Citrus Sinensis ID: 041201

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MEIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEIIAVEAPSTNLEKAEAQIGVDVHVALNSALTGKC
ccEEEEEEEcccccccccccccccccccccEEEEEEEccEEEEEEEcccEEEEEcccEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccc
ccEEEEEEEcccccEEcccccccHHHEccccEEEEEEcccEEEEEEEccEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccc
meidkiiipsttglmsvlpGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEIIAveapstnlekaEAQIGVDVHVALNSALTGKC
MEIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEIIAVEAPSTNLEKAEAQIGVDVHVALNSALTGKC
MEIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEIIAVEAPSTNLEKAEAQIGVDVHVALNSALTGKC
****KIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEIIAVEAPSTNLEKAEAQIGVDVHVALN*******
MEIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEIIAVEAPSTNLEKAEAQIGVDVH***********
MEIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEIIAVEAPSTNLEKAEAQIGVDVHVALNSALTGKC
MEIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEIIAVEAPSTNLEKAEAQIGVDVHVALNSALT**C
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEIIAVEAPSTNLEKAEAQIGVDVHVALNSALTGKC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query94 2.2.26 [Sep-21-2011]
Q40089200 ATP synthase subunit delt N/A no 0.968 0.455 0.573 5e-29
Q96252203 ATP synthase subunit delt yes no 0.968 0.448 0.539 4e-26
Q41000197 ATP synthase subunit delt N/A no 0.968 0.461 0.530 1e-25
A5GV56135 ATP synthase epsilon chai yes no 0.808 0.562 0.342 4e-09
P0A2Z9137 ATP synthase epsilon chai yes no 0.765 0.525 0.351 6e-07
P0A2Z8137 ATP synthase epsilon chai yes no 0.765 0.525 0.351 6e-07
A2C4I5135 ATP synthase epsilon chai yes no 0.797 0.555 0.363 9e-07
Q46J67135 ATP synthase epsilon chai yes no 0.797 0.555 0.363 1e-06
A4J998132 ATP synthase epsilon chai yes no 0.957 0.681 0.308 1e-06
B8HP54138 ATP synthase epsilon chai yes no 0.563 0.384 0.377 3e-06
>sp|Q40089|ATP4_IPOBA ATP synthase subunit delta', mitochondrial OS=Ipomoea batatas PE=1 SV=1 Back     alignment and function desciption
 Score =  126 bits (316), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 78/115 (67%), Gaps = 24/115 (20%)

Query: 2   EIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEI 61
           E+D +IIP+TTG M VLPGH + IA LK GV+SVHEGN+V KYF+S GFA IH NS+A+I
Sbjct: 86  EVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVSKYFVSGGFAFIHANSFADI 145

Query: 62  IAVEA------------------------PSTNLEKAEAQIGVDVHVALNSALTG 92
           IAVEA                         ST++EKAEAQIGVDVH ALN+ALTG
Sbjct: 146 IAVEAVPLDRIDANLVQKGLAEFTQKLNTASTDVEKAEAQIGVDVHSALNAALTG 200
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Ipomoea batatas (taxid: 4120)
>sp|Q96252|ATP4_ARATH ATP synthase subunit delta', mitochondrial OS=Arabidopsis thaliana GN=At5g47030 PE=1 SV=1 Back     alignment and function description
>sp|Q41000|ATP4_PEA ATP synthase subunit delta', mitochondrial OS=Pisum sativum PE=3 SV=1 Back     alignment and function description
>sp|A5GV56|ATPE_SYNR3 ATP synthase epsilon chain OS=Synechococcus sp. (strain RCC307) GN=atpC PE=3 SV=1 Back     alignment and function description
>sp|P0A2Z9|ATPE_SYNP6 ATP synthase epsilon chain OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=atpC PE=3 SV=1 Back     alignment and function description
>sp|P0A2Z8|ATPE_SYNE7 ATP synthase epsilon chain OS=Synechococcus elongatus (strain PCC 7942) GN=atpC PE=3 SV=1 Back     alignment and function description
>sp|A2C4I5|ATPE_PROM1 ATP synthase epsilon chain OS=Prochlorococcus marinus (strain NATL1A) GN=atpC PE=3 SV=1 Back     alignment and function description
>sp|Q46J67|ATPE_PROMT ATP synthase epsilon chain OS=Prochlorococcus marinus (strain NATL2A) GN=atpC PE=3 SV=1 Back     alignment and function description
>sp|A4J998|ATPE_DESRM ATP synthase epsilon chain OS=Desulfotomaculum reducens (strain MI-1) GN=atpC PE=3 SV=1 Back     alignment and function description
>sp|B8HP54|ATPE_CYAP4 ATP synthase epsilon chain OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=atpC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
147863390 206 hypothetical protein VITISV_044183 [Viti 0.968 0.441 0.6 4e-29
225453289 206 PREDICTED: ATP synthase subunit delta', 0.968 0.441 0.6 5e-29
449432356 200 PREDICTED: ATP synthase subunit delta', 0.968 0.455 0.608 1e-28
356504527 197 PREDICTED: ATP synthase subunit delta', 0.968 0.461 0.591 2e-28
255575798 204 ATP synthase delta chain, mitochondrial, 0.968 0.446 0.6 5e-28
388512823 199 unknown [Lotus japonicus] 0.968 0.457 0.582 5e-28
356520754 197 PREDICTED: ATP synthase subunit delta', 0.968 0.461 0.582 8e-28
224136358 198 predicted protein [Populus trichocarpa] 0.968 0.459 0.591 1e-27
357122753 206 PREDICTED: ATP synthase subunit delta', 0.968 0.441 0.565 1e-27
242045722 203 hypothetical protein SORBIDRAFT_02g03395 0.968 0.448 0.573 1e-27
>gi|147863390|emb|CAN84027.1| hypothetical protein VITISV_044183 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 80/115 (69%), Gaps = 24/115 (20%)

Query: 2   EIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEI 61
           E+D +IIP+TTG M VLPGH + IA LK GV+SVHEGN+V KYFISSGFA+IH NS+A+I
Sbjct: 92  EVDMVIIPATTGQMGVLPGHVATIAELKPGVMSVHEGNDVTKYFISSGFAVIHANSFADI 151

Query: 62  IAVEA------------------------PSTNLEKAEAQIGVDVHVALNSALTG 92
           IA+EA                         ST+LEKAEAQIGVDVH ALNSALTG
Sbjct: 152 IAIEAVPIDQIDPSLVQKGLADFTQKLSSASTDLEKAEAQIGVDVHSALNSALTG 206

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225453289|ref|XP_002267995.1| PREDICTED: ATP synthase subunit delta', mitochondrial [Vitis vinifera] gi|297734660|emb|CBI16711.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449432356|ref|XP_004133965.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Cucumis sativus] gi|449519178|ref|XP_004166612.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356504527|ref|XP_003521047.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|255575798|ref|XP_002528798.1| ATP synthase delta chain, mitochondrial, putative [Ricinus communis] gi|223531801|gb|EEF33620.1| ATP synthase delta chain, mitochondrial, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388512823|gb|AFK44473.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356520754|ref|XP_003529025.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|224136358|ref|XP_002326840.1| predicted protein [Populus trichocarpa] gi|222835155|gb|EEE73590.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357122753|ref|XP_003563079.1| PREDICTED: ATP synthase subunit delta', mitochondrial-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|242045722|ref|XP_002460732.1| hypothetical protein SORBIDRAFT_02g033950 [Sorghum bicolor] gi|241924109|gb|EER97253.1| hypothetical protein SORBIDRAFT_02g033950 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
TAIR|locus:2171022203 AT5G47030 [Arabidopsis thalian 0.957 0.443 0.532 5.7e-20
UNIPROTKB|F1PY24168 ATP5D "Uncharacterized protein 0.808 0.452 0.298 2.2e-09
MGI|MGI:1913293168 Atp5d "ATP synthase, H+ transp 0.808 0.452 0.298 2.2e-09
UNIPROTKB|F1S6Q7168 ATP5D "ATP synthase subunit de 0.808 0.452 0.310 2.8e-09
RGD|621372168 Atp5d "ATP synthase, H+ transp 0.808 0.452 0.298 2.8e-09
UNIPROTKB|P35434168 Atp5d "ATP synthase subunit de 0.808 0.452 0.298 2.8e-09
UNIPROTKB|P05630168 ATP5D "ATP synthase subunit de 0.808 0.452 0.298 3.6e-09
ZFIN|ZDB-GENE-030131-7649159 atp5d "ATP synthase, H+ transp 0.840 0.496 0.320 5.3e-08
DICTYBASE|DDB_G0269038170 atp5D "ATP synthase F1 delta" 0.893 0.494 0.333 1.8e-07
FB|FBgn0028342157 l(1)G0230 "lethal (1) G0230" [ 0.765 0.458 0.346 3.8e-07
TAIR|locus:2171022 AT5G47030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 237 (88.5 bits), Expect = 5.7e-20, P = 5.7e-20
 Identities = 49/92 (53%), Positives = 66/92 (71%)

Query:     2 EIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEI 61
             E+D +IIP++TG M VLPGH   IA LK G++SVHEG +V KYF+SSGFA +H NS A+I
Sbjct:    89 EVDMVIIPASTGQMGVLPGHVPTIAELKPGIMSVHEGTDVKKYFLSSGFAFLHANSVADI 148

Query:    62 IAVEA-PSTNLEKAEAQIGV-DVHVALNSALT 91
             IAVEA P  +++ ++ Q G+ +    L SA T
Sbjct:   149 IAVEAVPLDHIDPSQVQKGLAEFQQKLASATT 180
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0005753 "mitochondrial proton-transporting ATP synthase complex" evidence=ISS;IDA
GO:0015986 "ATP synthesis coupled proton transport" evidence=IEA
GO:0045261 "proton-transporting ATP synthase complex, catalytic core F(1)" evidence=IEA
GO:0046933 "proton-transporting ATP synthase activity, rotational mechanism" evidence=IEA;ISS
GO:0046961 "proton-transporting ATPase activity, rotational mechanism" evidence=IEA
GO:0000275 "mitochondrial proton-transporting ATP synthase complex, catalytic core F(1)" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0006096 "glycolysis" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009060 "aerobic respiration" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
UNIPROTKB|F1PY24 ATP5D "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1913293 Atp5d "ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S6Q7 ATP5D "ATP synthase subunit delta, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|621372 Atp5d "ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P35434 Atp5d "ATP synthase subunit delta, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P05630 ATP5D "ATP synthase subunit delta, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7649 atp5d "ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269038 atp5D "ATP synthase F1 delta" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0028342 l(1)G0230 "lethal (1) G0230" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
cd12152123 cd12152, F1-ATPase_delta, mitochondrial ATP syntha 9e-16
pfam0282380 pfam02823, ATP-synt_DE_N, ATP synthase, Delta/Epsi 1e-12
CHL00063134 CHL00063, atpE, ATP synthase CF1 epsilon subunit 2e-10
COG0355135 COG0355, AtpC, F0F1-type ATP synthase, epsilon sub 7e-09
PRK13446136 PRK13446, atpC, F0F1 ATP synthase subunit epsilon; 2e-08
PRK00571135 PRK00571, atpC, F0F1 ATP synthase subunit epsilon; 7e-08
PRK13444127 PRK13444, atpC, F0F1 ATP synthase subunit epsilon; 2e-07
PRK14736133 PRK14736, atpC, F0F1 ATP synthase subunit epsilon; 2e-06
PRK13443136 PRK13443, atpC, F0F1 ATP synthase subunit epsilon; 6e-06
TIGR01216130 TIGR01216, ATP_synt_epsi, ATP synthase, F1 epsilon 1e-05
PRK13448135 PRK13448, atpC, F0F1 ATP synthase subunit epsilon; 3e-04
PRK14735139 PRK14735, atpC, F0F1 ATP synthase subunit epsilon; 5e-04
PRK1344988 PRK13449, atpC, F0F1 ATP synthase subunit epsilon; 6e-04
PRK1344289 PRK13442, atpC, F0F1 ATP synthase subunit epsilon; 7e-04
PRK01474112 PRK01474, atpC, F0F1 ATP synthase subunit epsilon; 0.001
>gnl|CDD|213395 cd12152, F1-ATPase_delta, mitochondrial ATP synthase delta subunit Back     alignment and domain information 
 Score = 66.4 bits (163), Expect = 9e-16
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 2  EIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVH-EGNEVIKYFISSGFALIHTNSYAE 60
          E++ +++P T G   +LPGHA ++  LK GVL +  E  E   + +S GF  +   +   
Sbjct: 16 EVESVVLPGTEGEFGILPGHAPLVTALKPGVLRIRDEDGEEKYFAVSGGFLEVT-PNRVT 74

Query: 61 IIAVEA-PSTNLEKAEAQ 77
          I+A EA    +++   A+
Sbjct: 75 ILADEAERPEDIDVERAE 92

The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1, is composed of alpha, beta, gamma, delta, and epsilon subunits with a stoichiometry of 3:3:1:1:1. Alpha and beta subunit form the globular catalytic moiety, a hexameric ring of alternating subunits. Gamma, delta and epsilon subunits form a stalk, connecting F1 to F0, the integral membrane proton translocating domain. In bacteria, which is lacking a eukaryotic epsilon subunit homolog, this subunit is called the epsilon subunit. Length = 123
>gnl|CDD|217242 pfam02823, ATP-synt_DE_N, ATP synthase, Delta/Epsilon chain, beta-sandwich domain Back     alignment and domain information
>gnl|CDD|214351 CHL00063, atpE, ATP synthase CF1 epsilon subunit Back     alignment and domain information
>gnl|CDD|223432 COG0355, AtpC, F0F1-type ATP synthase, epsilon subunit (mitochondrial delta subunit) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184056 PRK13446, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|234796 PRK00571, atpC, F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|139576 PRK13444, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|173198 PRK14736, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|237388 PRK13443, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|130283 TIGR01216, ATP_synt_epsi, ATP synthase, F1 epsilon subunit (delta in mitochondria) Back     alignment and domain information
>gnl|CDD|139579 PRK13448, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|173197 PRK14735, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|184058 PRK13449, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|184055 PRK13442, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|100879 PRK01474, atpC, F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 94
PRK00539133 atpC F0F1 ATP synthase subunit epsilon; Validated 99.96
PRK13452145 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.96
PRK13444127 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.96
PRK13451101 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.96
PRK14735139 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.95
PRK13448135 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.95
PRK01474112 atpC F0F1 ATP synthase subunit epsilon; Validated 99.95
CHL00063134 atpE ATP synthase CF1 epsilon subunit 99.95
PRK13446136 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.95
PRK14736133 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.95
PRK13443136 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.95
PRK13450132 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.95
PRK00571135 atpC F0F1 ATP synthase subunit epsilon; Validated 99.94
COG0355135 AtpC F0F1-type ATP synthase, epsilon subunit (mito 99.94
TIGR01216130 ATP_synt_epsi ATP synthase, F1 epsilon subunit (de 99.94
KOG1758159 consensus Mitochondrial F1F0-ATP synthase, subunit 99.91
TIGR03166122 alt_F1F0_F1_eps alternate F1F0 ATPase, F1 subunit 99.9
PRK1344988 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.89
PRK06228131 F0F1 ATP synthase subunit epsilon; Validated 99.89
PRK13447136 F0F1 ATP synthase subunit epsilon; Provisional 99.89
PRK1344289 atpC F0F1 ATP synthase subunit epsilon; Provisiona 99.89
PF0282380 ATP-synt_DE_N: ATP synthase, Delta/Epsilon chain, 99.87
PF0040148 ATP-synt_DE: ATP synthase, Delta/Epsilon chain, lo 95.45
>PRK00539 atpC F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information 
Probab=99.96  E-value=1e-28  Score=167.97  Aligned_cols=79  Identities=18%  Similarity=0.216  Sum_probs=75.3

Q ss_pred             CceEEEEEecCceeeeeccCCcceeeeecceEEEEEe-CCeEEEEEeCccEEEEeCCeEe---------EecccccchhH
Q 041201            1 MEIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHE-GNEVIKYFISSGFALIHTNSYA---------EIIAVEAPSTN   70 (94)
Q Consensus         1 g~v~~V~~~t~~G~~gILp~H~p~it~L~~G~l~i~~-~~~~~~~~v~gGf~~v~~~~v~---------~~Id~e~A~~~   70 (94)
                      |+|++|++||++|+|||||||+|+|+.|.||.++|+. +++++.++|+|||++|.+|+++         ++||+++|+++
T Consensus        18 ~~v~~V~l~t~~G~~gIL~~Haplit~L~~G~~~i~~~~~~~~~~~v~gGf~ev~~n~v~Ilad~ae~~eeID~~~a~~a   97 (133)
T PRK00539         18 EKIISAQVKTTEGYAGLNRNRAPLIAAIQSHVCKITFADKTKRSAIIGAGLLLIKKTEAKIFTENFVFADELDYDETLKR   97 (133)
T ss_pred             ceEEEEEEecCccCceecCCCcceEeEecceEEEEEECCCcEEEEEEeeeEEEEECCEEEEEECeEEchhhCCHHHHHHH
Confidence            6899999999999999999999999999999999986 6777889999999999999998         89999999999


Q ss_pred             HHHHHHHhh
Q 041201           71 LEKAEAQIG   79 (94)
Q Consensus        71 ~~rAe~~l~   79 (94)
                      ++|||++|+
T Consensus        98 ~erAe~~L~  106 (133)
T PRK00539         98 KKELERKIK  106 (133)
T ss_pred             HHHHHHHHH
Confidence            999999995

>PRK13452 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK13444 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK13451 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK14735 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK13448 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK01474 atpC F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information
>CHL00063 atpE ATP synthase CF1 epsilon subunit Back     alignment and domain information
>PRK13446 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK14736 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK13443 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK13450 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK00571 atpC F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information
>COG0355 AtpC F0F1-type ATP synthase, epsilon subunit (mitochondrial delta subunit) [Energy production and conversion] Back     alignment and domain information
>TIGR01216 ATP_synt_epsi ATP synthase, F1 epsilon subunit (delta in mitochondria) Back     alignment and domain information
>KOG1758 consensus Mitochondrial F1F0-ATP synthase, subunit delta/ATP16 [Energy production and conversion] Back     alignment and domain information
>TIGR03166 alt_F1F0_F1_eps alternate F1F0 ATPase, F1 subunit epsilon Back     alignment and domain information
>PRK13449 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK06228 F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information
>PRK13447 F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK13442 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PF02823 ATP-synt_DE_N: ATP synthase, Delta/Epsilon chain, beta-sandwich domain; InterPro: IPR020546 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF00401 ATP-synt_DE: ATP synthase, Delta/Epsilon chain, long alpha-helix domain; InterPro: IPR020547 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
2rq7_A134 Solution Structure Of The Epsilon Subunit Chimera C 5e-07
2w6i_H168 Low Resolution Structures Of Bovine Mitochondrial F 1e-06
2xnd_H131 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 1e-06
1e79_H146 Bovine F1-Atpase Inhibited By Dccd (Dicyclohexylcar 1e-06
3oe7_H137 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 1e-06
2hld_H138 Crystal Structure Of Yeast Mitochondrial F1-Atpase 1e-06
2xok_H160 Refined Structure Of Yeast F1c10 Atpase Complex To 1e-06
4b2q_H132 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 1e-06
2rq6_A138 Solution Structure Of The Epsilon Subunit Of The F1 6e-06
>pdb|2RQ7|A Chain A, Solution Structure Of The Epsilon Subunit Chimera Combining The N-Terminal Beta-Sandwich Domain From T. Elongatus Bp-1 F1 And The C-Terminal Alpha-Helical Domain From Spinach Chloroplast F1 Length = 134 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 17/105 (16%)
Query: 4   DKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSY----- 58
           +++I+PSTTG + +L  HA ++  L++GV+ V +  E +   +  GFA +  N       
Sbjct: 20  EEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVAIALMGGFAEVENNEVTILVN 79
Query: 59  -AE----IIAVEAPST------NLEKAE-AQIGVDVHVALNSALT 91
            AE    I   EA  T      NL KAE A+  ++ ++AL  A T
Sbjct: 80  GAERGDTIDPQEAQQTLEIAEANLRKAEGARQKIEANLALRRART 124
>pdb|2W6I|H Chain H, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 4b. Length = 168 Back     alignment and structure
>pdb|2XND|H Chain H, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 131 Back     alignment and structure
>pdb|1E79|H Chain H, Bovine F1-Atpase Inhibited By Dccd (Dicyclohexylcarbodiimide) Length = 146 Back     alignment and structure
>pdb|3OE7|H Chain H, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Gamma-I270t Length = 137 Back     alignment and structure
>pdb|2HLD|H Chain H, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 138 Back     alignment and structure
>pdb|2XOK|H Chain H, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 160 Back     alignment and structure
>pdb|4B2Q|H Chain H, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 132 Back     alignment and structure
>pdb|2RQ6|A Chain A, Solution Structure Of The Epsilon Subunit Of The F1-Atpase From Thermosynechococcus Elongatus Bp-1 Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
2xok_H160 ATP synthase; hydrolase, ATP-binding, F(O), F(1), 1e-17
3oee_H138 ATP synthase subunit delta; ATP phosphatase, F1F0 2e-16
2w6j_H168 F1-ATPase delta subunit; ATP phosphorylase (H+ tra 5e-16
2ck3_H146 ATP synthase subunit delta\, mitochondrial; hydrol 6e-15
2e5y_A133 ATP synthase epsilon chain; F1FO ATP synthase, F1- 9e-15
2rq6_A138 ATP synthase epsilon chain; F1FO ATP synthase, F1- 5e-13
2qe7_H135 ATP synthase subunit epsilon; blockage of ATP hydr 2e-12
1aqt_A138 ATP synthase; hydrolase, ATPase, epsilon subunit; 4e-12
>2xok_H ATP synthase; hydrolase, ATP-binding, F(O), F(1), mitochondr inner membrane, transmembrane; HET: ANP; 3.01A {Saccharomyces cerevisiae} Length = 160 Back     alignment and structure
 Score = 71.4 bits (175), Expect = 1e-17
 Identities = 34/112 (30%), Positives = 50/112 (44%), Gaps = 23/112 (20%)

Query: 2   EIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYAEI 61
           E+ ++ +P+ +G + VL  H   +  L  GV+ V EG+   K+FIS GFA +  +S   +
Sbjct: 48  EVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQLCV 107

Query: 62  IAVEA-----------------------PSTNLEKAEAQIGVDVHVALNSAL 90
            A+EA                        S   E AEA I V+V   L S L
Sbjct: 108 TAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVL 159
>3oee_H ATP synthase subunit delta; ATP phosphatase, F1F0 ATPase, ATP synthesis, H ADP, PO4, mitochondria; HET: ANP; 2.74A {Saccharomyces cerevisiae} PDB: 2wpd_H* 3fks_H 2hld_H* 3oeh_H* 3ofn_H* 3zry_H* 3oe7_H* Length = 138 Back     alignment and structure
>2w6j_H F1-ATPase delta subunit; ATP phosphorylase (H+ transporting), transit peptide, F1FO ATP synthase, ATP phosphorylase; 3.84A {Bos taurus} PDB: 2w6h_H 2w6i_H Length = 168 Back     alignment and structure
>2ck3_H ATP synthase subunit delta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.2.10.1 b.93.1.1 PDB: 1e79_H* 1h8e_H* 2jdi_H* 2v7q_H* 2wss_H* 2xnd_H* Length = 146 Back     alignment and structure
>2e5y_A ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, hydrolase; HET: ATP; 1.92A {Bacillus SP} PDB: 2e5t_A 2e5u_A Length = 133 Back     alignment and structure
>2rq6_A ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, ATP synthesis, CF1, hydrogen ION transport, hydrolase; NMR {Thermosynechococcus elongatus} PDB: 2rq7_A Length = 138 Back     alignment and structure
>2qe7_H ATP synthase subunit epsilon; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} Length = 135 Back     alignment and structure
>1aqt_A ATP synthase; hydrolase, ATPase, epsilon subunit; 2.30A {Escherichia coli} SCOP: a.2.10.1 b.93.1.1 PDB: 1qo1_J 1bsh_A 1bsn_A 1fs0_E 3oaa_H* Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
2e5y_A133 ATP synthase epsilon chain; F1FO ATP synthase, F1- 99.96
1aqt_A138 ATP synthase; hydrolase, ATPase, epsilon subunit; 99.96
2rq6_A138 ATP synthase epsilon chain; F1FO ATP synthase, F1- 99.96
3oee_H138 ATP synthase subunit delta; ATP phosphatase, F1F0 99.96
2xok_H160 ATP synthase; hydrolase, ATP-binding, F(O), F(1), 99.95
2ck3_H146 ATP synthase subunit delta\, mitochondrial; hydrol 99.94
2qe7_H135 ATP synthase subunit epsilon; blockage of ATP hydr 99.94
2w6j_H168 F1-ATPase delta subunit; ATP phosphorylase (H+ tra 99.93
>2e5y_A ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, hydrolase; HET: ATP; 1.92A {Bacillus SP} PDB: 2e5t_A 2e5u_A Back     alignment and structure
Probab=99.96  E-value=2.5e-29  Score=169.66  Aligned_cols=79  Identities=22%  Similarity=0.408  Sum_probs=75.8

Q ss_pred             CceEEEEEecCceeeeeccCCcceeeeecceEEEEEeCCeEEEEEeCccEEEEeCCeEe---------EecccccchhHH
Q 041201            1 MEIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHEGNEVIKYFISSGFALIHTNSYA---------EIIAVEAPSTNL   71 (94)
Q Consensus         1 g~v~~V~~~t~~G~~gILp~H~p~it~L~~G~l~i~~~~~~~~~~v~gGf~~v~~~~v~---------~~Id~e~A~~~~   71 (94)
                      |+|++|++||.+|+|||||||+|+++.|.||+++|+.++++++|+|+|||++|.+|.++         ++||.++|++++
T Consensus        18 ~~v~~V~~p~~~G~~GILp~H~p~it~L~~G~v~i~~~~~~~~~~v~gGf~ev~~~~vtIla~~A~~~~diD~~~a~~a~   97 (133)
T 2e5y_A           18 DDVEMVSVKAKSGELGILPGHIPLVAPLEISAARLKKGGKTQYIAVSGGFLEVRPDKVTILAQAAERAEDIDVLRAKAAK   97 (133)
T ss_dssp             EEESEEEEEETTEEEEECTTCCCEEEEEEEEEEEEEETTEEEEEEEEEEEEEEETTEEEEEESSEEEGGGCCHHHHHHHH
T ss_pred             ceEEEEEEECCcCCeEecCCCcceEeEecceEEEEEECCeEEEEEEcCeEEEEECCEEEEEEeEEEEhhhCCHHHHHHHH
Confidence            57999999999999999999999999999999999988889999999999999999998         799999999999


Q ss_pred             HHHHHHhh
Q 041201           72 EKAEAQIG   79 (94)
Q Consensus        72 ~rAe~~l~   79 (94)
                      +|||++|+
T Consensus        98 ~~Ae~~l~  105 (133)
T 2e5y_A           98 ERAERRLQ  105 (133)
T ss_dssp             HHHHHHHT
T ss_pred             HHHHHHHh
Confidence            99999994
>1aqt_A ATP synthase; hydrolase, ATPase, epsilon subunit; 2.30A {Escherichia coli} SCOP: a.2.10.1 b.93.1.1 PDB: 1qo1_J 1bsh_A 1bsn_A 1fs0_E 3oaa_H* Back     alignment and structure
>2rq6_A ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, ATP synthesis, CF1, hydrogen ION transport, hydrolase; NMR {Thermosynechococcus elongatus} PDB: 2rq7_A Back     alignment and structure
>3oee_H ATP synthase subunit delta; ATP phosphatase, F1F0 ATPase, ATP synthesis, H ADP, PO4, mitochondria; HET: ANP; 2.74A {Saccharomyces cerevisiae} PDB: 2wpd_H* 3fks_H 2hld_H* 3oeh_H* 3ofn_H* 3zry_H* 3oe7_H* 4b2q_H* Back     alignment and structure
>2xok_H ATP synthase; hydrolase, ATP-binding, F(O), F(1), mitochondr inner membrane, transmembrane; HET: ANP; 3.01A {Saccharomyces cerevisiae} Back     alignment and structure
>2ck3_H ATP synthase subunit delta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.2.10.1 b.93.1.1 PDB: 1e79_H* 1h8e_H* 2jdi_H* 2v7q_H* 2wss_H* 2xnd_H* Back     alignment and structure
>2qe7_H ATP synthase subunit epsilon; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} Back     alignment and structure
>2w6j_H F1-ATPase delta subunit; ATP phosphorylase (H+ transporting), transit peptide, F1FO ATP synthase, ATP phosphorylase; 3.84A {Bos taurus} PDB: 2w6h_H 2w6i_H Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 94
d2jdih285 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP sy 1e-12
d1aqta285 b.93.1.1 (A:2-86) Epsilon subunit of F1F0-ATP synt 3e-08
>d2jdih2 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Length = 85 Back     information, alignment and structure

class: All beta proteins
fold: Epsilon subunit of F1F0-ATP synthase N-terminal domain
superfamily: Epsilon subunit of F1F0-ATP synthase N-terminal domain
family: Epsilon subunit of F1F0-ATP synthase N-terminal domain
domain: Epsilon subunit of F1F0-ATP synthase N-terminal domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 55.9 bits (135), Expect = 1e-12
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 2  EIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVH-EGNEVIKYFISSGFALIHTNSYAE 60
           + ++ +P+ TG   +L  H   + VL+ G++ VH E     KYF+SSG   ++ +S  +
Sbjct: 16 NVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQ 75

Query: 61 IIAVEA 66
          ++A EA
Sbjct: 76 LLAEEA 81
>d1aqta2 b.93.1.1 (A:2-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
d1aqta285 Epsilon subunit of F1F0-ATP synthase N-terminal do 99.89
d2jdih285 Epsilon subunit of F1F0-ATP synthase N-terminal do 99.82
d1aqta150 Epsilon subunit of F1F0-ATP synthase C-terminal do 95.25
>d1aqta2 b.93.1.1 (A:2-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Epsilon subunit of F1F0-ATP synthase N-terminal domain
superfamily: Epsilon subunit of F1F0-ATP synthase N-terminal domain
family: Epsilon subunit of F1F0-ATP synthase N-terminal domain
domain: Epsilon subunit of F1F0-ATP synthase N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=99.89  E-value=3.2e-23  Score=128.90  Aligned_cols=66  Identities=17%  Similarity=0.418  Sum_probs=59.2

Q ss_pred             CceEEEEEecCceeeeeccCCcceeeeecceEEEEEe-CCeEEEEEeCccEEEEeCCeEeEecccccch
Q 041201            1 MEIDKIIIPSTTGLMSVLPGHASIIAVLKSGVLSVHE-GNEVIKYFISSGFALIHTNSYAEIIAVEAPS   68 (94)
Q Consensus         1 g~v~~V~~~t~~G~~gILp~H~p~it~L~~G~l~i~~-~~~~~~~~v~gGf~~v~~~~v~~~Id~e~A~   68 (94)
                      |+|++|++||.+|+|||||||+|+|+.|.||.++|+. ++++++|+++|||++|.+|+++  |-.+.|+
T Consensus        17 ~~v~~v~~~~~~G~~gIL~~H~p~i~~L~~g~v~i~~~~~~~~~~~v~gG~~~v~~n~v~--Il~~~A~   83 (85)
T d1aqta2          17 GLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVT--VLADTAI   83 (85)
T ss_dssp             EEEEEEEEEBSSSEEEECTTCCCEEEEECSEEEEEEETTTEEEEEEESSEEEEEETTEEE--EEESSEE
T ss_pred             eEEEEEEEECCcCCEEEcCCCcceeEEecCCEEEEEECCCCEEEEEEcccEEEEECCEEE--EEEeeee
Confidence            5799999999999999999999999999999999986 6778899999999999999998  5445443
>d2jdih2 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1aqta1 a.2.10.1 (A:87-136) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure