Citrus Sinensis ID: 041173

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MSDPRVFQGSICQKYPQFCTTAENDASHGCSIQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEGACEGSLACSTCHVIKITWPELDGVRLAFPAATRDFAVDGYVPKPH
cccccccccHHHHcccccccccccccccccccccccEEEEEEcccccEEEEEEcccccHHHHHHHccccccccccccccccccEEEEcccccccccccccHHHHHHHHccccccccc
cccccccHcccccccccccccccccccccccccccEEEEEEEcccccEEEEEEccccEHHHHHHHccccccccccccccccccEEEEEEccccccEEEEcccccccEEEcccccccc
msdprvfqgsicqkypqfcttaendashgcsiqkdmvnvtfsdkdgeeknikvpVGMSMLEAVHEndielegacegslacstchvikitwpeldgvrlafpaatrdfavdgyvpkph
MSDPRVFQGSICQKYPQFCTTAENDASHGCSIQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEGACEGSLACSTCHVIKITWPELDGVRLAFPAATRDFAVDGYVPKPH
MSDPRVFQGSICQKYPQFCTTAENDASHGCSIQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEGACEGSLACSTCHVIKITWPELDGVRLAFPAATRDFAVDGYVPKPH
******FQGSICQKYPQFCTTAENDASHGCSIQKDMVNVTF*********IKVPVGMSMLEAVHENDIELEGACEGSLACSTCHVIKITWPELDGVRLAFPAATRDFAVDGYV****
**************************************VTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEGACEGSLACSTCHVIKITWPELDGVRLAFPAATRDFAVDG******
********GSICQKYPQFCTTAENDASHGCSIQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEGACEGSLACSTCHVIKITWPELDGVRLAFPAATRDFAVDGYVPKPH
*********************************KDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEGACEGSLACSTCHVIKITWPELDGVRLAFPAATRDFAVDGY*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDPRVFQGSICQKYPQFCTTAENDASHGCSIQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEGACEGSLACSTCHVIKITWPELDGVRLAFPAATRDFAVDGYVPKPH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query117 2.2.26 [Sep-21-2011]
Q9CPW2174 Adrenodoxin-like protein, yes no 0.957 0.643 0.320 2e-15
Q08C57195 Adrenodoxin-like protein, yes no 0.726 0.435 0.375 2e-15
Q9AKH1112 2Fe-2S ferredoxin OS=Rick yes no 0.623 0.651 0.398 4e-15
Q4UKL2112 2Fe-2S ferredoxin OS=Rick yes no 0.623 0.651 0.388 7e-15
Q9AKM6112 2Fe-2S ferredoxin OS=Rick yes no 0.623 0.651 0.388 7e-15
Q92J08112 2Fe-2S ferredoxin OS=Rick yes no 0.623 0.651 0.388 1e-14
Q9AKC4117 2Fe-2S ferredoxin OS=Rick yes no 0.649 0.649 0.360 5e-14
Q5FWQ0193 Adrenodoxin-like protein, N/A no 0.863 0.523 0.350 1e-13
P37193172 Adrenodoxin-like protein, yes no 0.709 0.482 0.355 1e-13
Q9ZDW6112 2Fe-2S ferredoxin OS=Rick yes no 0.623 0.651 0.361 3e-13
>sp|Q9CPW2|ADXL_MOUSE Adrenodoxin-like protein, mitochondrial OS=Mus musculus GN=Fdx1l PE=2 SV=1 Back     alignment and function desciption
 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 71/153 (46%), Gaps = 41/153 (26%)

Query: 4   PRVFQGSICQKYPQFCTTAEN----DASHGCSIQKDMVNVTFSDKDGEEKNIKVPVGMSM 59
           PR    ++  +   F TT E     +A+    + +D+VNV F D+ G+   ++  VG ++
Sbjct: 24  PRAGHAAVTSR--TFGTTGERRAGEEAADSPELPRDVVNVVFVDRSGKRIPVRGKVGDNV 81

Query: 60  LEAVHENDIELEGACEGSLACSTCHVIK-------------------------------- 87
           L     + ++LEGACE SLACSTCHV                                  
Sbjct: 82  LYLAQRHGVDLEGACEASLACSTCHVYVSEAHLDLLPPPEEREDDMLDMAPLLQENSRLG 141

Query: 88  ---ITWPELDGVRLAFPAATRDFAVDGYVPKPH 117
              +  PEL+GV  A P  TR+F VDG++PKPH
Sbjct: 142 CQIVLTPELEGVEFALPKITRNFYVDGHIPKPH 174

Mus musculus (taxid: 10090)
>sp|Q08C57|ADXL_DANRE Adrenodoxin-like protein, mitochondrial OS=Danio rerio GN=fdx1l PE=2 SV=1 Back     alignment and function description
>sp|Q9AKH1|FER2_RICRI 2Fe-2S ferredoxin OS=Rickettsia rickettsii GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q4UKL2|FER2_RICFE 2Fe-2S ferredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montana GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q92J08|FER2_RICCN 2Fe-2S ferredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q9AKC4|FER2_RICTY 2Fe-2S ferredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q5FWQ0|ADXL_XENLA Adrenodoxin-like protein, mitochondrial OS=Xenopus laevis GN=fdx1l PE=2 SV=1 Back     alignment and function description
>sp|P37193|ADXH_DROME Adrenodoxin-like protein, mitochondrial OS=Drosophila melanogaster GN=Fdxh PE=2 SV=3 Back     alignment and function description
>sp|Q9ZDW6|FER2_RICPR 2Fe-2S ferredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=fdxB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
224072725198 predicted protein [Populus trichocarpa] 0.940 0.555 0.554 2e-33
388507328201 unknown [Lotus japonicus] 0.957 0.557 0.536 2e-33
255550341199 adrenodoxin, putative [Ricinus communis] 0.940 0.552 0.547 3e-33
356564716198 PREDICTED: 2Fe-2S ferredoxin-like [Glyci 0.965 0.570 0.503 1e-32
225444625198 PREDICTED: 2Fe-2S ferredoxin [Vitis vini 0.991 0.585 0.486 7e-32
357480231204 2Fe-2S ferredoxin [Medicago truncatula] 0.957 0.549 0.506 8e-32
224115868198 predicted protein [Populus trichocarpa] 0.948 0.560 0.537 2e-31
356547972199 PREDICTED: 2Fe-2S ferredoxin-like [Glyci 0.965 0.567 0.510 4e-31
356528054133 PREDICTED: 2Fe-2S ferredoxin-like [Glyci 0.803 0.706 0.561 7e-31
30685302197 ferredoxin 2 [Arabidopsis thaliana] gi|3 0.957 0.568 0.489 9e-30
>gi|224072725|ref|XP_002303851.1| predicted protein [Populus trichocarpa] gi|222841283|gb|EEE78830.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 91/146 (62%), Gaps = 36/146 (24%)

Query: 8   QGSICQKYPQFCTTAENDASHGCSIQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHEND 67
           QGSI QK+ QF +TA +  S   S   +M++VTF DKDGEEK+IKVPVGMSMLEA  END
Sbjct: 53  QGSIFQKHHQFSSTATSRDSADGSDPNEMISVTFVDKDGEEKDIKVPVGMSMLEAAQEND 112

Query: 68  IELEGACEGSLACSTCHVI------------------------------------KITWP 91
           IELEGACEGSLACSTCHVI                                     I  P
Sbjct: 113 IELEGACEGSLACSTCHVIVTDMEYYNKLEDPTDEENDMLDLAFGLTETSRLGCQVIAKP 172

Query: 92  ELDGVRLAFPAATRDFAVDGYVPKPH 117
           EL+G+RLA PAATR+FAVDGYVPKPH
Sbjct: 173 ELNGMRLALPAATRNFAVDGYVPKPH 198

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388507328|gb|AFK41730.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255550341|ref|XP_002516221.1| adrenodoxin, putative [Ricinus communis] gi|223544707|gb|EEF46223.1| adrenodoxin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356564716|ref|XP_003550595.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] Back     alignment and taxonomy information
>gi|225444625|ref|XP_002275665.1| PREDICTED: 2Fe-2S ferredoxin [Vitis vinifera] gi|297738516|emb|CBI27761.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357480231|ref|XP_003610401.1| 2Fe-2S ferredoxin [Medicago truncatula] gi|355511456|gb|AES92598.1| 2Fe-2S ferredoxin [Medicago truncatula] Back     alignment and taxonomy information
>gi|224115868|ref|XP_002332077.1| predicted protein [Populus trichocarpa] gi|222831963|gb|EEE70440.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356547972|ref|XP_003542378.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] Back     alignment and taxonomy information
>gi|356528054|ref|XP_003532620.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] Back     alignment and taxonomy information
>gi|30685302|ref|NP_193841.2| ferredoxin 2 [Arabidopsis thaliana] gi|30685306|ref|NP_849415.1| ferredoxin 2 [Arabidopsis thaliana] gi|79325201|ref|NP_001031685.1| ferredoxin 2 [Arabidopsis thaliana] gi|19698259|dbj|BAB86773.1| MFDX2 precursor [Arabidopsis thaliana] gi|28192429|gb|AAL82812.1| adrenodoxin-like ferredoxin 1 [Arabidopsis thaliana] gi|28466923|gb|AAO44070.1| At4g21090 [Arabidopsis thaliana] gi|110743957|dbj|BAE99811.1| mitochondrial ferredoxin [Arabidopsis thaliana] gi|222424373|dbj|BAH20142.1| AT4G21090 [Arabidopsis thaliana] gi|332658998|gb|AEE84398.1| ferredoxin 2 [Arabidopsis thaliana] gi|332658999|gb|AEE84399.1| ferredoxin 2 [Arabidopsis thaliana] gi|332659000|gb|AEE84400.1| ferredoxin 2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
TAIR|locus:2127358197 MFDX2 "MITOCHONDRIAL FERREDOXI 0.692 0.411 0.597 2.4e-21
MGI|MGI:1915415174 Fdx1l "ferredoxin 1-like" [Mus 0.683 0.459 0.372 7.3e-20
WB|WBGene00013532169 Y73F8A.27 [Caenorhabditis eleg 0.452 0.313 0.509 1.2e-19
RGD|1561264174 Fdx1l "ferredoxin 1-like" [Rat 0.547 0.367 0.421 3.9e-19
TAIR|locus:2115939197 MFDX1 "mitochondrial ferredoxi 0.615 0.365 0.575 5.1e-19
DICTYBASE|DDB_G0267486159 DDB_G0267486 "2Fe-2S type ferr 0.470 0.345 0.527 2.7e-18
UNIPROTKB|Q6P4F2183 FDX1L "Adrenodoxin-like protei 0.529 0.338 0.460 2.7e-18
FB|FBgn0011769172 Fdxh "Ferredoxin" [Drosophila 0.435 0.296 0.509 4.3e-18
UNIPROTKB|E2RM76186 FDX1L "Uncharacterized protein 0.435 0.274 0.509 4.3e-18
UNIPROTKB|F1S3K4186 LOC100526209 "Uncharacterized 0.435 0.274 0.490 7e-18
TAIR|locus:2127358 MFDX2 "MITOCHONDRIAL FERREDOXIN 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 250 (93.1 bits), Expect = 2.4e-21, P = 2.4e-21
 Identities = 49/82 (59%), Positives = 61/82 (74%)

Query:     5 RVFQGSICQKYPQFCTTAENDASHGCSIQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVH 64
             R F+ ++     +FCT+    +  G   + + +NVTF DKDGEE +IKVPVGM++LEA H
Sbjct:    50 RSFKEALFSNNHKFCTSFSTTSEKGGE-KTEKINVTFVDKDGEEIHIKVPVGMNILEAAH 108

Query:    65 ENDIELEGACEGSLACSTCHVI 86
             ENDIELEGACEGSLACSTCHVI
Sbjct:   109 ENDIELEGACEGSLACSTCHVI 130
GO:0005739 "mitochondrion" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA;ISS
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
MGI|MGI:1915415 Fdx1l "ferredoxin 1-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00013532 Y73F8A.27 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|1561264 Fdx1l "ferredoxin 1-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2115939 MFDX1 "mitochondrial ferredoxin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267486 DDB_G0267486 "2Fe-2S type ferredoxin" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P4F2 FDX1L "Adrenodoxin-like protein, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0011769 Fdxh "Ferredoxin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2RM76 FDX1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3K4 LOC100526209 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
PLN02593117 PLN02593, PLN02593, adrenodoxin-like ferredoxin pr 4e-42
TIGR02007110 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC s 7e-09
PTZ00490143 PTZ00490, PTZ00490, Ferredoxin superfamily; Provis 9e-09
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 8e-08
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 3e-05
TIGR01941 405 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, N 0.001
PRK05464 409 PRK05464, PRK05464, Na(+)-translocating NADH-quino 0.003
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 0.004
>gnl|CDD|178203 PLN02593, PLN02593, adrenodoxin-like ferredoxin protein Back     alignment and domain information 
 Score =  134 bits (338), Expect = 4e-42
 Identities = 65/117 (55%), Positives = 73/117 (62%), Gaps = 36/117 (30%)

Query: 37  VNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEGACEGSLACSTCHVI---------- 86
           ++VTF DKDGEE+ +K PVGMS+LEA HENDIELEGACEGSLACSTCHVI          
Sbjct: 1   ISVTFVDKDGEERTVKAPVGMSLLEAAHENDIELEGACEGSLACSTCHVIVMDEKVYNKL 60

Query: 87  --------------------------KITWPELDGVRLAFPAATRDFAVDGYVPKPH 117
                                      I  PELDG+RLA PAATR+FAVDG+VPKPH
Sbjct: 61  PEPTDEENDMLDLAFGLTETSRLGCQVIAKPELDGMRLALPAATRNFAVDGHVPKPH 117

Length = 117
>gnl|CDD|131062 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>gnl|CDD|185668 PTZ00490, PTZ00490, Ferredoxin superfamily; Provisional Back     alignment and domain information
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|130996 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>gnl|CDD|235481 PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 117
KOG3309159 consensus Ferredoxin [Energy production and conver 99.95
PLN02593117 adrenodoxin-like ferredoxin protein 99.89
PTZ00490143 Ferredoxin superfamily; Provisional 99.77
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.49
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.44
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.41
CHL0013499 petF ferredoxin; Validated 99.4
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.34
PTZ00038191 ferredoxin; Provisional 99.27
PLN03136148 Ferredoxin; Provisional 99.26
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.24
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.22
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.13
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 99.12
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.08
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.05
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.02
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 98.96
COG3894 614 Uncharacterized metal-binding protein [General fun 98.95
PRK05713 312 hypothetical protein; Provisional 98.92
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 98.8
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 98.79
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 98.77
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.51
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 98.39
PRK09130 687 NADH dehydrogenase subunit G; Validated 98.34
PRK07860 797 NADH dehydrogenase subunit G; Validated 98.33
PRK08493 819 NADH dehydrogenase subunit G; Validated 98.29
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 98.28
PRK09129 776 NADH dehydrogenase subunit G; Validated 98.23
PRK12814 652 putative NADPH-dependent glutamate synthase small 98.22
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 98.2
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 98.06
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 97.75
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 97.74
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 97.54
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 97.36
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 97.25
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 97.04
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 97.03
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 97.0
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 96.98
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 96.95
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 96.93
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 96.88
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 96.86
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 96.71
PRK09800 956 putative hypoxanthine oxidase; Provisional 96.5
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 96.4
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 96.39
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 96.07
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 95.98
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 95.75
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 95.65
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 95.02
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 94.39
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 93.86
KOG2282 708 consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 91.99
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 91.47
PLN00192 1344 aldehyde oxidase 91.21
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 84.1
PF0219671 RBD: Raf-like Ras-binding domain; InterPro: IPR003 80.83
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information 
Probab=99.95  E-value=3.7e-27  Score=174.56  Aligned_cols=109  Identities=50%  Similarity=0.816  Sum_probs=92.7

Q ss_pred             ccccccCcceeccCCCCCCC-CCCCCCCceEEEEEcCCCCEEEEEecCCchHHHHHHHCCCCccCCCCCcccccCCEEEE
Q 041173            9 GSICQKYPQFCTTAENDASH-GCSIQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEGACEGSLACSTCHVIK   87 (117)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~mv~Vt~~~~~G~~~~v~~~~G~tLLeaa~~~gI~l~~~CgG~g~CgTC~V~V   87 (117)
                      -++-.+++.|..+.....+. +++.....++|+|+++||.+..+++..|+|||++|.++||+++++|+|..+|+||||+|
T Consensus        15 ~a~~~~~~~f~~~~t~~~~~~~~~~~~e~i~Itfv~~dG~~~~i~g~vGdtlLd~ah~n~idleGACEgslACSTCHViv   94 (159)
T KOG3309|consen   15 LAPFTRNHIFRTSSTSEFSPSKGPRKVEDIKITFVDPDGEEIKIKGKVGDTLLDAAHENNLDLEGACEGSLACSTCHVIV   94 (159)
T ss_pred             ccccccceeeccCcccccccccCCCCCceEEEEEECCCCCEEEeeeecchHHHHHHHHcCCCccccccccccccceEEEE
Confidence            34444556666554443321 23333444999999999999999999999999999999999999999999999999999


Q ss_pred             -----------------------------------EeeCCCCCeEEecCCCccceeecCCCCCCC
Q 041173           88 -----------------------------------ITWPELDGVRLAFPAATRDFAVDGYVPKPH  117 (117)
Q Consensus        88 -----------------------------------~l~~~~dGlvv~lP~~~~~~~~~~~~~~~~  117 (117)
                                                         .++++||||+|+||...+|+++||++||||
T Consensus        95 ~~~~yekl~ep~DeE~DmLDlA~gLt~tSRLGCQI~l~keldG~~v~vP~atrn~~vd~~~~kph  159 (159)
T KOG3309|consen   95 DEEYYEKLPEPEDEENDMLDLAFGLTETSRLGCQIVLTKELDGMRVAVPEATRNFRVDGFVPKPH  159 (159)
T ss_pred             cHHHHhcCCCCcchHHHHHHhhhccccccccceEEEeccccCCcEEECccccccccccCCCCCCC
Confidence                                               999999999999999999999999999999

>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
3p1m_A132 Crystal Structure Of Human Ferredoxin-1 (Fdx1) In C 1e-09
3n9z_C123 Crystal Structure Of Human Cyp11a1 In Complex With 2e-09
3n9y_C114 Crystal Structure Of Human Cyp11a1 In Complex With 2e-09
1l6v_A128 Structure Of Reduced Bovine Adrenodoxin Length = 12 5e-09
1cje_A127 Adrenodoxin From Bovine Length = 127 7e-09
1l6u_A128 Nmr Structure Of Oxidized Adrenodoxin Length = 128 7e-09
1e6e_B128 Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHO 7e-09
1ayf_A105 Bovine Adrenodoxin (oxidized) Length = 105 8e-09
2bt6_A108 Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 9e-09
2y5c_A109 Structure Of Human Ferredoxin 2 (Fdx2)in Complex Wi 2e-08
2jqr_B105 Solution Model Of Crosslinked Complex Of Cytochrome 2e-08
2wlb_A103 Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schi 2e-08
3hui_A126 Crystal Structure Of The Mutant A105r Of [2fe-2s] F 6e-05
3na0_C68 Crystal Structure Of Human Cyp11a1 In Complex With 7e-05
3ah7_A113 Crystal Structure Of The Isc-Like [2fe-2s] Ferredox 5e-04
>pdb|3P1M|A Chain A, Crystal Structure Of Human Ferredoxin-1 (Fdx1) In Complex With Iron- Sulfur Cluster Length = 132 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 12/87 (13%)
Query: 31  SIQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEG--ACEGSLACSTCHVI-- 86
           S  +D + V F ++DGE    K  VG S+L+ V EN+++++G  ACEG+LACSTCH+I  
Sbjct: 2   SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFE 61
Query: 87  --------KITWPELDGVRLAFPAATR 105
                    IT  E D + LA+    R
Sbjct: 62  DHIYEKLDAITDEENDMLDLAYGLTDR 88
>pdb|3N9Z|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 22- Hydroxycholesterol Length = 123 Back     alignment and structure
>pdb|3N9Y|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 114 Back     alignment and structure
>pdb|1L6V|A Chain A, Structure Of Reduced Bovine Adrenodoxin Length = 128 Back     alignment and structure
>pdb|1CJE|A Chain A, Adrenodoxin From Bovine Length = 127 Back     alignment and structure
>pdb|1L6U|A Chain A, Nmr Structure Of Oxidized Adrenodoxin Length = 128 Back     alignment and structure
>pdb|1E6E|B Chain B, Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHONDRIAL P450 Systems Length = 128 Back     alignment and structure
>pdb|1AYF|A Chain A, Bovine Adrenodoxin (oxidized) Length = 105 Back     alignment and structure
>pdb|2BT6|A Chain A, Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 108 Back     alignment and structure
>pdb|2Y5C|A Chain A, Structure Of Human Ferredoxin 2 (Fdx2)in Complex With 2fe2s Cluster Length = 109 Back     alignment and structure
>pdb|2JQR|B Chain B, Solution Model Of Crosslinked Complex Of Cytochrome C And Adrenodoxin Length = 105 Back     alignment and structure
>pdb|2WLB|A Chain A, Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schizosaccharomyces Pombe Mitochondria Length = 103 Back     alignment and structure
>pdb|3HUI|A Chain A, Crystal Structure Of The Mutant A105r Of [2fe-2s] Ferredoxin In The Class I Cyp199a2 System From Rhodopseudomonas Palustris Length = 126 Back     alignment and structure
>pdb|3NA0|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 68 Back     alignment and structure
>pdb|3AH7|A Chain A, Crystal Structure Of The Isc-Like [2fe-2s] Ferredoxin (Fdxb) From Pseudomonas Putida Jcm 20004 Length = 113 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 9e-24
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 3e-23
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 5e-22
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 5e-22
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 4e-21
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 6e-21
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 9e-20
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 1e-19
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 2e-19
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 9e-19
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 2e-17
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 1e-15
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 4e-06
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
 Score = 86.9 bits (216), Expect = 9e-24
 Identities = 34/110 (30%), Positives = 46/110 (41%), Gaps = 37/110 (33%)

Query: 32  IQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEGACEGSLACSTCHV------ 85
           +  D+VNV F D+ G+   +   VG ++L     + ++LEGACE SLACSTCHV      
Sbjct: 1   MASDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDH 60

Query: 86  ------------------------------IKITWPELDGVRLAFPAATR 105
                                         I +T PEL+G     P  TR
Sbjct: 61  LDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLT-PELEGAEFTLPKITR 109
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Length = 126 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Length = 113 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Length = 111 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Length = 106 Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} Length = 104 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Length = 631 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.84
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.8
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.8
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.79
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.77
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.72
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.69
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.69
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.69
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.66
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.61
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.55
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.52
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.5
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.48
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.47
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.46
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.44
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.41
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.4
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.28
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.27
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.13
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.03
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 98.52
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 98.47
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 98.37
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 97.98
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 97.97
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 97.96
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 97.96
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 97.93
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 97.39
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 97.29
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 97.16
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.03
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 96.9
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 96.84
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 96.63
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 96.35
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 96.34
2l05_A95 Serine/threonine-protein kinase B-RAF; structural 95.05
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 93.16
1wxm_A86 A-RAF proto-oncogene serine/threonine-protein kina 90.07
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 89.48
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 88.63
1rrb_A107 RAF-1 RBD, RAF proto-oncogene serine/threonine-pro 88.32
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 88.05
3u7z_A101 Putative metal binding protein rumgna_00854; the b 87.93
3ny5_A96 Serine/threonine-protein kinase B-RAF; NESG, struc 87.19
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 85.32
3kdv_A184 DDRB, DNA damage response B protein; anti-parallel 84.23
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 82.99
1c1y_B77 Proto-onkogene serine/threonine protein kinase RAF 81.61
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 81.31
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 80.93
1wwt_A88 Threonyl-tRNA synthetase, cytoplasmic; TGS domain, 80.5
3v6c_B91 Ubiquitin; structural genomics, structural genomic 80.37
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
Probab=99.84  E-value=7.1e-21  Score=135.54  Aligned_cols=77  Identities=34%  Similarity=0.596  Sum_probs=68.8

Q ss_pred             CCCCCCCceEEEEEcCCCCEEEEEecCCchHHHHHHHCCCC-ccCCCCCcccccCCEEEE--------------------
Q 041173           29 GCSIQKDMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIE-LEGACEGSLACSTCHVIK--------------------   87 (117)
Q Consensus        29 ~~~~~~~mv~Vt~~~~~G~~~~v~~~~G~tLLeaa~~~gI~-l~~~CgG~g~CgTC~V~V--------------------   87 (117)
                      -.+.+.+|++|+|++++|++++|++.+|+|||++|+++||+ +++.|+|.|.||||+|+|                    
T Consensus        14 ~~~~~~~M~~Vt~~~~~G~~~~v~~~~G~tLL~aa~~~gi~gi~~~C~G~G~CgtC~v~v~~G~~~~l~~~~~~E~~~L~   93 (126)
T 3hui_A           14 LVPRGSHMAKINFVDHTGETRTVEVEEGATVMEAAIRNAIPGVEAECGGACACATCHVYVDEAWREKVGGPSPMEEDMLD   93 (126)
T ss_dssp             -CCTTCSEEEEEEECTTSCEEEEEEETTSBHHHHHHTTTCTTCCCTTSSSSCCSTTEEEECGGGHHHHCCCCHHHHHHHT
T ss_pred             ccCCCCCceEEEEEeCCCCEEEEEECCCCcHHHHHHHcCCCCCccCCCCCCCCCCCEEEECCCcccccCCCCHHHhhhcC
Confidence            45678999999999999988999999999999999999999 999999999999999999                    


Q ss_pred             ---------------EeeCCCCCeEEecCCCcc
Q 041173           88 ---------------ITWPELDGVRLAFPAATR  105 (117)
Q Consensus        88 ---------------~l~~~~dGlvv~lP~~~~  105 (117)
                                     .++.++||++|+||+++|
T Consensus        94 ~~~e~~~g~RLaCQ~~~~~dldgl~V~lp~~~r  126 (126)
T 3hui_A           94 FGYDVRPNSRLSCQIKVSNELDGLIVTTPERQR  126 (126)
T ss_dssp             TSSSCCTTEEEGGGCBCCGGGTTEEEECCSCCC
T ss_pred             chhhccCCeEEeeeCEECcCCCcEEEEecCcCC
Confidence                           455667889999988764
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>2l05_A Serine/threonine-protein kinase B-RAF; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1wxm_A A-RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain (RBD), ubiquitin-like fold, A-RAF kinase, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>1rrb_A RAF-1 RBD, RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain, transferase, riken structural genomics/proteomics initiative; NMR {Rattus norvegicus} SCOP: d.15.1.5 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} Back     alignment and structure
>3ny5_A Serine/threonine-protein kinase B-RAF; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; HET: MSE; 1.99A {Homo sapiens} SCOP: d.15.1.0 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>1c1y_B Proto-onkogene serine/threonine protein kinase RAF-1; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: d.15.1.5 PDB: 1gua_B* 1rfa_A 3kud_B* 3kuc_B* Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1wwt_A Threonyl-tRNA synthetase, cytoplasmic; TGS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ligase; NMR {Homo sapiens} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 117
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 6e-12
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 6e-11
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 6e-10
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 9e-10
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 6e-09
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 4e-07
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 5e-07
d1jq4a_98 d.15.4.2 (A:) Methane monooxygenase reductase N-te 5e-06
d1frda_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 6e-05
d1czpa_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 2e-04
d1doia_128 d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcu 3e-04
d1frra_95 d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense 6e-04
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 7e-04
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: Adrenodoxin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 55.4 bits (133), Expect = 6e-12
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 2/54 (3%)

Query: 35 DMVNVTFSDKDGEEKNIKVPVGMSMLEAVHENDIELEG--ACEGSLACSTCHVI 86
          D + V F ++DGE    K  +G S+L+ V +N+++++G  ACEG+LACSTCH+I
Sbjct: 1  DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLI 54
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Length = 98 Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 128 Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 95 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.84
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.83
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.81
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.74
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.65
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.6
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.57
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.55
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.53
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.52
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.52
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.5
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.5
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.47
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.32
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.28
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.13
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 99.06
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 98.43
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.18
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.93
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 97.8
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 97.78
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 97.69
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 97.64
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 97.55
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 97.35
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 96.65
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 95.19
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 89.73
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 89.06
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 88.17
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 84.61
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 82.43
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 80.69
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]

Probab=99.84  E-value=3.5e-21  Score=131.06  Aligned_cols=67  Identities=27%  Similarity=0.644  Sum_probs=63.2

Q ss_pred             EEEEEcCCCCEEEEEecCCchHHHHHHHCCCC-ccCCCCCcccccCCEEEE-----------------------------
Q 041173           38 NVTFSDKDGEEKNIKVPVGMSMLEAVHENDIE-LEGACEGSLACSTCHVIK-----------------------------   87 (117)
Q Consensus        38 ~Vt~~~~~G~~~~v~~~~G~tLLeaa~~~gI~-l~~~CgG~g~CgTC~V~V-----------------------------   87 (117)
                      ||||++++|++++|++++|+|||+||+++||+ +++.|||.|.|+||||+|                             
T Consensus         2 KIt~i~~dG~~~~i~~~~G~tLl~a~~~~gi~~i~~~CgG~g~C~tC~V~i~~g~~~~l~~~~~~E~~~L~~~~~~~~~~   81 (106)
T d1e9ma_           2 KIIFIEHNGTRHEVEAKPGLTVMEAARDNGVPGIDADCGGACACSTCHAYVDPAWVDKLPKALPTETDMIDFAYEPNPAT   81 (106)
T ss_dssp             EEEEECTTSCEEEEECCTTSBHHHHHHTTTCTTCCCTTSSSSSSCTTEEEECHHHHTTSCCCCHHHHHHHTTSSSCCTTT
T ss_pred             EEEEECCCCCEEEEEECCCChHHHHHHHcCCCCcCcccccCceecceEEEeccCccccCCCCCHHHHHHHhhccccCCCc
Confidence            79999999999999999999999999999995 999999999999999999                             


Q ss_pred             -------EeeCCCCCeEEecCCCc
Q 041173           88 -------ITWPELDGVRLAFPAAT  104 (117)
Q Consensus        88 -------~l~~~~dGlvv~lP~~~  104 (117)
                             .++++++||+|+||+++
T Consensus        82 sRLaCQ~~v~~d~~gl~V~iPe~q  105 (106)
T d1e9ma_          82 SRLTCQIKVTSLLDGLVVHLPEKQ  105 (106)
T ss_dssp             EEEGGGCBCCGGGTTEEEECCSCC
T ss_pred             eEeeEeCEeccccCCEEEECCccc
Confidence                   68888999999999764
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure