Citrus Sinensis ID: 041344
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 236 | ||||||
| 255558688 | 499 | conserved hypothetical protein [Ricinus | 0.927 | 0.438 | 0.885 | 1e-104 | |
| 356501455 | 490 | PREDICTED: uncharacterized protein LOC10 | 0.966 | 0.465 | 0.864 | 1e-103 | |
| 356553844 | 490 | PREDICTED: uncharacterized protein LOC10 | 0.936 | 0.451 | 0.877 | 1e-102 | |
| 224082584 | 501 | predicted protein [Populus trichocarpa] | 0.927 | 0.437 | 0.863 | 1e-101 | |
| 225446797 | 500 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.436 | 0.848 | 1e-100 | |
| 357494193 | 492 | hypothetical protein MTR_5g091000 [Medic | 0.923 | 0.443 | 0.871 | 2e-99 | |
| 224066555 | 501 | predicted protein [Populus trichocarpa] | 0.966 | 0.455 | 0.847 | 4e-99 | |
| 449460032 | 490 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.444 | 0.830 | 8e-96 | |
| 449502140 | 487 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.447 | 0.830 | 8e-96 | |
| 42570991 | 381 | Pleckstrin homology (PH) domain-containi | 0.902 | 0.559 | 0.802 | 2e-92 |
| >gi|255558688|ref|XP_002520368.1| conserved hypothetical protein [Ricinus communis] gi|223540415|gb|EEF41984.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 382 bits (980), Expect = e-104, Method: Compositional matrix adjust.
Identities = 194/219 (88%), Positives = 207/219 (94%)
Query: 1 TRRNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA 60
TRRNEP +KGTI FD NSTI +SPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA
Sbjct: 65 TRRNEPAIKGTIIFDANSTITVSPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA 124
Query: 61 WVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLR 120
WV+TLHA QLVLKAHKEAVNSLSG GSAKLGTVATVVAAANSTA ECSKEIEAAMQISLR
Sbjct: 125 WVATLHATQLVLKAHKEAVNSLSGTGSAKLGTVATVVAAANSTALECSKEIEAAMQISLR 184
Query: 121 NALGTMTNRITDGPMDDLSIMKETLRVKDEELQNLARDLRARDSTIRDIADKLSETAEAA 180
NALG + NRITDGPMDDL+IMKETL+VKDEELQNLARDLRARDSTIR+IADKLSETAEAA
Sbjct: 185 NALGMVNNRITDGPMDDLAIMKETLKVKDEELQNLARDLRARDSTIREIADKLSETAEAA 244
Query: 181 EAAASAAHTMDEQRRIACAEIERINKESTKQLETCVLKV 219
EAAASAAHTMDEQRRIACAEIER++K S KQL++ +LK+
Sbjct: 245 EAAASAAHTMDEQRRIACAEIERLSKASQKQLDSSLLKL 283
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356501455|ref|XP_003519540.1| PREDICTED: uncharacterized protein LOC100820315 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356553844|ref|XP_003545261.1| PREDICTED: uncharacterized protein LOC100792926 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224082584|ref|XP_002306753.1| predicted protein [Populus trichocarpa] gi|222856202|gb|EEE93749.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225446797|ref|XP_002283267.1| PREDICTED: uncharacterized protein LOC100254120 [Vitis vinifera] gi|302143523|emb|CBI22084.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357494193|ref|XP_003617385.1| hypothetical protein MTR_5g091000 [Medicago truncatula] gi|355518720|gb|AET00344.1| hypothetical protein MTR_5g091000 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224066555|ref|XP_002302134.1| predicted protein [Populus trichocarpa] gi|222843860|gb|EEE81407.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449460032|ref|XP_004147750.1| PREDICTED: uncharacterized protein LOC101215308 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449502140|ref|XP_004161554.1| PREDICTED: uncharacterized protein LOC101223787 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|42570991|ref|NP_973569.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|330253358|gb|AEC08452.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 236 | ||||||
| TAIR|locus:2052831 | 504 | SWAP70 [Arabidopsis thaliana ( | 0.927 | 0.434 | 0.671 | 3.1e-76 |
| TAIR|locus:2052831 SWAP70 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 768 (275.4 bits), Expect = 3.1e-76, P = 3.1e-76
Identities = 147/219 (67%), Positives = 167/219 (76%)
Query: 1 TRRNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA 60
TRRNEPT+KGTI FDENSTI+ISPVNF GLPKY+GCC YIGTPQKKDYFLCAETPGAA+A
Sbjct: 66 TRRNEPTIKGTILFDENSTISISPVNFQGLPKYNGCCIYIGTPQKKDYFLCAETPGAAKA 125
Query: 61 WVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGXXXXXXXXXXXXXQECSKEIEAAMQISLR 120
WV+TLHA QLVLKAHKEAV SLSG+GSA LG ECS+EI+AAMQISLR
Sbjct: 126 WVTTLHATQLVLKAHKEAVESLSGSGSATLGTVATVVAAANSTALECSREIQAAMQISLR 185
Query: 121 NALGTMTNRITDGPMDDLSIMKETLRVKDEELQNLARDLRARDSTIRDIADKLXXXXXXX 180
NAL N+ DGP+DDL+IMKETLRVKDEEL NLAR+LR+RDS I++IADKL
Sbjct: 186 NALKITPNKPIDGPLDDLTIMKETLRVKDEELHNLARELRSRDSMIKEIADKLSETAEAA 245
Query: 181 XXXXXXXHTMDEQRRIACAEIERINKESTKQLETCVLKV 219
HTMDEQR+I C E ER+ +S +Q E LK+
Sbjct: 246 VAAASAAHTMDEQRKIVCVEFERLTTDSQRQQEATKLKL 284
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.318 0.132 0.384 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 236 209 0.00079 112 3 11 22 0.36 33
31 0.48 35
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 598 (64 KB)
Total size of DFA: 166 KB (2098 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 16.50u 0.14s 16.64t Elapsed: 00:00:01
Total cpu time: 16.50u 0.14s 16.64t Elapsed: 00:00:01
Start: Fri May 10 08:35:10 2013 End: Fri May 10 08:35:11 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_V000477 | hypothetical protein (501 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 236 | |||
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 8e-04 | |
| cd01235 | 106 | cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als | 0.001 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 0.001 |
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
Score = 37.5 bits (87), Expect = 8e-04
Identities = 12/34 (35%), Positives = 14/34 (41%)
Query: 36 CCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQ 69
CF I T +K L AE+ WV L A
Sbjct: 68 HCFEIKTSDRKTLLLQAESEEEREKWVEALRKAI 101
|
Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. Length = 102 |
| >gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 236 | |||
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 98.35 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 98.04 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 97.92 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 97.85 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 97.72 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 97.69 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 97.69 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 97.68 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 97.67 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 97.24 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 97.23 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 97.17 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 97.06 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 97.02 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 96.76 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 96.34 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 96.26 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 95.5 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 95.26 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 95.2 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 95.19 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 94.61 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 94.27 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 91.62 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 90.76 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 90.11 | |
| cd01248 | 115 | PH_PLC Phospholipase C (PLC) pleckstrin homology ( | 88.3 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 87.04 | |
| cd01227 | 133 | PH_Dbs Dbs (DBL's big sister) pleckstrin homology | 83.18 | |
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 82.32 | |
| PF10824 | 100 | DUF2580: Protein of unknown function (DUF2580); In | 81.72 |
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
Probab=98.35 E-value=2.1e-06 Score=61.52 Aligned_cols=63 Identities=24% Similarity=0.416 Sum_probs=46.2
Q ss_pred CCCCCcceeEEeecCceeeeeccccCCCCCc-c-ceeEEeeeccccceeeeecChhHHHHHHHHHHH
Q 041344 3 RNEPTVKGTITFDENSTIAISPVNFHGLPKY-D-GCCFYIGTPQKKDYFLCAETPGAARAWVSTLHA 67 (236)
Q Consensus 3 R~e~~~kG~I~fDa~STitiSPvNf~g~~kY-D-gCCfyIgtpqkK~yfLcAETp~aaraWvstl~A 67 (236)
.+|..++|+|.++...+|.+..-+. +.|+. + .|||-|-| .++.||||||++..+..|+..|+.
T Consensus 35 ~~~~~~~g~I~L~~~~~v~~~~~~~-~~~~~~~~~~~f~i~t-~~r~~~~~a~s~~e~~~Wi~ai~~ 99 (101)
T cd01235 35 FEDTAEKGCIDLAEVKSVNLAQPGM-GAPKHTSRKGFFDLKT-SKRTYNFLAENINEAQRWKEKIQQ 99 (101)
T ss_pred CCCCccceEEEcceeEEEeecCCCC-CCCCCCCCceEEEEEe-CCceEEEECCCHHHHHHHHHHHHh
Confidence 3567899999999888777643332 33432 2 34555544 578999999999999999999975
|
Set binding factor Pleckstrin Homology (PH) domain. Set binding factor is a myotubularin-related pseudo-phosphatase consisting of a Denn domain, a Gram domain, an inactive phosphatase domain, a SID motif and a C-terminal PH domain. Its PH domain is predicted to bind lipids based upon its ability to respond to phosphatidylinositol 3-kinase . |
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF10824 DUF2580: Protein of unknown function (DUF2580); InterPro: IPR022536 This entry represents the ESX-1 secretion-associated protein EspC protein family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 236 | |||
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 2e-09 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 1e-08 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 6e-08 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 3e-07 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 5e-07 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 2e-06 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 3e-06 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 4e-06 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 4e-06 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 1e-05 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 1e-05 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 1e-05 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 2e-05 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 2e-05 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 2e-05 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 3e-05 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 3e-05 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 4e-05 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 5e-05 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 8e-05 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 2e-04 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 2e-04 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 5e-04 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 6e-04 |
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
Score = 52.8 bits (127), Expect = 2e-09
Identities = 14/68 (20%), Positives = 24/68 (35%)
Query: 1 TRRNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA 60
R + KG I E +A D F+ ++ Y CA+ +A+
Sbjct: 42 DHRMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQ 101
Query: 61 WVSTLHAA 68
WV + +
Sbjct: 102 WVDRIQSC 109
|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 236 | |||
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 98.22 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 98.2 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 98.19 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 98.17 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 98.15 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 98.13 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 98.13 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 98.12 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 98.11 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 98.08 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 98.08 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 98.08 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 98.05 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 98.01 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 98.01 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 98.0 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 97.97 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 97.95 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 97.95 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 97.95 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 97.9 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 97.89 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 97.88 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 97.87 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 97.87 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 97.85 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 97.77 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 97.76 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 97.71 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 97.63 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 97.59 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 97.55 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 97.49 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 97.48 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 97.45 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 97.41 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 97.38 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 97.32 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 97.25 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 97.25 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 97.21 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 97.2 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 97.14 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 97.1 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 97.0 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 97.0 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 96.91 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 96.71 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 96.7 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 96.66 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 96.51 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 96.47 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 96.18 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 95.94 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 95.79 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 95.63 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 95.49 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 95.45 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 94.75 | |
| 3zbh_A | 99 | ESXA; unknown function, type 7 secretion, ESAT6 fa | 93.34 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 93.27 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 92.81 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 92.78 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 92.53 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 92.38 | |
| 3gwk_C | 98 | SAG1039, putative uncharacterized protein SAG1039; | 90.33 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 88.21 | |
| 4i0x_B | 103 | ESAT-6-like protein MAB_3113; structural genomics, | 87.99 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 87.97 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 87.55 | |
| 4ioe_A | 93 | Secreted protein ESXB; structural genomics, PSI-bi | 85.13 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 85.04 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 82.76 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 80.07 |
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
Probab=98.22 E-value=2.6e-06 Score=60.98 Aligned_cols=62 Identities=18% Similarity=0.366 Sum_probs=47.5
Q ss_pred CCCCcceeEEeecCceeeeeccccCCCCC---c--cceeEEeeeccccceeeeecChhHHHHHHHHHHHH
Q 041344 4 NEPTVKGTITFDENSTIAISPVNFHGLPK---Y--DGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAA 68 (236)
Q Consensus 4 ~e~~~kG~I~fDa~STitiSPvNf~g~~k---Y--DgCCfyIgtpqkK~yfLcAETp~aaraWvstl~At 68 (236)
.+..++|.|.++..+-+.+.+. +.|. . ..+||.|-||.++.|+|+|+|+.....|+..|+.+
T Consensus 56 ~~~~~~g~i~L~~~~v~~~~~~---~~p~~~~~~~~~~~F~I~~~~~r~~~l~a~s~~e~~~Wi~al~~~ 122 (129)
T 1x1g_A 56 EENRPVGGFSLRGSLVSALEDN---GVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKL 122 (129)
T ss_dssp CCSSCSCCEESTTCCCEECCSS---SSCSSCSSCCCSSCEEECCTTCCCEEECCSSHHHHHHHHHHHHHH
T ss_pred cCCccceEEECcCCEEEEeCCC---CCcccccCCCCCceEEEEcCCCCEEEEEcCCHHHHHHHHHHHHHH
Confidence 4678999999987543333332 2221 1 46899999999889999999999999999999754
|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3zbh_A ESXA; unknown function, type 7 secretion, ESAT6 family proteins, W protein ESS; 1.94A {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3gwk_C SAG1039, putative uncharacterized protein SAG1039; WXG motif, four-helical bundle, viral protein; 1.30A {Streptococcus agalactiae serogroup V} PDB: 3gvm_A 3o9o_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >4i0x_B ESAT-6-like protein MAB_3113; structural genomics, PSI-2, protein structure initiative, in center for structure and function innovation; HET: BME GOL; 1.96A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 236 | ||||
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 2e-06 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 8e-06 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 5e-05 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 8e-05 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 2e-04 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 3e-04 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 3e-04 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 8e-04 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 0.001 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 0.001 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 0.001 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 0.004 |
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: SET binding factor 1, Sbf1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 43.5 bits (101), Expect = 2e-06
Identities = 14/66 (21%), Positives = 24/66 (36%)
Query: 3 RNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWV 62
R + KG I E +A D F+ ++ Y CA+ +A+ WV
Sbjct: 44 RMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWV 103
Query: 63 STLHAA 68
+ +
Sbjct: 104 DRIQSC 109
|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 236 | |||
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 98.73 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 98.63 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 98.31 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 98.31 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.1 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 98.0 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 97.99 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 97.98 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 97.98 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 97.96 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 97.95 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 97.93 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 97.89 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 97.87 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 97.85 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 97.77 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 97.74 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 97.73 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 97.71 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 97.7 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 97.67 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 97.55 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 97.46 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 97.39 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 97.36 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 97.31 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 97.16 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 97.11 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 97.01 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 96.94 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 96.89 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 96.89 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 96.85 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 96.76 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 96.6 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 96.01 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 94.59 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 92.66 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 91.53 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 89.07 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 86.63 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 84.66 |
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: SET binding factor 1, Sbf1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.73 E-value=5.4e-09 Score=71.46 Aligned_cols=66 Identities=21% Similarity=0.394 Sum_probs=56.8
Q ss_pred CCCCCcceeEEeecCceeeeeccccCCCCCccceeEEeeeccccceeeeecChhHHHHHHHHHHHH
Q 041344 3 RNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAA 68 (236)
Q Consensus 3 R~e~~~kG~I~fDa~STitiSPvNf~g~~kYDgCCfyIgtpqkK~yfLcAETp~aaraWvstl~At 68 (236)
.+|..++|+|.++..+.|.+...+.......+.+||++.++..+.|||||||+...+.||..|+.+
T Consensus 44 ~~~~~p~g~i~l~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~s~~e~~~Wv~~l~~a 109 (117)
T d1v5ua_ 44 RMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRIQSC 109 (117)
T ss_dssp SSCSSCCCEEEGGGEEEEECCCCCTTSCSSSCTTTCEEEEESSCEEEEECSSHHHHHHHHHHHHTT
T ss_pred ccccCcceEEEecceEEEeecccccccccccccceEEEeeCCCcEEEEEeCCHHHHHHHHHHHHHH
Confidence 467889999999999989888888888777777777777777789999999999999999999754
|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|