Citrus Sinensis ID: 041088

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12

TSMFSIVRPCWISNLEPFNGMWHLSENVKLRGQFDVVVIAHKGKCANRLLGSSGLPQIARQMKRLELSSIWALLAAFEDPLPLGSASTFEGAFVKGVDSVSWMANNSAKLLNSQSDAPH

ccEEEEEccEEEEEEEEcccEEEEccccEEEccccEEEEEccHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHcccccccccccccccEEcccccEEEEEccccccccccccccc

ccEEEEEccEEEEcccccccEEEEccccccccEEEEEEEEcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEccccEEEEEccHHHcccccccccc

tsmfsivrpcwisnlepfngmwhlsenvklrgQFDVVVIAHKGkcanrllgssglPQIARQMKRLELSSIWALLAAfedplplgsastfegafvkgVDSVSWMANNSAKllnsqsdaph

tsmfsivrpcWISNLEPFNGMWHLSENVKLRGQFDVVVIAHKGKcanrllgssgLPQIARQMKRLELSSIWALLAAFEDPLPLGSASTFEGAFVKGVDSVSWMANNSakllnsqsdaph

TSMFSIVRPCWISNLEPFNGMWHLSENVKLRGQFDVVVIAHKGKCANRLLGSSGLPQIARQMKRLELSSIWALLAAFEDPLPLGSASTFEGAFVKGVDSVSWMANNSAKLLNSQSDAPH

***FSIVRPCWISNLEPFNGMWHLSENVKLRGQFDVVVIAHKGKCANRLLGSSGLPQIARQMKRLELSSIWALLAAFEDPLPLGSASTFEGAFVKGVDSVSWMA***************

TSMFSIVRPCWISNLEPFNGMWHLSENVKLRGQFDVVVIAHKGKCANRLLGSSGLPQIARQMKRLELSSIWALLAAFEDPLPLGSASTFEGAFVKGVDSVSWMANNSAKL*********

TSMFSIVRPCWISNLEPFNGMWHLSENVKLRGQFDVVVIAHKGKCANRLLGSSGLPQIARQMKRLELSSIWALLAAFEDPLPLGSASTFEGAFVKGVDSVSWMANNSAKLL********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

TSMFSIVRPCWISNLEPFNGMWHLSENVKLRGQFDVVVIAHKGKCANRLLGSSGLPQIARQMKRLELSSIWALLAAFEDPLPLGSASTFEGAFVKGVDSVSWMANNSAKLLNSQSDAPH

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		119
224130614		496	predicted protein [Populus trichocarpa]	1.0	0.239	0.766	7e-48
449443231		545	PREDICTED: uncharacterized protein LOC10	1.0	0.218	0.737	1e-46
449483109		536	PREDICTED: uncharacterized protein LOC10	1.0	0.222	0.737	1e-46
255580905		467	conserved hypothetical protein [Ricinus	0.991	0.252	0.783	2e-46
225463946		467	PREDICTED: uncharacterized protein LOC10	0.966	0.246	0.731	1e-45
296087896		518	unnamed protein product [Vitis vinifera]	0.966	0.222	0.731	2e-45
147823103		2691	hypothetical protein VITISV_000598 [Viti	0.966	0.042	0.739	2e-45
18396966		486	FAD/NAD(P)-binding oxidoreductase domain	0.966	0.236	0.705	2e-42
297828968		485	oxidoreductase [Arabidopsis lyrata subsp	0.957	0.235	0.705	3e-42
357116570		477	PREDICTED: uncharacterized protein LOC10	0.983	0.245	0.65	9e-41

>gi\|224130614\|ref\|XP_002328333.1\| predicted protein [Populus trichocarpa] gi\|222838048\|gb\|EEE76413.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  194 bits (492), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 92/120 (76%), Positives = 104/120 (86%), Gaps = 1/120 (0%)

Query: 1   TSMFSIVRPCWISNLEPFNGMWHLSENVKLRGQFDVVVIAHKGKCANRLLGSSGLPQIAR 60
           T M ++VRPCWIS LEPFNGMWHLSEN K  GQFD++VIAH GKCANRLL SSGLP IAR
Sbjct: 219 TCMVNVVRPCWISKLEPFNGMWHLSENGKPCGQFDIIVIAHNGKCANRLLASSGLPLIAR 278

Query: 61  QMKRLELSSIWALLAAFEDPLPLGSAST-FEGAFVKGVDSVSWMANNSAKLLNSQSDAPH 119
           QMK L LSSIWALLAAFEDPLP+ + +T FEGAFVKGVDS+SWM NNSAKLL S++++PH
Sbjct: 279 QMKTLGLSSIWALLAAFEDPLPIPTGATPFEGAFVKGVDSLSWMGNNSAKLLGSKTNSPH 338

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449443231\|ref\|XP_004139383.1\| PREDICTED: uncharacterized protein LOC101219713 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449483109\|ref\|XP_004156495.1\| PREDICTED: uncharacterized protein LOC101226129 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255580905\|ref\|XP_002531271.1\| conserved hypothetical protein [Ricinus communis] gi\|223529104\|gb\|EEF31084.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|225463946\|ref\|XP_002268010.1\| PREDICTED: uncharacterized protein LOC100241002 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296087896\|emb\|CBI35179.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147823103\|emb\|CAN66330.1\| hypothetical protein VITISV_000598 [Vitis vinifera]	Back alignment and taxonomy information

>gi|18396966|ref|NP_566235.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] gi|6175169|gb|AAF04895.1|AC011437_10 unknown protein [Arabidopsis thaliana] gi|15215628|gb|AAK91359.1| AT3g04650/F7O18_13 [Arabidopsis thaliana] gi|28416461|gb|AAO42761.1| At3g04650/F7O18_13 [Arabidopsis thaliana] gi|332640593|gb|AEE74114.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297828968\|ref\|XP_002882366.1\| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi\|297328206\|gb\|EFH58625.1\| oxidoreductase [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|357116570\|ref\|XP_003560053.1\| PREDICTED: uncharacterized protein LOC100824134 [Brachypodium distachyon]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		119
TAIR\|locus:2084903		486	AT3G04650 [Arabidopsis thalian	0.966	0.236	0.705	1.4e-41
UNIPROTKB\|Q4K6B1		328	PFL_5143 "FAD dependent oxidor	0.722	0.262	0.336	0.00011
UNIPROTKB\|Q48MT7		328	PSPPH_1014 "Uncharacterized pr	0.773	0.280	0.294	0.00062

TAIR\|locus:2084903 AT3G04650 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 441 (160.3 bits), Expect = 1.4e-41, P = 1.4e-41
 Identities = 84/119 (70%), Positives = 98/119 (82%)

Query:     1 TSMFSIVRPCWISNLEPFNGMWHLSENVKLRGQFDVVVIAHKGKCANRLLGSSGLPQIAR 60
             + M ++VRPCWIS LEP NGMWHLSEN   RGQFDV+VIAH GKCANRLL +SGLP +A+
Sbjct:   215 SQMVNLVRPCWISKLEPLNGMWHLSENGTPRGQFDVIVIAHNGKCANRLLSASGLPLVAK 274

Query:    61 QMKRLELSSIWALLAAFEDPLPLGSASTFEGAFVKGVDSVSWMANNSAKLLNSQSDAPH 119
             QMK+L+LSSIWALLAAF+DPLP      FEGAFVKGV+S+SWM NNSAKL N ++  PH
Sbjct:   275 QMKKLDLSSIWALLAAFDDPLP---TVNFEGAFVKGVESLSWMGNNSAKLGNGRTP-PH 329

GO:0005739 "mitochondrion" evidence=ISM

GO:0009507 "chloroplast" evidence=IDA

UNIPROTKB\|Q4K6B1 PFL_5143 "FAD dependent oxidoreductase" [Pseudomonas protegens Pf-5 (taxid:220664)]	Back alignment and assigned GO terms

UNIPROTKB\|Q48MT7 PSPPH_1014 "Uncharacterized protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pm.C_scaffold_70000013	hypothetical protein (496 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		119
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	99.86
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	99.45
TIGR03467		419	HpnE squalene-associated FAD-dependent desaturase.	99.36
PLN02576		496	protoporphyrinogen oxidase	99.28
PRK11883		451	protoporphyrinogen oxidase; Reviewed	99.13
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	99.04
PRK12416		463	protoporphyrinogen oxidase; Provisional	99.0
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	98.83
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	98.82
PRK07233		434	hypothetical protein; Provisional	98.81
PLN02612		567	phytoene desaturase	98.78
PLN02268		435	probable polyamine oxidase	98.74
PLN02328		808	lysine-specific histone demethylase 1 homolog	98.66
PLN02529		738	lysine-specific histone demethylase 1	98.61
COG2907		447	Predicted NAD/FAD-binding protein [General functio	98.58
PRK07208		479	hypothetical protein; Provisional	98.48
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	98.47
PLN02487		569	zeta-carotene desaturase	98.46
PLN02568		539	polyamine oxidase	98.34
PLN03000		881	amine oxidase	98.28
PLN02676		487	polyamine oxidase	98.14
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	98.08
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	98.06
PLN02976		1713	amine oxidase	97.75
KOG1276		491	consensus Protoporphyrinogen oxidase [Coenzyme tra	97.58
KOG0685		498	consensus Flavin-containing amine oxidase [Coenzym	97.48
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	97.31
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	97.3
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	96.95
KOG0029		501	consensus Amine oxidase [Secondary metabolites bio	96.24
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	96.16
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	96.04
PF07156		368	Prenylcys_lyase: Prenylcysteine lyase; InterPro: I	95.16
COG2081		408	Predicted flavoproteins [General function predicti	95.16
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	95.15
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	95.03
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	94.52
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	94.32
PRK09897		534	hypothetical protein; Provisional	94.22
PF00743		531	FMO-like: Flavin-binding monooxygenase-like; Inter	93.79
PRK07588		391	hypothetical protein; Provisional	93.25
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	93.16
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	92.85
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	92.84
PRK06847		375	hypothetical protein; Provisional	92.75
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	92.6
PRK11728		393	hydroxyglutarate oxidase; Provisional	92.19
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	92.18
PTZ00383		497	malate:quinone oxidoreductase; Provisional	91.86
PRK07236		386	hypothetical protein; Provisional	91.67
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	91.53
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	91.51
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	91.37
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	91.21
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	90.83
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	90.81
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	90.71
PRK06753		373	hypothetical protein; Provisional	90.7
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	90.64
PRK09126		392	hypothetical protein; Provisional	90.59
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	90.58
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	90.53
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	89.85
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	89.68
COG0579		429	Predicted dehydrogenase [General function predicti	89.66
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	89.52
PRK08163		396	salicylate hydroxylase; Provisional	89.47
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	89.47
PRK13339		497	malate:quinone oxidoreductase; Reviewed	89.46
PRK05868		372	hypothetical protein; Validated	89.22
PRK06116		450	glutathione reductase; Validated	89.06
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	88.97
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	88.51
TIGR00275		400	flavoprotein, HI0933 family. The model when search	88.4
PRK07846		451	mycothione reductase; Reviewed	87.91
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	87.65
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	87.35
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	87.24
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	87.0
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	86.99
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	86.98
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	86.81
PRK07845		466	flavoprotein disulfide reductase; Reviewed	86.55
PRK06834		488	hypothetical protein; Provisional	86.21
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	86.16
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	86.09
PLN02507		499	glutathione reductase	86.0
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	85.94
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	85.37
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	85.05
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	85.04
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	85.03
PRK11445		351	putative oxidoreductase; Provisional	84.89
PRK08013		400	oxidoreductase; Provisional	84.86
PRK05257		494	malate:quinone oxidoreductase; Validated	84.66
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	84.54
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	84.2
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	84.06
PRK07190		487	hypothetical protein; Provisional	83.81
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	83.72
PRK09564		444	coenzyme A disulfide reductase; Reviewed	83.64
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	83.56
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	83.05
KOG1399		448	consensus Flavin-containing monooxygenase [Seconda	82.81
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	82.67
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	82.55
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	82.53
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	81.98
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	81.91
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	81.62
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	81.18
PRK14727		479	putative mercuric reductase; Provisional	80.91
PRK14694		468	putative mercuric reductase; Provisional	80.66
PRK07045		388	putative monooxygenase; Reviewed	80.65
PRK13512		438	coenzyme A disulfide reductase; Provisional	80.58
PRK06475		400	salicylate hydroxylase; Provisional	80.57
PRK06184		502	hypothetical protein; Provisional	80.44
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	80.38
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	80.33
PRK10157		428	putative oxidoreductase FixC; Provisional	80.25
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	80.1

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

Probab=99.86  E-value=1.3e-22  Score=150.37  Aligned_cols=108  Identities=19%  Similarity=0.382  Sum_probs=96.0

Q ss_pred             ceeEEcCceeEEEEecCCeEEEEeCCc-cccccCEEEEcCCHHHHHhhcCC----CCCHHHHHHhhcCCccceEEEEEee
Q 041088            3 MFSIVRPCWISNLEPFNGMWHLSENVK-LRGQFDVVVIAHKGKCANRLLGS----SGLPQIARQMKRLELSSIWALLAAF   77 (119)
Q Consensus         3 ~~~i~~~~~V~~i~~~~~~w~l~~~~g-~~~~~D~VIlA~Pa~qaa~LL~~----~~~~~~a~~l~~i~~~p~~~v~l~~   77 (119)
                      .++|.++++|++|.+.++.|+|..++| ....||.||+|.|+||++.||..    .. .++.+.+..+.|.|||+++|+|
T Consensus       117 dL~V~~~~rVt~v~~~~~~W~l~~~~g~~~~~~d~vvla~PAPQ~~~LLt~~~~~~p-~~l~~~~a~V~y~Pc~s~~lg~  195 (331)
T COG3380         117 DLTVVLETRVTEVARTDNDWTLHTDDGTRHTQFDDVVLAIPAPQTATLLTTDADDLP-AALRAALADVVYAPCWSAVLGY  195 (331)
T ss_pred             cchhhhhhhhhhheecCCeeEEEecCCCcccccceEEEecCCCcchhhcCcccccch-HHHHHhhccceehhHHHHHhcC
Confidence            578999999999999999999998655 66689999999999999999954    23 4688899999999999999999


Q ss_pred             cCCCCCCCCCceeeEEECCCCcEEEEEecCCCCCCCCCC
Q 041088           78 EDPLPLGSASTFEGAFVKGVDSVSWMANNSAKLLNSQSD  116 (119)
Q Consensus        78 ~~~~~~p~~~~~~~~~~~~~~~~~wv~~~s~Kp~~~~~~  116 (119)
                      ++++..|    ++|.++.++ +|.|++||.+|+||..-+
T Consensus       196 ~q~l~~P----~~G~~vdg~-~laWla~d~sK~g~~p~~  229 (331)
T COG3380         196 PQPLDRP----WPGNFVDGH-PLAWLARDASKKGHVPDG  229 (331)
T ss_pred             CccCCCC----CCCcccCCC-eeeeeeccccCCCCCCcC
Confidence            9999999    999877776 999999999999998654

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>TIGR03467 HpnE squalene-associated FAD-dependent desaturase	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>PLN02612 phytoene desaturase	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>COG2907 Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes []	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		119
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	99.76
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	99.55
3nks_A		477	Protoporphyrinogen oxidase; FAD containing protein	99.28
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	99.06
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	99.04
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	99.04
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	98.96
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	98.94
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	98.91
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	98.9
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	98.88
4dsg_A		484	UDP-galactopyranose mutase; rossmann fold, flavin	98.88
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	98.82
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	98.64
2iid_A		498	L-amino-acid oxidase; flavoenzyme, FAD binding dom	98.62
1rsg_A		516	FMS1 protein; FAD binding motif, oxidoreductase; H	98.6
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	98.55
4gut_A		776	Lysine-specific histone demethylase 1B; histone de	98.49
2xag_A		852	Lysine-specific histone demethylase 1; amine oxida	98.45
1sez_A		504	Protoporphyrinogen oxidase, mitochondrial; FAD-bin	98.4
4gde_A		513	UDP-galactopyranose mutase; flavin adenine dinucle	98.35
2b9w_A		424	Putative aminooxidase; isomerase, conjugated linol	98.2
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	98.2
4dgk_A		501	Phytoene dehydrogenase; the FAD/NAD(P)-binding ros	98.09
3ayj_A		721	Pro-enzyme of L-phenylalanine oxidase; amino acid	96.92
1i8t_A		367	UDP-galactopyranose mutase; rossman fold, FAD, con	96.91
2bi7_A		384	UDP-galactopyranose mutase; FAD, flavoprotein, iso	96.51
1v0j_A		399	UDP-galactopyranose mutase; flavoprotein, isomeras	96.49
3ps9_A		676	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	95.75
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	95.69
3nyc_A		381	D-arginine dehydrogenase; FAD, imino-arginine, oxi	95.55
1ryi_A		382	Glycine oxidase; flavoprotein, protein-inhibitor c	95.41
3dje_A		438	Fructosyl amine: oxygen oxidoreductase; fructosyl-	95.36
2gf3_A		389	MSOX, monomeric sarcosine oxidase; flavoprotein ox	95.2
3v76_A		417	Flavoprotein; structural genomics, PSI-biology, NE	95.12
3dme_A		369	Conserved exported protein; structural genomics, P	95.03
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	94.86
2e1m_B		130	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	94.85
2uzz_A		372	N-methyl-L-tryptophan oxidase; N-methyltryptophan	94.67
2gv8_A		447	Monooxygenase; FMO, FAD, NADPH, cofactor complex,	94.46
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	94.4
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	94.23
2ywl_A		180	Thioredoxin reductase related protein; uncharacter	94.2
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	94.16
1y56_B		382	Sarcosine oxidase; dehydrogenase, protein-protein	94.15
2i0z_A		447	NAD(FAD)-utilizing dehydrogenases; structural geno	94.11
2xdo_A		398	TETX2 protein; tetracycline degradation, tigecycli	94.06
1d5t_A		433	Guanine nucleotide dissociation inhibitor; ultra-h	94.0
2oln_A		397	NIKD protein; flavoprotein, rossmann fold, oxidore	93.85
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	93.83
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	93.77
2x3n_A		399	Probable FAD-dependent monooxygenase; oxidoreducta	93.7
2gqf_A		401	Hypothetical protein HI0933; structural genomics,	93.65
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	93.5
2v3a_A		384	Rubredoxin reductase; alkane degradation, NADH oxi	93.17
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	93.05
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	92.82
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	92.68
3axb_A		448	Putative oxidoreductase; dinucleotide-binding fold	92.67
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	92.66
3hdq_A		397	UDP-galactopyranose mutase; substrate and inhibito	92.6
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	92.38
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	92.32
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	92.21
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	91.89
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	91.88
1w4x_A		542	Phenylacetone monooxygenase; baeyer-villiger, FAD;	91.85
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	91.6
2gag_B		405	Heterotetrameric sarcosine oxidase beta-subunit; f	91.6
2xve_A		464	Flavin-containing monooxygenase; oxidoreductase; H	91.54
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	91.52
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	91.47
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	91.44
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	91.4
3klj_A		385	NAD(FAD)-dependent dehydrogenase, NIRB-family (N-	91.28
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	91.26
3nlc_A		549	Uncharacterized protein VP0956; FAD-binding protei	90.98
1m6i_A		493	Programmed cell death protein 8; apoptosis, AIF, o	90.96
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	90.86
2bcg_G		453	Secretory pathway GDP dissociation inhibitor; RABG	90.73
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	90.68
3fg2_P		404	Putative rubredoxin reductase; ferredoxin reductas	90.58
3p1w_A		475	Rabgdi protein; GDI RAB, malaria, structural genom	90.37
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	90.25
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	90.07
1fec_A		490	Trypanothione reductase; redox-active center, oxid	89.8
4dna_A		463	Probable glutathione reductase; structural genomic	89.12
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	89.02
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	88.83
1ojt_A		482	Surface protein; redox-active center, glycolysis,	88.75
2cul_A		232	Glucose-inhibited division protein A-related PROT	88.68
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	88.57
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	88.55
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	88.25
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	88.18
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	88.07
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	88.04
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	87.92
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	87.77
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	87.68
1pj5_A		830	N,N-dimethylglycine oxidase; channelling, FAD bind	87.05
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	86.78
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	86.74
2qa2_A		499	CABE, polyketide oxygenase CABE; FAD, angucycline,	86.65
3vrd_B		401	FCCB subunit, flavocytochrome C flavin subunit; su	86.63
2qa1_A		500	PGAE, polyketide oxygenase PGAE; FAD, angucycline,	86.6
3c4n_A		405	Uncharacterized protein DR_0571; alpha-beta protei	86.48
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	86.46
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	86.31
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	86.27
1k0i_A		394	P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h	86.22
3ic9_A		492	Dihydrolipoamide dehydrogenase; APC62701, colwelli	86.17
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	86.06
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	85.81
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	85.81
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	85.39
3fmw_A		570	Oxygenase; mithramycin, baeyer-villiger, flavin bi	85.38
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	85.3
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	85.16
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	85.12
3ihg_A		535	RDME; flavoenzyme, anthracycline, polyketide biosy	85.09
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	85.01
2qcu_A		501	Aerobic glycerol-3-phosphate dehydrogenase; glycer	84.98
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	84.98
3l8k_A		466	Dihydrolipoyl dehydrogenase; redox-active center,	84.71
3cgb_A		480	Pyridine nucleotide-disulfide oxidoreductase, CLA;	84.66
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	84.61
4hb9_A		412	Similarities with probable monooxygenase; flavin,	84.26
3c96_A		410	Flavin-containing monooxygenase; FAD, oxidoreducta	84.26
2bc0_A		490	NADH oxidase; flavoprotein, pyridine nucleotide di	83.83
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	83.32
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	83.3
3h8l_A		409	NADH oxidase; membrane protein, complete form, ros	83.27
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	83.21
2e4g_A		550	Tryptophan halogenase; flavin-binding, rebeccamyci	83.21
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	83.16
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	83.12
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	82.99
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	82.95
4b1b_A		542	TRXR, thioredoxin reductase; oxidoreductase, FAD,	82.8
1y56_A		493	Hypothetical protein PH1363; dehydrogenase, protei	82.77
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	82.64
1n4w_A		504	CHOD, cholesterol oxidase; flavoenzyme, steroid me	82.42
2bry_A		497	NEDD9 interacting protein with calponin homology a	82.41
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	82.4
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	82.38
1coy_A		507	Cholesterol oxidase; oxidoreductase(oxygen recepto	82.25
3atr_A		453	Conserved archaeal protein; saturating double bond	82.18
2weu_A		511	Tryptophan 5-halogenase; regioselectivity, antifun	81.84
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	81.83
1qo8_A		566	Flavocytochrome C3 fumarate reductase; oxidoreduct	81.77
1y0p_A		571	Fumarate reductase flavoprotein subunit; flavocyto	81.69
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	81.68
3r9u_A		315	Thioredoxin reductase; structural genomics, center	81.58
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	81.28
3t37_A		526	Probable dehydrogenase; BET alpha beta fold, ADP b	81.25
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	81.24
1m6i_A		493	Programmed cell death protein 8; apoptosis, AIF, o	80.99
1d4d_A		572	Flavocytochrome C fumarate reductase; oxidoreducta	80.39
2rgh_A		571	Alpha-glycerophosphate oxidase; flavoprotein oxida	80.26
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	80.23
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	80.17

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens}	Back alignment and structure

Probab=99.76  E-value=2.2e-18  Score=129.01  Aligned_cols=108  Identities=15%  Similarity=0.210  Sum_probs=91.1

Q ss_pred             ceeEEcCceeEEEEecCCeEEEEeCCccccccCEEEEcCCHHHHHhhcCCCC---CHHHHHHhhcCCccceEEEEEeecC
Q 041088            3 MFSIVRPCWISNLEPFNGMWHLSENVKLRGQFDVVVIAHKGKCANRLLGSSG---LPQIARQMKRLELSSIWALLAAFED   79 (119)
Q Consensus         3 ~~~i~~~~~V~~i~~~~~~w~l~~~~g~~~~~D~VIlA~Pa~qaa~LL~~~~---~~~~a~~l~~i~~~p~~~v~l~~~~   79 (119)
                      .++|+++++|++|++++++|+|.+++|....||.||+|+|++++++||....   .+...+.|++++|.|+++|+|.|++
T Consensus       123 g~~i~~~~~V~~i~~~~~~~~v~~~~g~~~~ad~vV~A~p~~~~~~ll~~~~~~l~~~~~~~l~~~~~~~~~~v~l~~~~  202 (342)
T 3qj4_A          123 GAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEA  202 (342)
T ss_dssp             TCEEESSCCEEEEEECSSSEEEEESSSCCEEESEEEECSCHHHHTTCBSTHHHHSCHHHHHHHHTCCBCCEEEEEEECSS
T ss_pred             CCEEEeCCEEEEEEEcCCEEEEEECCCCEEEcCEEEECCCHHHHHHHhcccccccCHHHHHHHhcCCccccEEEEEEECC
Confidence            3689999999999999999999987775456999999999999999997532   0356788999999999999999997


Q ss_pred             C--CCCCCCCceeeEEECCCCcEEEEEecCCCCCCCC
Q 041088           80 P--LPLGSASTFEGAFVKGVDSVSWMANNSAKLLNSQ  114 (119)
Q Consensus        80 ~--~~~p~~~~~~~~~~~~~~~~~wv~~~s~Kp~~~~  114 (119)
                      +  ...|    +.|+.+.+++.++|++++++||+|..
T Consensus       203 ~~~~~~~----~~g~~~~~~~~~~~~~~~~~k~~r~~  235 (342)
T 3qj4_A          203 GTKIDVP----WAGQYITSNPCIRFVSIDNKKRNIES  235 (342)
T ss_dssp             CC--CCS----CSEEECSSCSSEEEEEEHHHHTTCCC
T ss_pred             CCccCCc----eeeEEccCCcceEEEEccccCCCCCC
Confidence            6  3466    88988877657999999999999763

PyMOL of 3qj4

>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens}	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G*	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum}	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis}	Back alignment and structure

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei}	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A*	Back alignment and structure

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ...	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A*	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A*	Back alignment and structure

>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A*	Back alignment and structure

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus}	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A*	Back alignment and structure

>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A*	Back alignment and structure

>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A*	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A	Back alignment and structure

>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A*	Back alignment and structure

>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A	Back alignment and structure

>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5	Back alignment and structure

>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A*	Back alignment and structure

>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A*	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A*	Back alignment and structure

>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis}	Back alignment and structure

>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A*	Back alignment and structure

>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7	Back alignment and structure

>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A*	Back alignment and structure

>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis}	Back alignment and structure

>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A*	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A*	Back alignment and structure

>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A*	Back alignment and structure

>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A*	Back alignment and structure

>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A*	Back alignment and structure

>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti}	Back alignment and structure

>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis}	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia}	Back alignment and structure

>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli}	Back alignment and structure

>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A*	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A*	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2	Back alignment and structure

>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A*	Back alignment and structure

>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A	Back alignment and structure

>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A*	Back alignment and structure

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A*	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa}	Back alignment and structure

>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A*	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A*	Back alignment and structure

>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A*	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A*	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A*	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B*	Back alignment and structure

>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A*	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A*	Back alignment and structure

>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus}	Back alignment and structure

>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A*	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris}	Back alignment and structure

>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7}	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A*	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A*	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A*	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii}	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A*	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces}	Back alignment and structure

>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A*	Back alignment and structure

>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces}	Back alignment and structure

>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1}	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ...	Back alignment and structure

>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea}	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A*	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus}	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens}	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A*	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens}	Back alignment and structure

>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A*	Back alignment and structure

>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A*	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A*	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus}	Back alignment and structure

>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum}	Back alignment and structure

>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A*	Back alignment and structure

>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A*	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A*	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A*	Back alignment and structure

>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A*	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1	Back alignment and structure

>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A*	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti}	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A*	Back alignment and structure

>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A*	Back alignment and structure

>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A*	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		119
d2ivda1		347	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	98.67
d2v5za1		383	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	97.69
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	97.63
d1m6ia2		137	Apoptosis-inducing factor (AIF) {Human (Homo sapie	96.61
d2gf3a1		281	Sarcosine oxidase {Bacillus sp., strain b0618 [Tax	96.45
d2gv8a1		335	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	96.44
d1aoga2		117	Trypanothione reductase {Trypanosoma cruzi [TaxId:	96.27
d1gesa2		116	Glutathione reductase {Escherichia coli [TaxId: 56	96.22
d1feca2		117	Trypanothione reductase {Crithidia fasciculata [Ta	96.01
d1ryia1		276	Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	95.95
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	95.85
d2i0za1		251	Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]	95.78
d1b5qa1		347	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	95.74
d1onfa2		117	Glutathione reductase {Plasmodium falciparum [TaxI	95.7
d1d5ta1		336	Guanine nucleotide dissociation inhibitor, GDI {Co	95.51
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	95.48
d2bcgg1		297	Guanine nucleotide dissociation inhibitor, GDI {Ba	95.31
d1pj5a2		305	N,N-dimethylglycine oxidase {Arthrobacter globifor	95.07
d1w4xa1		298	Phenylacetone monooxygenase {Thermobifida fusca [T	94.96
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	94.37
d1q1ra2		133	Putidaredoxin reductase {Pseudomonas putida [TaxId	94.19
d1m6ia1		213	Apoptosis-inducing factor (AIF) {Human (Homo sapie	94.08
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	94.01
d1mo9a2		121	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	93.96
d1ojta2		125	Dihydrolipoamide dehydrogenase {Neisseria meningit	92.94
d2gqfa1		253	Hypothetical protein HI0933 {Haemophilus influenza	92.79
d1nhpa2		123	NADH peroxidase {Enterococcus faecalis [TaxId: 135	92.56
d2voua1		265	Dihydroxypyridine hydroxylase DhpH {Arthrobacter n	92.48
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	92.36
d3coxa1		370	Cholesterol oxidase of GMC family {Brevibacterium	92.16
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	92.07
d1lvla2		115	Dihydrolipoamide dehydrogenase {Pseudomonas putida	91.08
d1n4wa1		367	Cholesterol oxidase of GMC family {Streptomyces sp	91.07
d1nhpa1		198	NADH peroxidase {Enterococcus faecalis [TaxId: 135	85.85
d1ps9a2		162	2,4-dienoyl-CoA reductase, C-terminal domain {Esch	85.44
d1cf3a1		385	Glucose oxidase {Aspergillus niger [TaxId: 5061]}	84.11
d1d7ya1		183	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	82.67
d1h6va2		122	Mammalian thioredoxin reductase {Rat (Rattus norve	81.55

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Protoporphyrinogen oxidase
species: Myxococcus xanthus [TaxId: 34]

Probab=98.67  E-value=2e-08  Score=69.21  Aligned_cols=67  Identities=15%  Similarity=0.092  Sum_probs=52.9

Q ss_pred             eeEEcCceeEEEEecCCeEEEEe-CCc--cccccCEEEEcCCHHHHHhhcCCCCCHHHHHHhhcCCccceE
Q 041088            4 FSIVRPCWISNLEPFNGMWHLSE-NVK--LRGQFDVVVIAHKGKCANRLLGSSGLPQIARQMKRLELSSIW   71 (119)
Q Consensus         4 ~~i~~~~~V~~i~~~~~~w~l~~-~~g--~~~~~D~VIlA~Pa~qaa~LL~~~~~~~~a~~l~~i~~~p~~   71 (119)
                      ++|++|++|++|+.++++|.+.. ++|  ....||.||+|+|++++++||++.. +.+.+.+.++.+.+..
T Consensus       234 ~~i~~~~~V~~I~~~~~~~~v~~~~~~~~~~~~ad~VV~a~p~~~~~~Ll~~~~-~~~~~~~~~~~~~~~~  303 (347)
T d2ivda1         234 DAAHVGARVEGLAREDGGWRLIIEEHGRRAELSVAQVVLAAPAHATAKLLRPLD-DALAALVAGIYNLGHL  303 (347)
T ss_dssp             GGEESSEEEEEEECC--CCEEEEEETTEEEEEECSEEEECSCHHHHHHHHTTTC-HHHHHHHHTCCBTTHH
T ss_pred             cccccCCEEEEEEEeCCeEEEEEEcCCeEEEEECCEEEECCCHHHHHHhccCCC-HHHHHHhhcceecCcc
Confidence            57999999999999999888764 222  3456999999999999999999988 8888888877665543

PyMOL of d2ivda1

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}	Back information, alignment and structure

>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}	Back information, alignment and structure

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}	Back information, alignment and structure

>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure