 662 YNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGRIPESP 721
           YNQL G I S F +L+ LE LDLSHN+LSG+IP +F  +  LT + +S+N L G IP++ 
Sbjct: 607 YNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDMLALTHVDVSHNNLQGPIPDNA 666

Query: 722 QMDRQIDPVIYANNSGLCG 740
              R   P  +  N  LCG
Sbjct: 667 AF-RNAPPDAFEGNKDLCG 684





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query757
225435788814 PREDICTED: LRR receptor-like serine/thre 0.988 0.918 0.591 0.0
224052865805 predicted protein [Populus trichocarpa] 0.966 0.909 0.577 0.0
255564832816 serine-threonine protein kinase, plant-t 0.963 0.893 0.577 0.0
147789084793 hypothetical protein VITISV_041017 [Viti 0.960 0.916 0.572 0.0
297809603812 hypothetical protein ARALYDRAFT_490081 [ 0.960 0.895 0.553 0.0
42566300811 receptor like protein 46 [Arabidopsis th 0.957 0.893 0.546 0.0
359478805827 PREDICTED: LRR receptor-like serine/thre 0.959 0.877 0.547 0.0
449532453845 PREDICTED: LRR receptor-like serine/thre 0.957 0.857 0.530 0.0
449452781842 PREDICTED: LRR receptor-like serine/thre 0.957 0.861 0.529 0.0
3377849766 similar to receptor protein kinases [Ara 0.898 0.887 0.496 0.0
>gi|225435788|ref|XP_002283740.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/761 (59%), Positives = 585/761 (76%), Gaps = 13/761 (1%)

Query: 1   MANLSLLLATLLLSFSILNSTCLCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETW 60
           MANL LLL ++ LS  IL   CL CPE QK ALL+FKS +L   A NSS ++   GLE+W
Sbjct: 1   MANLGLLLGSIFLSIFIL--PCLSCPEYQKQALLQFKSSIL---ASNSSFNSSTFGLESW 55

Query: 61  NSSSDCCRWEMVRCRS--RGPSQEVTGLDLNNLF---PLDSIVTSVVLAPIFRIRSLMTL 115
           NSSS CC+W+ V C S     S+ VTGL L+ L+   P    + S VLAP+F+IRSLM L
Sbjct: 56  NSSSSCCQWDQVTCSSPSNSTSRVVTGLYLSALYTMLPPRPQLPSTVLAPLFQIRSLMLL 115

Query: 116 DLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKL 175
           D+S N++ GE+  +GFANL++L +LD+  NN N  IP   F+LR+L++LDL+ N++ G L
Sbjct: 116 DISSNNIYGEI-SSGFANLSKLVHLDMMLNNFNDFIPPHFFHLRHLQYLDLTNNSLHGSL 174

Query: 176 SSRVAGLKNLKQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLET 235
           S  V  L+NLK L LD+N + G++P EIGNLT L +LSL  N+FS GIP S+L L++L+T
Sbjct: 175 SPDVGSLQNLKVLKLDENFLSGKVPEEIGNLTKLQQLSLSSNQFSDGIPSSVLYLKELQT 234

Query: 236 LDLQRNSLSGEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEI 295
           LDL  N LS EIP DIG L NI+ L L++N LTG IP SI+ ++KL TL L++N+L+GEI
Sbjct: 235 LDLSYNMLSMEIPIDIGNLPNISTLTLNDNQLTGGIPSSIQKLSKLETLHLENNLLTGEI 294

Query: 296 STWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTF 355
           S+WLFDL+G+K+LYLG N L WN++V IVPKC+L+ LSL+SC V G IP W+STQ  L F
Sbjct: 295 SSWLFDLKGLKNLYLGSNSLTWNNSVKIVPKCILSRLSLKSCGVAGEIPEWISTQKTLDF 354

Query: 356 LDLSENELEGTYPQWLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELP 415
           LDLSENEL+GT+PQWL+E+++G++ILSDN LTGSLPP LF+S +LSVL LSRNNFSGELP
Sbjct: 355 LDLSENELQGTFPQWLAEMDVGSIILSDNKLTGSLPPVLFQSLSLSVLALSRNNFSGELP 414

Query: 416 ETIGQSTSVMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGE-FPAFGSDSLVGHV 474
           + IG +  +M+LML+ NNFSG +P+SIS IYRLL+LDLS+N FSG+ FP F  +  +  +
Sbjct: 415 KNIGDAGGLMILMLAENNFSGPIPQSISQIYRLLLLDLSSNRFSGKTFPIFDPEGFLAFI 474

Query: 475 DISSNRFSGEVPSSFGVTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAF 534
           D SSN FSGE+P SF    ++L+L  NKFSG LP NLS+LS L+HLDLHDNNL G+ P  
Sbjct: 475 DFSSNEFSGEIPMSFSQETMILALGGNKFSGSLPSNLSSLSKLEHLDLHDNNLKGDLPES 534

Query: 535 LSQLSSLQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPS 594
           L Q+S+LQVL+LRN +L+GSI + +SNL+S++ILD+SNNNL+G+IP   GNL GMI+TP+
Sbjct: 535 LFQISTLQVLSLRNNSLQGSIPETISNLSSVRILDVSNNNLIGEIPKGCGNLVGMIETPN 594

Query: 595 ILPTLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKG 654
           +L ++ ++F+F +E +DLIVNWK SK+GLSS+ L IY+L DLS N LSGEIP+S+G+LK 
Sbjct: 595 LLSSVSDVFTFSIEFKDLIVNWKKSKQGLSSRHLDIYTLFDLSKNHLSGEIPASIGALKA 654

Query: 655 LKSLNLSYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLS 714
           LK LN+SYN+L G IP +FG+LE +E+LDLSHN LSG IPQT  KLQQL++L +SNN+L+
Sbjct: 655 LKLLNVSYNKLSGKIPVSFGDLENVESLDLSHNQLSGSIPQTLVKLQQLSNLDVSNNQLT 714

Query: 715 GRIPESPQMDRQIDPVIYANNSGLCGMQIQVVCPEDVQPPP 755
           GRIP   QM    DP+ YANNSGLCGMQI+V CPED +PPP
Sbjct: 715 GRIPVGGQMSTMADPIYYANNSGLCGMQIRVPCPED-EPPP 754




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224052865|ref|XP_002297619.1| predicted protein [Populus trichocarpa] gi|222844877|gb|EEE82424.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255564832|ref|XP_002523410.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223537360|gb|EEF38989.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147789084|emb|CAN75789.1| hypothetical protein VITISV_041017 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297809603|ref|XP_002872685.1| hypothetical protein ARALYDRAFT_490081 [Arabidopsis lyrata subsp. lyrata] gi|297318522|gb|EFH48944.1| hypothetical protein ARALYDRAFT_490081 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42566300|ref|NP_192331.2| receptor like protein 46 [Arabidopsis thaliana] gi|332656975|gb|AEE82375.1| receptor like protein 46 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359478805|ref|XP_002283728.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449532453|ref|XP_004173195.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449452781|ref|XP_004144137.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|3377849|gb|AAC28231.1| similar to receptor protein kinases [Arabidopsis thaliana] gi|7267178|emb|CAB77890.1| putative disease resistance protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query757
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.920 0.859 0.478 4.1e-159
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.869 0.587 0.332 1.4e-80
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.837 0.540 0.321 2.6e-77
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.896 0.597 0.312 1.4e-76
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.902 0.607 0.296 3.4e-76
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.833 0.697 0.331 1.4e-73
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.854 0.587 0.324 5e-73
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.852 0.516 0.326 6e-73
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.778 0.563 0.324 6.1e-73
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.871 0.527 0.315 2.1e-72
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1550 (550.7 bits), Expect = 4.1e-159, P = 4.1e-159
 Identities = 342/715 (47%), Positives = 464/715 (64%)

Query:    25 CPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVT 84
             CP+DQ+ +LLEFK+L++ ++ DN +A   LG   TW  +SDCC+W  V C +  PS+EV 
Sbjct:    24 CPQDQRQSLLEFKNLLIHNIKDNYTAFEELG---TWRPNSDCCKWLRVTCNASSPSKEVI 80

Query:    85 GLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKD 144
              L+L  L P   +V+S +L PI RI SL+ LD+S+N++QGE+PG  F NLT L  LD+  
Sbjct:    81 DLNLFLLIP-PGLVSSSILRPILRINSLVGLDVSFNNIQGEIPGYAFVNLTSLISLDMCC 139

Query:   145 NNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNLKQLILDDNLIQGQIPAEIG 204
             N  NGSIP +LF+L  L+ LDLS N I G LS  +  LKNL++LILD+NLI G IP+EIG
Sbjct:   140 NRFNGSIPHELFSLTNLQRLDLSRNVIGGTLSGDIKELKNLQELILDENLIGGAIPSEIG 199

Query:   205 NLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSN 264
             +L  L  L+LRQN F+  IP S+ +L KL+T+DLQ N LS +IP+DIG L N++ L+LS 
Sbjct:   200 SLVELLTLTLRQNMFNSSIPSSVSRLTKLKTIDLQNNFLSSKIPDDIGNLVNLSTLSLSM 259

Query:   265 NALTGAIPQSIRNMTKLVTLRLDSNV-LSGEI-STWLFDLQGMKSLYL-GGNKLKWNDNV 321
             N L+G IP SI N+  L TL+L++N  LSGEI + WLF LQ +K L L G NKL+WN+N 
Sbjct:   260 NKLSGGIPSSIHNLKNLETLQLENNNGLSGEIPAAWLFGLQKLKVLRLEGNNKLQWNNNG 319

Query:   322 SIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQWLSELNLGTVIL 381
              + P+  LT LSLRSC + G+IP WL  QT L +LDLS N LEG +P+WL++L +  + L
Sbjct:   320 YVFPQFKLTHLSLRSCGLEGNIPDWLKNQTALVYLDLSINRLEGRFPKWLADLKIRNITL 379

Query:   382 SDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVMVLMLSSNNFSGHVPKS 441
             SDN LTGSLPP LF+  +L  LVLSRNNFSG++P+TIG+S  VMVLMLS NNFSG VPKS
Sbjct:   380 SDNRLTGSLPPNLFQRPSLYYLVLSRNNFSGQIPDTIGES-QVMVLMLSENNFSGSVPKS 438

Query:   442 ISNIYRLLVLDLSNNSFSGEFPAFGSDSLVGHVDISSNRFSGEVPSSFGVTILMLSLSEN 501
             I+ I  L +LDLS N  SGEFP F  +S +  +DISSN FSG+VP+ FG +  ML +S+N
Sbjct:   439 ITKIPFLKLLDLSKNRLSGEFPRFRPESYLEWLDISSNEFSGDVPAYFGGSTSMLLMSQN 498

Query:   502 KFSGQLPXXXXXXXXXXXXXXXXXXXTGEFPAFXXXXXXXX-VLNLRNTALEGSITDGLS 560
              FSG+ P                   +G   +          VL+LRN +L+GSI +G+S
Sbjct:   499 NFSGEFPQNFRNLSYLIRLDLHDNKISGTVASLISQLSSSVEVLSLRNNSLKGSIPEGIS 558

Query:   561 NLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPSILPTLPEIFSFPVEIQDLIVNWKNSK 620
             NLTSL++LDLS NNL G +PSS GNL  MI +P   P+   I  +     D+     N +
Sbjct:   559 NLTSLKVLDLSENNLDGYLPSSLGNLTCMIKSPE--PSAMTIRPYFSSYTDI----PNIE 612

Query:   621 RGLSSKSLAIYSLMDLSNNQLSGEIPXXXXXXXXXXXXXXXYNQLQGNIPSTFGNLEILE 680
             R +  +S  I+SL+   N + S ++                 N+L G IP++ GNL+ L+
Sbjct:   613 RLIEIESEDIFSLV--VNWKNSKQV-LFDRNFYLYTLLDLSKNKLHGEIPTSLGNLKSLK 669

Query:   681 TLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGRIPESPQMDRQIDPVIYANN 735
              L+LS+N  SG IPQ+F  L+++ SL LS+N L+G IP++     +++ +   NN
Sbjct:   670 VLNLSNNEFSGLIPQSFGDLEKVESLDLSHNNLTGEIPKTLSKLSELNTLDLRNN 724


GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00024833001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (814 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query757
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-93
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-90
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-05
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  312 bits (801), Expect = 1e-93
 Identities = 235/678 (34%), Positives = 328/678 (48%), Gaps = 95/678 (14%)

Query: 5   SLLLATLLLSFSILNSTCLCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSS 64
             L+  L   F  LN + L   E +   LL FKS          S +  L  L  WNSS+
Sbjct: 10  PYLIFMLFFLF--LNFSMLHAEELE--LLLSFKS----------SINDPLKYLSNWNSSA 55

Query: 65  DCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQG 124
           D C W+ + C +   S  V  +DL+        ++  + + IFR+  + T++LS N + G
Sbjct: 56  DVCLWQGITCNN---SSRVVSIDLSG-----KNISGKISSAIFRLPYIQTINLSNNQLSG 107

Query: 125 EVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKN 184
            +P   F   + L YL+L +NN  GSIP        LE LDLS N + G++ + +    +
Sbjct: 108 PIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPN--LETLDLSNNMLSGEIPNDIGSFSS 165

Query: 185 LKQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLS 244
           LK L L  N++ G+IP  + NLT+L  L+L  N+  G IP  L Q++ L+ + L  N+LS
Sbjct: 166 LKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLS 225

Query: 245 GEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQG 304
           GEIP +IG L ++  L L  N LTG IP S+ N+  L  L L  N LSG I   +F LQ 
Sbjct: 226 GEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQK 285

Query: 305 MKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELE 364
           + SL L  N                        S+ G IP  +     L  L L  N   
Sbjct: 286 LISLDLSDN------------------------SLSGEIPELVIQLQNLEILHLFSNNFT 321

Query: 365 GTYPQWLSEL-NLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTS 423
           G  P  L+ L  L  + L  N  +G +P  L +  NL+VL LS NN +GE+PE +  S +
Sbjct: 322 GKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGN 381

Query: 424 VMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPA-FGSDSLVGHVDISSNRFS 482
           +  L+L SN+  G +PKS+     L  + L +NSFSGE P+ F    LV  +DIS+N   
Sbjct: 382 LFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQ 441

Query: 483 GEVPSSFG--VTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSS 540
           G + S      ++ MLSL+ NKF G LP        L++LDL  N  +G  P  L  LS 
Sbjct: 442 GRINSRKWDMPSLQMLSLARNKFFGGLPD-SFGSKRLENLDLSRNQFSGAVPRKLGSLSE 500

Query: 541 LQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMIDTPSILPTLP 600
           L  L L    L G I D LS+   L  LDLS+N L G+IP+SF  +              
Sbjct: 501 LMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMP------------- 547

Query: 601 EIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLKSLNL 660
                                        + S +DLS NQLSGEIP +LG+++ L  +N+
Sbjct: 548 -----------------------------VLSQLDLSQNQLSGEIPKNLGNVESLVQVNI 578

Query: 661 SYNQLQGNIPSTFGNLEI 678
           S+N L G++PST   L I
Sbjct: 579 SHNHLHGSLPSTGAFLAI 596


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 757
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
PLN03150623 hypothetical protein; Provisional 99.53
PLN03150623 hypothetical protein; Provisional 99.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.94
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.94
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.78
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.75
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.28
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.06
PRK15386 426 type III secretion protein GogB; Provisional 98.04
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.89
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.72
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.65
PRK15386426 type III secretion protein GogB; Provisional 97.59
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.54
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.46
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.44
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.4
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.35
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.77
KOG4341483 consensus F-box protein containing LRR [General fu 96.4
KOG4341483 consensus F-box protein containing LRR [General fu 96.35
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.87
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.64
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.05
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.68
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.42
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.58
KOG4308478 consensus LRR-containing protein [Function unknown 92.13
KOG4308478 consensus LRR-containing protein [Function unknown 91.91
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.36
smart0037026 LRR Leucine-rich repeats, outliers. 90.36
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.43
smart0037026 LRR Leucine-rich repeats, outliers. 88.88
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.26
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.18
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.54
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5e-74  Score=689.87  Aligned_cols=584  Identities=38%  Similarity=0.610  Sum_probs=483.4

Q ss_pred             cHHHHHHHHHHHhhccCCCCCCCcccccCCCCCCCCCCCCCcccceeeeCCCCCcccEEEEEcCCCCCCCCcceeecccc
Q 041016           26 PEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAP  105 (757)
Q Consensus        26 ~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~~~v~~l~L~~~~~~~~~~~~~~~~~  105 (757)
                      .++|++||++||+.+.   + +      .+.+.+|+...+||.|.||+|+.   .++|+.++|++.     .+.|.+++.
T Consensus        27 ~~~~~~~l~~~~~~~~---~-~------~~~~~~w~~~~~~c~w~gv~c~~---~~~v~~L~L~~~-----~i~~~~~~~   88 (968)
T PLN00113         27 HAEELELLLSFKSSIN---D-P------LKYLSNWNSSADVCLWQGITCNN---SSRVVSIDLSGK-----NISGKISSA   88 (968)
T ss_pred             CHHHHHHHHHHHHhCC---C-C------cccCCCCCCCCCCCcCcceecCC---CCcEEEEEecCC-----CccccCChH
Confidence            4689999999999985   2 4      45578998878999999999985   568999999986     778888889


Q ss_pred             ccCCCCCCEEeCCCCCCCCCCCccccCCCCCCCEEeCCCCcCCCCcCccccCCCCCCEEEccCCcCCCcccccccCCCCC
Q 041016          106 IFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSRVAGLKNL  185 (757)
Q Consensus       106 l~~l~~L~~L~Ls~n~l~~~i~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L  185 (757)
                      +..+++|++|+|++|.+.|.+|...+..+++|++|+|++|.+++.+|.  +.+++|++|+|++|.+.+..|..++++++|
T Consensus        89 ~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L  166 (968)
T PLN00113         89 IFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSL  166 (968)
T ss_pred             HhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCC
Confidence            999999999999999999999966677999999999999999988885  568899999999999988888889999999


Q ss_pred             CEEEccCccCCccCchhccCCCCCCEEEccccccccccCccccCCCCCCEEEccCCcCcccCcccccCCCCCCEEEccCC
Q 041016          186 KQLILDDNLIQGQIPAEIGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSNN  265 (757)
Q Consensus       186 ~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n  265 (757)
                      ++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..++++++|++|++++|.+++.+|..++++++|++|++++|
T Consensus       167 ~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n  246 (968)
T PLN00113        167 KVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYN  246 (968)
T ss_pred             CEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCc
Confidence            99999999988888988999999999999999988888888888999999999999988888888888889999999888


Q ss_pred             CCCCccchhhhcCCCCCEEEccCCccccccchhhhccCCCcEEEccCCCCcCCCcccccCCcccceeecCCccCccCcch
Q 041016          266 ALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPL  345 (757)
Q Consensus       266 ~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~  345 (757)
                      .+.+.+|..++++++|++|++++|.+.+.+|..+..+++|++|++++|.+.                        +.+|.
T Consensus       247 ~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~------------------------~~~p~  302 (968)
T PLN00113        247 NLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLS------------------------GEIPE  302 (968)
T ss_pred             eeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeec------------------------cCCCh
Confidence            888888888888888888888888888878877877777777777777665                        66777


Q ss_pred             hccCCCCCCEEEccCCcccCcccccccCccccEEEcCCCcCCCCCCCCccCCCCCCEEeCcCccccccCCcccCCCCCcc
Q 041016          346 WLSTQTELTFLDLSENELEGTYPQWLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVM  425 (757)
Q Consensus       346 ~l~~~~~L~~L~l~~n~l~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~  425 (757)
                      ++..+++|+.|++++|.+.+..|..+.                       .+++|+.|++++|.+++.+|..++.+++|+
T Consensus       303 ~~~~l~~L~~L~l~~n~~~~~~~~~~~-----------------------~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~  359 (968)
T PLN00113        303 LVIQLQNLEILHLFSNNFTGKIPVALT-----------------------SLPRLQVLQLWSNKFSGEIPKNLGKHNNLT  359 (968)
T ss_pred             hHcCCCCCcEEECCCCccCCcCChhHh-----------------------cCCCCCEEECcCCCCcCcCChHHhCCCCCc
Confidence            777777788887777777765555444                       445555555555555555555555555666


Q ss_pred             EEEccCCcccccChHhhhccCCCCEEEccCCcccccCC-CCCCCCcccEEECcCCccccCCCchhhhcccEEEccCCccc
Q 041016          426 VLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFP-AFGSDSLVGHVDISSNRFSGEVPSSFGVTILMLSLSENKFS  504 (757)
Q Consensus       426 ~L~L~~n~l~~~~~~~l~~l~~L~~L~ls~n~l~~~~~-~~~~~~~L~~L~l~~n~l~~~~~~~~~~~l~~L~l~~n~l~  504 (757)
                      .|++++|++.+.+|..+..+++|+.|++++|.+.+.+| .+..+++|+.|++++|++                      +
T Consensus       360 ~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l----------------------~  417 (968)
T PLN00113        360 VLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSF----------------------S  417 (968)
T ss_pred             EEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEe----------------------e
Confidence            66666666655556556555566666666655555554 444444544444444433                      3


Q ss_pred             cccchhccCCCCCCEEeCcCCcccCcchhhccCCCCCCEEEccCCcCccccCcccCCCCCCCEEECcCCcccccCCcccc
Q 041016          505 GQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSLQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFG  584 (757)
Q Consensus       505 ~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~ls~n~l~~~~p~~~~  584 (757)
                      +..|..|.+++.|+.|++++|.+++.+|..+..+++|++|++++|++.+.+|..+ ..++|+.|++++|++++.+|..+.
T Consensus       418 ~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~  496 (968)
T PLN00113        418 GELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLG  496 (968)
T ss_pred             eECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhh
Confidence            4455667788888889999888888888888888899999999999888888765 458899999999999998888877


Q ss_pred             cccccccCCCCCCCCCcccCCccccceeEeeeccCccccccccccccCeEECcCCCCCCcCCccccCCCCCCEEeCCCCC
Q 041016          585 NLQGMIDTPSILPTLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLKSLNLSYNQ  664 (757)
Q Consensus       585 ~l~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~  664 (757)
                      ++..|                                          +.|+|++|++.+.+|..++++++|++|+|++|.
T Consensus       497 ~l~~L------------------------------------------~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~  534 (968)
T PLN00113        497 SLSEL------------------------------------------MQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQ  534 (968)
T ss_pred             hhhcc------------------------------------------CEEECcCCcceeeCChHHcCccCCCEEECCCCc
Confidence            66555                                          889999999999999999999999999999999


Q ss_pred             CCccCCcchhCCCCCCEEeCCCCcCccCCCCCccCCCCCCEEeCCCCcceecCCCCCCCCCCCCCccccCCCCCCCCC
Q 041016          665 LQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGRIPESPQMDRQIDPVIYANNSGLCGMQ  742 (757)
Q Consensus       665 l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~~gn~~lc~~~  742 (757)
                      +++.+|..|..+++|++|+|++|++++.+|..+..+++|++|++++|+++|.+|..+++.++...+ |.||+++||.+
T Consensus       535 l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~-~~~n~~lc~~~  611 (968)
T PLN00113        535 LSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASA-VAGNIDLCGGD  611 (968)
T ss_pred             ccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhh-hcCCccccCCc
Confidence            999999999999999999999999999999999999999999999999999999999999999999 99999999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query757
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-43
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-43
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-21
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-10
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 7e-06
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 7e-08
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 7e-08
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-07
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 1e-06
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 1e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-06
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-06
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-06
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 3e-06
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 6e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 4e-06
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 4e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 8e-05
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 1e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 3e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-04
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-04
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 8e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 172 bits (436), Expect = 6e-43, Method: Compositional matrix adjust. Identities = 224/767 (29%), Positives = 332/767 (43%), Gaps = 113/767 (14%) Query: 57 LETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLD 116 L W+S+ + C ++ V CR +VT +DL++ PL+ + S V + + + L +L Sbjct: 30 LPDWSSNKNPCTFDGVTCRD----DKVTSIDLSSK-PLN-VGFSAVSSSLLSLTGLESLF 83 Query: 117 LSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPS--QLFNLRYLEFLDLSANAIE-- 172 LS + + G V +GF LT LDL N+L+G + + L + L+FL++S+N ++ Sbjct: 84 LSNSHINGSV--SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFP 141 Query: 173 GKLSSRVAGLKNLKQLILDDNLIQGQIPAEIG-----NLTNLHKLSLRQNKFSGGIPLSL 227 GK+S + L +L+ L L N I G +G L L++ NK SG + +S Sbjct: 142 GKVSGGLK-LNSLEVLDLSANSISGA--NVVGWVLSDGCGELKHLAISGNKISGDVDVS- 197 Query: 228 LQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLD 287 + LE LD+ N+ S IP +G + + L +S N L+G ++I T+L L + Sbjct: 198 -RCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNIS 255 Query: 288 SNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVPKCMLTELSLRSCSVRGSIPLWL 347 SN G I +P L LSL G IP +L Sbjct: 256 SNQFVGPIPP--------------------------LPLKSLQYLSLAENKFTGEIPDFL 289 Query: 348 STQTE-LTFLDLSENELEGTYPQWLSELNLGTVILSD-NMLTGSLP-PPLFESRNLSVLV 404 S + LT LDLS N G P + +L + N +G LP L + R L VL Sbjct: 290 SGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLD 349 Query: 405 LSRNNFSGELPETIGQ-STSVMVLMLSSNNFSGHV-PKSISNIYRLLV-LDLSNNSFSGE 461 LS N FSGELPE++ S S++ L LSSNNFSG + P N L L L NN F+G+ Sbjct: 350 LSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK 409 Query: 462 FPAFGSD-SLVGHVDISSNRFSGEVPSSFGV--TILMLSLSENKFSGQLPXXXXXXXXXX 518 P S+ S + + +S N SG +PSS G + L L N G++P Sbjct: 410 IPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE 469 Query: 519 XXXXXXXXXTGEFPAFXXXXXXXXVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGK 578 TGE P+ ++L N L G I + L +L IL LSNN+ G Sbjct: 470 TLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGN 529 Query: 579 IPSSFGNLQGMI----DTPSILPTLPEIFSFPVEIQDLIVNWKNSKR-------GLSSKS 627 IP+ G+ + +I +T T+P + + + N+ KR G+ + Sbjct: 530 IPAELGDCRSLIWLDLNTNLFNGTIPA--AMFKQSGKIAANFIAGKRYVYIKNDGMKKEC 587 Query: 628 LAIYSLMDLSN------NQLSGEIPXXXXXXXXXXXXX-------------XXYNQLQGN 668 +L++ N+LS P YN L G Sbjct: 588 HGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGY 647 Query: 669 IPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGRIPES-------- 720 IP G++ L L+L HN +SG IP L+ L L LS+NKL GRIP++ Sbjct: 648 IPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLT 707 Query: 721 -------------PQMDR--QIDPVIYANNSGLCGMQIQVVCPEDVQ 752 P+M + P + NN GLCG + P + Sbjct: 708 EIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNAD 754
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query757
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-101
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-81
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-80
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-78
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-60
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-84
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-61
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-58
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-84
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-66
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-54
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-47
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-78
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-49
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-72
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-68
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-70
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-67
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-62
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-40
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-51
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-42
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-51
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-32
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-47
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-46
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-34
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-32
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-32
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-32
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-20
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-28
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-28
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-27
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-23
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-14
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-14
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-18
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-16
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 9e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 6e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  536 bits (1383), Expect = 0.0
 Identities = 220/784 (28%), Positives = 342/784 (43%), Gaps = 67/784 (8%)

Query: 16  SILNSTCLCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCR 75
           S   S        +   L+ FK      L D +        L  W+S+ + C ++ V CR
Sbjct: 1   SFQASPSQSL-YREIHQLISFKD----VLPDKNL-------LPDWSSNKNPCTFDGVTCR 48

Query: 76  SRGPSQEVTGLDLNNLFPLDSIVTSVVLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLT 135
                 +VT +DL++     ++  S V + +  +  L +L LS + + G V   GF    
Sbjct: 49  ----DDKVTSIDLSSKP--LNVGFSAVSSSLLSLTGLESLFLSNSHINGSVS--GFKCSA 100

Query: 136 RLTYLDLKDNNLNGSIPS--QLFNLRYLEFLDLSANAIEGKLS-SRVAGLKNLKQLILDD 192
            LT LDL  N+L+G + +   L +   L+FL++S+N ++     S    L +L+ L L  
Sbjct: 101 SLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSA 160

Query: 193 NLIQGQIPAEI---GNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPE 249
           N I G              L  L++  NK SG + +S  +   LE LD+  N+ S  IP 
Sbjct: 161 NSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVS--RCVNLEFLDVSSNNFSTGIPF 218

Query: 250 DIGTLANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLY 309
            +G  + +  L +S N L+G   ++I   T+L  L + SN   G I      L+ ++ L 
Sbjct: 219 -LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLP--LKSLQYLS 275

Query: 310 LGGNKLKWNDNVSIVPKC-MLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYP 368
           L  NK        +   C  LT L L      G++P +  + + L  L LS N   G  P
Sbjct: 276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELP 335

Query: 369 -QWLSEL-NLGTVILSDNMLTGSLPPPLFE-SRNLSVLVLSRNNFSGELPETIGQS--TS 423
              L ++  L  + LS N  +G LP  L   S +L  L LS NNFSG +   + Q+   +
Sbjct: 336 MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNT 395

Query: 424 VMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPA-FGSDSLVGHVDISSNRFS 482
           +  L L +N F+G +P ++SN   L+ L LS N  SG  P+  GS S +  + +  N   
Sbjct: 396 LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLE 455

Query: 483 GEVPSSFG--VTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSS 540
           GE+P       T+  L L  N  +G++P  LSN + L  + L +N LTGE P ++ +L +
Sbjct: 456 GEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLEN 515

Query: 541 LQVLNLRNTALEGSITDGLSNLTSLQILDLSNNNLLGKIPSSFGNLQGMID----TPSIL 596
           L +L L N +  G+I   L +  SL  LDL+ N   G IP++     G I          
Sbjct: 516 LAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRY 575

Query: 597 PTLPEIFSFPVEIQDLIVNWKNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLK 656
             +              +      R      L+  +  ++++    G    +  +   + 
Sbjct: 576 VYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMM 635

Query: 657 SLNLSYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQTFAKLQQLTSLYLSNNKLSGR 716
            L++SYN L G IP   G++  L  L+L HN +SG IP     L+ L  L LS+NKL GR
Sbjct: 636 FLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGR 695

Query: 717 IPES---------------------PQMD--RQIDPVIYANNSGLCGMQIQVVCPEDVQP 753
           IP++                     P+M       P  + NN GLCG  +    P +   
Sbjct: 696 IPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADG 755

Query: 754 PPDS 757
               
Sbjct: 756 YAHH 759


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query757
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.39
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.18
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.96
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.33
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.83
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4e-92  Score=824.47  Aligned_cols=701  Identities=31%  Similarity=0.450  Sum_probs=620.5

Q ss_pred             CCCcHHHHHHHHHHHhhccCCCCCCCcccccCCCCCCCCCCCCCcccceeeeCCCCCcccEEEEEcCCCCCCCCcceee-
Q 041016           23 LCCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCRWEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTSV-  101 (757)
Q Consensus        23 ~~~~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~~~v~~l~L~~~~~~~~~~~~~-  101 (757)
                      +++.++|++||++||+++.   + +      . .+++|+.++|||+|.||+|+    .++|++++|++.     .+.|. 
T Consensus         7 ~~~~~~~~~all~~k~~~~---~-~------~-~l~~W~~~~~~C~w~gv~C~----~~~v~~L~L~~~-----~l~g~~   66 (768)
T 3rgz_A            7 SQSLYREIHQLISFKDVLP---D-K------N-LLPDWSSNKNPCTFDGVTCR----DDKVTSIDLSSK-----PLNVGF   66 (768)
T ss_dssp             -CCHHHHHHHHHHHHTTCS---C-T------T-SSTTCCTTSCGGGSTTEEEE----TTEEEEEECTTS-----CCCEEH
T ss_pred             ccCCHHHHHHHHHHHhhCC---C-c------c-cccCCCCCCCCcCCcceEEC----CCcEEEEECCCC-----CcCCcc
Confidence            3567899999999999986   3 4      4 68899988899999999998    479999999987     78888 


Q ss_pred             --ccccccCCCCCCEEeCCCCCCCCCCCccccCCCCCCCEEeCCCCcCCCCcCc--cccCCCCCCEEEccCCcCCCcccc
Q 041016          102 --VLAPIFRIRSLMTLDLSYNSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPS--QLFNLRYLEFLDLSANAIEGKLSS  177 (757)
Q Consensus       102 --~~~~l~~l~~L~~L~Ls~n~l~~~i~~~~~~~l~~L~~L~Ls~n~l~~~~p~--~l~~l~~L~~L~Ls~n~l~~~~~~  177 (757)
                        +++.+.++++|+.++++.+.+. .+| ..|+++++|++|+|++|.++|.+|.  .++++++|++|+|++|.+.+..|.
T Consensus        67 ~~l~~~l~~L~~L~~l~~~~~~~~-~l~-~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~  144 (768)
T 3rgz_A           67 SAVSSSLLSLTGLESLFLSNSHIN-GSV-SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKV  144 (768)
T ss_dssp             HHHHHHTTTCTTCCEEECTTSCEE-ECC-CCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSC
T ss_pred             CccChhHhccCcccccCCcCCCcC-CCc-hhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCH
Confidence              8899999999999999999875 466 6799999999999999999999998  999999999999999999988887


Q ss_pred             cc-cCCCCCCEEEccCccCCccCchh---ccCCCCCCEEEccccccccccCccccCCCCCCEEEccCCcCcccCcccccC
Q 041016          178 RV-AGLKNLKQLILDDNLIQGQIPAE---IGNLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGT  253 (757)
Q Consensus       178 ~~-~~l~~L~~L~L~~n~l~~~~p~~---~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~  253 (757)
                      .+ .++++|++|++++|.+++..|..   +.++++|++|++++|.+.+..+.  ..+++|++|++++|.+++.+|. +++
T Consensus       145 ~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l~~~~~~-l~~  221 (768)
T 3rgz_A          145 SGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFSTGIPF-LGD  221 (768)
T ss_dssp             CSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCCCSCCCB-CTT
T ss_pred             HHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcCCCCCcc-ccc
Confidence            76 89999999999999999888877   89999999999999999977664  8899999999999999988887 999


Q ss_pred             CCCCCEEEccCCCCCCccchhhhcCCCCCEEEccCCccccccchhhhccCCCcEEEccCCCCcCCCcccccC-Cccccee
Q 041016          254 LANITILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKWNDNVSIVP-KCMLTEL  332 (757)
Q Consensus       254 l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~-~~~L~~L  332 (757)
                      +++|++|++++|.+++.+|..++++++|++|++++|.+++.+|..  .+++|++|++++|.++......+.. +..|++|
T Consensus       222 l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L  299 (768)
T 3rgz_A          222 CSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGL  299 (768)
T ss_dssp             CCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEE
T ss_pred             CCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEE
Confidence            999999999999999999999999999999999999999888765  8999999999999988433334434 4789999


Q ss_pred             ecCCccCccCcchhccCCCCCCEEEccCCcccCccccc-ccCcc-ccEEEcCCCcCCCCCCCCccCCC-CCCEEeCcCcc
Q 041016          333 SLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQW-LSELN-LGTVILSDNMLTGSLPPPLFESR-NLSVLVLSRNN  409 (757)
Q Consensus       333 ~L~~~~~~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~-~~~~~-L~~L~l~~n~l~~~~~~~l~~~~-~L~~L~L~~n~  409 (757)
                      ++++|.+++.+|.+++.+++|++|++++|++.+.+|.. +..++ |++|++++|++++.+|..+..++ +|++|++++|.
T Consensus       300 ~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~  379 (768)
T 3rgz_A          300 DLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN  379 (768)
T ss_dssp             ECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSE
T ss_pred             ECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCC
Confidence            99999999999999999999999999999999888875 78887 99999999999999999999887 99999999999


Q ss_pred             ccccCCcccCC--CCCccEEEccCCcccccChHhhhccCCCCEEEccCCcccccCC-CCCCCCcccEEECcCCccccCCC
Q 041016          410 FSGELPETIGQ--STSVMVLMLSSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFP-AFGSDSLVGHVDISSNRFSGEVP  486 (757)
Q Consensus       410 l~~~~~~~~~~--~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~ls~n~l~~~~~-~~~~~~~L~~L~l~~n~l~~~~~  486 (757)
                      +++.++..+..  +++|++|++++|.+++.+|..+.++++|++|++++|.+++.+| .+..+++|++|++++|++.+.+|
T Consensus       380 l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p  459 (768)
T 3rgz_A          380 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP  459 (768)
T ss_dssp             EEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCC
T ss_pred             cCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCC
Confidence            99999888877  8899999999999999999999999999999999999999888 89999999999999999999999


Q ss_pred             chhhhc--ccEEEccCCccccccchhccCCCCCCEEeCcCCcccCcchhhccCCCCCCEEEccCCcCccccCcccCCCCC
Q 041016          487 SSFGVT--ILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSLQVLNLRNTALEGSITDGLSNLTS  564 (757)
Q Consensus       487 ~~~~~~--l~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~  564 (757)
                      ..+...  +++|++++|++++.+|..+.++++|++|++++|++++.+|.+++.+++|++|++++|++++.+|..+..+++
T Consensus       460 ~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~  539 (768)
T 3rgz_A          460 QELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRS  539 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTT
T ss_pred             HHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCC
Confidence            988754  999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEECcCCcccccCCcccccccccccCCCCCC---------CCCcccC-----------Ccccccee------Ee--ee
Q 041016          565 LQILDLSNNNLLGKIPSSFGNLQGMIDTPSILP---------TLPEIFS-----------FPVEIQDL------IV--NW  616 (757)
Q Consensus       565 L~~L~ls~n~l~~~~p~~~~~l~~l~~~~~~~~---------~~~~~~~-----------~~~~~~~l------~~--~~  616 (757)
                      |++|++++|+++|.+|..+.....+........         .......           .+..+..+      .+  ..
T Consensus       540 L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~  619 (768)
T 3rgz_A          540 LIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRV  619 (768)
T ss_dssp             CCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCE
T ss_pred             CCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccce
Confidence            999999999999999999877665532211000         0000000           00000000      00  00


Q ss_pred             ccCccccccccccccCeEECcCCCCCCcCCccccCCCCCCEEeCCCCCCCccCCcchhCCCCCCEEeCCCCcCccCCCCC
Q 041016          617 KNSKRGLSSKSLAIYSLMDLSNNQLSGEIPSSLGSLKGLKSLNLSYNQLQGNIPSTFGNLEILETLDLSHNSLSGKIPQT  696 (757)
Q Consensus       617 ~~~~~~~~~~~~~~l~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~  696 (757)
                      ...........++.++.|||++|+++|.+|..|+++++|++|+|++|+++|.+|+.|+++++|++|||++|+++|.+|..
T Consensus       620 ~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~  699 (768)
T 3rgz_A          620 YGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQA  699 (768)
T ss_dssp             EEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGG
T ss_pred             ecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChH
Confidence            00000112234678999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCEEeCCCCcceecCCCCCCCCCCCCCccccCCCCCCCCCCCCCCCCCCC
Q 041016          697 FAKLQQLTSLYLSNNKLSGRIPESPQMDRQIDPVIYANNSGLCGMQIQVVCPEDVQ  752 (757)
Q Consensus       697 l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~~gn~~lc~~~l~~~c~~~~~  752 (757)
                      +..+++|++||+++|+++|.||+++||+++...+ |.|||+|||+|+. +|....+
T Consensus       700 l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~-~~gN~~Lcg~~l~-~C~~~~~  753 (768)
T 3rgz_A          700 MSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAK-FLNNPGLCGYPLP-RCDPSNA  753 (768)
T ss_dssp             GGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGG-GCSCTEEESTTSC-CCCSCC-
T ss_pred             HhCCCCCCEEECcCCcccccCCCchhhccCCHHH-hcCCchhcCCCCc-CCCCCcc
Confidence            9999999999999999999999999999999999 9999999999986 8976654



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 757
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-25
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-14
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-12
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-08
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-12
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-10
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-08
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 7e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 8e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score =  106 bits (264), Expect = 3e-25
 Identities = 82/384 (21%), Positives = 153/384 (39%), Gaps = 35/384 (9%)

Query: 205 NLTNLHKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANITILALSN 264
            L    K  L +   +  +  +   L ++ TL   R  +     + +  L N+T +  SN
Sbjct: 20  ALAEKMKTVLGKTNVTDTVSQT--DLDQVTTLQADRLGIKS--IDGVEYLNNLTQINFSN 75

Query: 265 NALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLKW------- 317
           N LT   P  ++N+TKLV + +++N ++              +L+               
Sbjct: 76  NQLTDITP--LKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTN 133

Query: 318 --------NDNVSIVPKCMLTELSLRSCSVRGSIPLWLSTQTELTFLDLSENELEGTYPQ 369
                   N    I     LT L   S   + +    L+  T L  LD+S N+       
Sbjct: 134 LNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNK-VSDISV 192

Query: 370 WLSELNLGTVILSDNMLTGSLPPPLFESRNLSVLVLSRNNFSGELPETIGQSTSVMVLML 429
                NL ++I ++N ++   P  +    NL  L L+ N        T+   T++  L L
Sbjct: 193 LAKLTNLESLIATNNQISDITPLGIL--TNLDELSLNGNQLKD--IGTLASLTNLTDLDL 248

Query: 430 SSNNFSGHVPKSISNIYRLLVLDLSNNSFSGEFPAFGSDSLVGHVDISSNRFSGEVPSSF 489
           ++N  S   P  +S + +L  L L  N  S         + + +++++ N+     P S 
Sbjct: 249 ANNQISNLAP--LSGLTKLTELKLGANQISN-ISPLAGLTALTNLELNENQLEDISPISN 305

Query: 490 GVTILMLSLSENKFSGQLPQNLSNLSLLQHLDLHDNNLTGEFPAFLSQLSSLQVLNLRNT 549
              +  L+L  N  S   P  +S+L+ LQ L   +N ++    + L+ L+++  L+  + 
Sbjct: 306 LKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHN 361

Query: 550 ALEGSITDGLSNLTSLQILDLSNN 573
            +       L+NLT +  L L++ 
Sbjct: 362 QISDLT--PLANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query757
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.39
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.71
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.19
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.87
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=3.3e-40  Score=341.32  Aligned_cols=274  Identities=30%  Similarity=0.479  Sum_probs=212.9

Q ss_pred             CCcHHHHHHHHHHHhhccCCCCCCCcccccCCCCCCCCCCCCCcc--cceeeeCCCCCcccEEEEEcCCCCCCCCccee-
Q 041016           24 CCPEDQKAALLEFKSLVLGDLADNSSADAMLGGLETWNSSSDCCR--WEMVRCRSRGPSQEVTGLDLNNLFPLDSIVTS-  100 (757)
Q Consensus        24 ~~~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~~~~w~~~~~~c~--w~gv~c~~~~~~~~v~~l~L~~~~~~~~~~~~-  100 (757)
                      -|.++||+||++||+++.   + +       ..+++|..++|||.  |.||+|+..+..+||++++|++.     .+.| 
T Consensus         2 ~c~~~e~~aLl~~k~~~~---~-~-------~~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~-----~l~g~   65 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLG---N-P-------TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL-----NLPKP   65 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT---C-C-------GGGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECC-----CCSSC
T ss_pred             CCCHHHHHHHHHHHHHCC---C-C-------CcCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCC-----CCCCC
Confidence            489999999999999987   3 2       24789998889994  99999998656679999999986     5555 


Q ss_pred             -eccccccCCCCCCEEeCCC-CCCCCCCCccccCCCCCCCEEeCCCCcCCCCcCccccCCCCCCEEEccCCcCCCccccc
Q 041016          101 -VVLAPIFRIRSLMTLDLSY-NSMQGEVPGTGFANLTRLTYLDLKDNNLNGSIPSQLFNLRYLEFLDLSANAIEGKLSSR  178 (757)
Q Consensus       101 -~~~~~l~~l~~L~~L~Ls~-n~l~~~i~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~  178 (757)
                       .+|+.++++++|++|+|++ |+++|.+| ..|+++++|++|+|++|++.+..+..+..+.+|+++++++|.+.+.+|..
T Consensus        66 ~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP-~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~  144 (313)
T d1ogqa_          66 YPIPSSLANLPYLNFLYIGGINNLVGPIP-PAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPS  144 (313)
T ss_dssp             EECCGGGGGCTTCSEEEEEEETTEESCCC-GGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGG
T ss_pred             CCCChHHhcCccccccccccccccccccc-cccccccccchhhhccccccccccccccchhhhcccccccccccccCchh
Confidence             5677888888888888875 77887888 67888888888888888888777777788888888888888877777777


Q ss_pred             ccCCCCCCEEEccCccCCccCchhccCCCCC-CEEEccccccccccCccccCCCCCCEEEccCCcCcccCcccccCCCCC
Q 041016          179 VAGLKNLKQLILDDNLIQGQIPAEIGNLTNL-HKLSLRQNKFSGGIPLSLLQLRKLETLDLQRNSLSGEIPEDIGTLANI  257 (757)
Q Consensus       179 ~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L-~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L  257 (757)
                      +.++++|+++++++|.+.+.+|..+..+.++ +.+++++|++++..|..+.++..+ .+++..+...+.+|..+..++++
T Consensus       145 l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l  223 (313)
T d1ogqa_         145 ISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNT  223 (313)
T ss_dssp             GGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCC
T ss_pred             hccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccc
Confidence            8888888888888888877777777777665 777788888877777777665444 67777777777777777777777


Q ss_pred             CEEEccCCCCCCccchhhhcCCCCCEEEccCCccccccchhhhccCCCcEEEccCCCCc
Q 041016          258 TILALSNNALTGAIPQSIRNMTKLVTLRLDSNVLSGEISTWLFDLQGMKSLYLGGNKLK  316 (757)
Q Consensus       258 ~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~  316 (757)
                      +.+++++|.+.+.++ .+..+++|+.|++++|+++|.+|.++.++++|++|+|++|+++
T Consensus       224 ~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~  281 (313)
T d1ogqa_         224 QKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC  281 (313)
T ss_dssp             SEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEE
T ss_pred             ccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCccc
Confidence            777777777775543 4666777777777777777777777777777777777776665



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure