Citrus Sinensis ID: 041344


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
TRRNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRNALGTMTNRITDGPMDDLSIMKETLRVKDEELQNLARDLRARDSTIRDIADKLSETAEAAEAAASAAHTMDEQRRIACAEIERINKESTKQLETCVLKVNFSQLFCGLLHNPIYTL
ccccccccccEEEEcccccEEEcccccccccccccEEEEEcccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccc
cccccccccEEEEEEcccEEEEcccccccccccccEEEEEEcccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEccc
trrneptvkgtitfdenstiaispvnfhglpkydgccfyigtpqkkdyflcaetpGAARAWVSTLHAAQLVLKAHKEAVNslsgngsaklGTVATVVAAANSTAQECSKEIEAAMQISLRNALGTmtnritdgpmddlsIMKETLRVKDEELQNLARDLRARDSTIRDIADKLSETAEAAEAAASAAHTMDEQRRIACAEIERINKESTKQLETCVLKVNFSQLFCgllhnpiytl
trrneptvkgtitfdenstiaiSPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRNALGTMTNRITDGPMDDLSIMKETLRVKDEELQNLardlrardstIRDIADKLSETAEAAEAAASAAHTMDEQRRIACAEIERINKESTKQLETCVLKVNFSQLFCGLLHNPIYTL
TRRNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGtvatvvaaanstaQECSKEIEAAMQISLRNALGTMTNRITDGPMDDLSIMKETLRVKDEELQNLARDLRARDSTIRDIADKLsetaeaaeaaasaaHTMDEQRRIACAEIERINKESTKQLETCVLKVNFSQLFCGLLHNPIYTL
**********TITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAAN*********IEAAMQISLRNALGTM*********************************************************************IACAEIERINKESTKQLETCVLKVNFSQLFCGLLHNPIY**
******T****ITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKA************SAKLGTVATVVAAANSTAQECSKEIEAA**********************DLSIMKETLRVKDEELQNLARDLRARDSTIRDIADKLSE*************TMDEQRRIAC************************QLFCGLLHNPIYTL
*********GTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRNALGTMTNRITDGPMDDLSIMKETLRVKDEELQNLARDLRARDSTIRDIADKLSE*****************QRRIACAEIERINKESTKQLETCVLKVNFSQLFCGLLHNPIYTL
******TVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRNALGTMTN*ITDGPMDDLSIMKETLRVKDEELQNLARDLRARDSTIRDIADKLSETAEAAEAAASAAHTMDEQRRIACAEIERINKESTKQLETCVLKVNFSQLFCGLLHNPIYTL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TRRNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRNALGTMTNRITDGPMDDLSIMxxxxxxxxxxxxxxxxxxxxxDSTIRDIADKLSETAEAAEAAASAAHTMDEQRRIACAEIERINKESTKQLETCVLKVNFSQLFCGLLHNPIYTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
255558688 499 conserved hypothetical protein [Ricinus 0.927 0.438 0.885 1e-104
356501455 490 PREDICTED: uncharacterized protein LOC10 0.966 0.465 0.864 1e-103
356553844 490 PREDICTED: uncharacterized protein LOC10 0.936 0.451 0.877 1e-102
224082584 501 predicted protein [Populus trichocarpa] 0.927 0.437 0.863 1e-101
225446797 500 PREDICTED: uncharacterized protein LOC10 0.923 0.436 0.848 1e-100
357494193 492 hypothetical protein MTR_5g091000 [Medic 0.923 0.443 0.871 2e-99
224066555 501 predicted protein [Populus trichocarpa] 0.966 0.455 0.847 4e-99
449460032 490 PREDICTED: uncharacterized protein LOC10 0.923 0.444 0.830 8e-96
449502140 487 PREDICTED: uncharacterized protein LOC10 0.923 0.447 0.830 8e-96
42570991 381 Pleckstrin homology (PH) domain-containi 0.902 0.559 0.802 2e-92
>gi|255558688|ref|XP_002520368.1| conserved hypothetical protein [Ricinus communis] gi|223540415|gb|EEF41984.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/219 (88%), Positives = 207/219 (94%)

Query: 1   TRRNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA 60
           TRRNEP +KGTI FD NSTI +SPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA
Sbjct: 65  TRRNEPAIKGTIIFDANSTITVSPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA 124

Query: 61  WVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLR 120
           WV+TLHA QLVLKAHKEAVNSLSG GSAKLGTVATVVAAANSTA ECSKEIEAAMQISLR
Sbjct: 125 WVATLHATQLVLKAHKEAVNSLSGTGSAKLGTVATVVAAANSTALECSKEIEAAMQISLR 184

Query: 121 NALGTMTNRITDGPMDDLSIMKETLRVKDEELQNLARDLRARDSTIRDIADKLSETAEAA 180
           NALG + NRITDGPMDDL+IMKETL+VKDEELQNLARDLRARDSTIR+IADKLSETAEAA
Sbjct: 185 NALGMVNNRITDGPMDDLAIMKETLKVKDEELQNLARDLRARDSTIREIADKLSETAEAA 244

Query: 181 EAAASAAHTMDEQRRIACAEIERINKESTKQLETCVLKV 219
           EAAASAAHTMDEQRRIACAEIER++K S KQL++ +LK+
Sbjct: 245 EAAASAAHTMDEQRRIACAEIERLSKASQKQLDSSLLKL 283




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356501455|ref|XP_003519540.1| PREDICTED: uncharacterized protein LOC100820315 [Glycine max] Back     alignment and taxonomy information
>gi|356553844|ref|XP_003545261.1| PREDICTED: uncharacterized protein LOC100792926 [Glycine max] Back     alignment and taxonomy information
>gi|224082584|ref|XP_002306753.1| predicted protein [Populus trichocarpa] gi|222856202|gb|EEE93749.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225446797|ref|XP_002283267.1| PREDICTED: uncharacterized protein LOC100254120 [Vitis vinifera] gi|302143523|emb|CBI22084.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357494193|ref|XP_003617385.1| hypothetical protein MTR_5g091000 [Medicago truncatula] gi|355518720|gb|AET00344.1| hypothetical protein MTR_5g091000 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224066555|ref|XP_002302134.1| predicted protein [Populus trichocarpa] gi|222843860|gb|EEE81407.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449460032|ref|XP_004147750.1| PREDICTED: uncharacterized protein LOC101215308 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449502140|ref|XP_004161554.1| PREDICTED: uncharacterized protein LOC101223787 [Cucumis sativus] Back     alignment and taxonomy information
>gi|42570991|ref|NP_973569.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|330253358|gb|AEC08452.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
TAIR|locus:2052831 504 SWAP70 [Arabidopsis thaliana ( 0.927 0.434 0.671 3.1e-76
TAIR|locus:2052831 SWAP70 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 768 (275.4 bits), Expect = 3.1e-76, P = 3.1e-76
 Identities = 147/219 (67%), Positives = 167/219 (76%)

Query:     1 TRRNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA 60
             TRRNEPT+KGTI FDENSTI+ISPVNF GLPKY+GCC YIGTPQKKDYFLCAETPGAA+A
Sbjct:    66 TRRNEPTIKGTILFDENSTISISPVNFQGLPKYNGCCIYIGTPQKKDYFLCAETPGAAKA 125

Query:    61 WVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGXXXXXXXXXXXXXQECSKEIEAAMQISLR 120
             WV+TLHA QLVLKAHKEAV SLSG+GSA LG              ECS+EI+AAMQISLR
Sbjct:   126 WVTTLHATQLVLKAHKEAVESLSGSGSATLGTVATVVAAANSTALECSREIQAAMQISLR 185

Query:   121 NALGTMTNRITDGPMDDLSIMKETLRVKDEELQNLARDLRARDSTIRDIADKLXXXXXXX 180
             NAL    N+  DGP+DDL+IMKETLRVKDEEL NLAR+LR+RDS I++IADKL       
Sbjct:   186 NALKITPNKPIDGPLDDLTIMKETLRVKDEELHNLARELRSRDSMIKEIADKLSETAEAA 245

Query:   181 XXXXXXXHTMDEQRRIACAEIERINKESTKQLETCVLKV 219
                    HTMDEQR+I C E ER+  +S +Q E   LK+
Sbjct:   246 VAAASAAHTMDEQRKIVCVEFERLTTDSQRQQEATKLKL 284


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.132   0.384    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      236       209   0.00079  112 3  11 22  0.36    33
                                                     31  0.48    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  598 (64 KB)
  Total size of DFA:  166 KB (2098 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  16.50u 0.14s 16.64t   Elapsed:  00:00:01
  Total cpu time:  16.50u 0.14s 16.64t   Elapsed:  00:00:01
  Start:  Fri May 10 08:35:10 2013   End:  Fri May 10 08:35:11 2013


GO:0005543 "phospholipid binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0007165 "signal transduction" evidence=ISS
GO:0035091 "phosphatidylinositol binding" evidence=ISS
GO:0009505 "plant-type cell wall" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_LG_V000477
hypothetical protein (501 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
smart00233102 smart00233, PH, Pleckstrin homology domain 8e-04
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 0.001
pfam00169101 pfam00169, PH, PH domain 0.001
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
 Score = 37.5 bits (87), Expect = 8e-04
 Identities = 12/34 (35%), Positives = 14/34 (41%)

Query: 36  CCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQ 69
            CF I T  +K   L AE+      WV  L  A 
Sbjct: 68  HCFEIKTSDRKTLLLQAESEEEREKWVEALRKAI 101


Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. Length = 102

>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 236
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 98.35
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 98.04
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 97.92
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 97.85
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 97.72
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 97.69
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 97.69
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 97.68
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 97.67
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 97.24
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 97.23
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 97.17
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 97.06
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 97.02
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 96.76
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 96.34
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 96.26
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 95.5
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 95.26
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 95.2
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 95.19
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 94.61
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 94.27
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 91.62
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 90.76
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 90.11
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 88.3
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 87.04
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 83.18
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 82.32
PF10824100 DUF2580: Protein of unknown function (DUF2580); In 81.72
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
Probab=98.35  E-value=2.1e-06  Score=61.52  Aligned_cols=63  Identities=24%  Similarity=0.416  Sum_probs=46.2

Q ss_pred             CCCCCcceeEEeecCceeeeeccccCCCCCc-c-ceeEEeeeccccceeeeecChhHHHHHHHHHHH
Q 041344            3 RNEPTVKGTITFDENSTIAISPVNFHGLPKY-D-GCCFYIGTPQKKDYFLCAETPGAARAWVSTLHA   67 (236)
Q Consensus         3 R~e~~~kG~I~fDa~STitiSPvNf~g~~kY-D-gCCfyIgtpqkK~yfLcAETp~aaraWvstl~A   67 (236)
                      .+|..++|+|.++...+|.+..-+. +.|+. + .|||-|-| .++.||||||++..+..|+..|+.
T Consensus        35 ~~~~~~~g~I~L~~~~~v~~~~~~~-~~~~~~~~~~~f~i~t-~~r~~~~~a~s~~e~~~Wi~ai~~   99 (101)
T cd01235          35 FEDTAEKGCIDLAEVKSVNLAQPGM-GAPKHTSRKGFFDLKT-SKRTYNFLAENINEAQRWKEKIQQ   99 (101)
T ss_pred             CCCCccceEEEcceeEEEeecCCCC-CCCCCCCCceEEEEEe-CCceEEEECCCHHHHHHHHHHHHh
Confidence            3567899999999888777643332 33432 2 34555544 578999999999999999999975



Set binding factor Pleckstrin Homology (PH) domain. Set binding factor is a myotubularin-related pseudo-phosphatase consisting of a Denn domain, a Gram domain, an inactive phosphatase domain, a SID motif and a C-terminal PH domain. Its PH domain is predicted to bind lipids based upon its ability to respond to phosphatidylinositol 3-kinase .

>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>PF10824 DUF2580: Protein of unknown function (DUF2580); InterPro: IPR022536 This entry represents the ESX-1 secretion-associated protein EspC protein family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 2e-09
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 1e-08
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 6e-08
3aj4_A112 Pleckstrin homology domain-containing family B ME; 3e-07
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 5e-07
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 2e-06
2yry_A122 Pleckstrin homology domain-containing family A mem 3e-06
2dkp_A128 Pleckstrin homology domain-containing family A mem 4e-06
2d9y_A117 Pleckstrin homology domain-containing protein fami 4e-06
2d9v_A130 Pleckstrin homology domain-containing protein fami 1e-05
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 1e-05
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 1e-05
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 2e-05
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 2e-05
1u5e_A211 SRC-associated adaptor protein; novel dimerization 2e-05
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 3e-05
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 3e-05
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 4e-05
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 5e-05
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 8e-05
3rcp_A103 Pleckstrin homology domain-containing family A ME; 2e-04
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 2e-04
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3cxb_B112 Pleckstrin homology domain-containing family M mem 5e-04
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 6e-04
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
 Score = 52.8 bits (127), Expect = 2e-09
 Identities = 14/68 (20%), Positives = 24/68 (35%)

Query: 1   TRRNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA 60
             R +   KG I   E   +A            D   F+     ++ Y  CA+   +A+ 
Sbjct: 42  DHRMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQ 101

Query: 61  WVSTLHAA 68
           WV  + + 
Sbjct: 102 WVDRIQSC 109


>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 98.22
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 98.2
3aj4_A112 Pleckstrin homology domain-containing family B ME; 98.19
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 98.17
3rcp_A103 Pleckstrin homology domain-containing family A ME; 98.15
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 98.13
2yry_A122 Pleckstrin homology domain-containing family A mem 98.13
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 98.12
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 98.11
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 98.08
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 98.08
2d9y_A117 Pleckstrin homology domain-containing protein fami 98.08
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 98.05
2dkp_A128 Pleckstrin homology domain-containing family A mem 98.01
1v88_A130 Oxysterol binding protein-related protein 8; vesic 98.01
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 98.0
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 97.97
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 97.95
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 97.95
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 97.95
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 97.9
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 97.89
2d9v_A130 Pleckstrin homology domain-containing protein fami 97.88
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 97.87
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 97.87
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 97.85
1v5p_A126 Pleckstrin homology domain-containing, family A; T 97.77
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 97.76
1u5e_A211 SRC-associated adaptor protein; novel dimerization 97.71
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 97.63
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 97.59
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 97.55
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 97.49
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 97.48
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 97.45
3cxb_B112 Pleckstrin homology domain-containing family M mem 97.41
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 97.38
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 97.32
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 97.25
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 97.25
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 97.21
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 97.2
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.14
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 97.1
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 97.0
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 97.0
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 96.91
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 96.71
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 96.7
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 96.66
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 96.51
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 96.47
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 96.18
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 95.94
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 95.79
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 95.63
1wi1_A126 Calcium-dependent activator protein for secretion, 95.49
2d9w_A127 Docking protein 2; PH domain, structural genomics, 95.45
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 94.75
3zbh_A99 ESXA; unknown function, type 7 secretion, ESAT6 fa 93.34
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 93.27
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 92.81
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 92.78
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 92.53
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 92.38
3gwk_C98 SAG1039, putative uncharacterized protein SAG1039; 90.33
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 88.21
4i0x_B103 ESAT-6-like protein MAB_3113; structural genomics, 87.99
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 87.97
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 87.55
4ioe_A93 Secreted protein ESXB; structural genomics, PSI-bi 85.13
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 85.04
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 82.76
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 80.07
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
Probab=98.22  E-value=2.6e-06  Score=60.98  Aligned_cols=62  Identities=18%  Similarity=0.366  Sum_probs=47.5

Q ss_pred             CCCCcceeEEeecCceeeeeccccCCCCC---c--cceeEEeeeccccceeeeecChhHHHHHHHHHHHH
Q 041344            4 NEPTVKGTITFDENSTIAISPVNFHGLPK---Y--DGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAA   68 (236)
Q Consensus         4 ~e~~~kG~I~fDa~STitiSPvNf~g~~k---Y--DgCCfyIgtpqkK~yfLcAETp~aaraWvstl~At   68 (236)
                      .+..++|.|.++..+-+.+.+.   +.|.   .  ..+||.|-||.++.|+|+|+|+.....|+..|+.+
T Consensus        56 ~~~~~~g~i~L~~~~v~~~~~~---~~p~~~~~~~~~~~F~I~~~~~r~~~l~a~s~~e~~~Wi~al~~~  122 (129)
T 1x1g_A           56 EENRPVGGFSLRGSLVSALEDN---GVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKL  122 (129)
T ss_dssp             CCSSCSCCEESTTCCCEECCSS---SSCSSCSSCCCSSCEEECCTTCCCEEECCSSHHHHHHHHHHHHHH
T ss_pred             cCCccceEEECcCCEEEEeCCC---CCcccccCCCCCceEEEEcCCCCEEEEEcCCHHHHHHHHHHHHHH
Confidence            4678999999987543333332   2221   1  46899999999889999999999999999999754



>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>3zbh_A ESXA; unknown function, type 7 secretion, ESAT6 family proteins, W protein ESS; 1.94A {Geobacillus thermodenitrificans} Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>3gwk_C SAG1039, putative uncharacterized protein SAG1039; WXG motif, four-helical bundle, viral protein; 1.30A {Streptococcus agalactiae serogroup V} PDB: 3gvm_A 3o9o_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>4i0x_B ESAT-6-like protein MAB_3113; structural genomics, PSI-2, protein structure initiative, in center for structure and function innovation; HET: BME GOL; 1.96A {Mycobacterium abscessus} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 236
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 2e-06
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 8e-06
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 5e-05
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 8e-05
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 2e-04
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 3e-04
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 3e-04
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 8e-04
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 0.001
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 0.001
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 0.001
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 0.004
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: SET binding factor 1, Sbf1
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 14/66 (21%), Positives = 24/66 (36%)

Query: 3   RNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWV 62
           R +   KG I   E   +A            D   F+     ++ Y  CA+   +A+ WV
Sbjct: 44  RMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWV 103

Query: 63  STLHAA 68
             + + 
Sbjct: 104 DRIQSC 109


>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 98.73
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 98.31
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 98.31
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 98.0
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 97.99
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 97.98
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 97.96
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 97.95
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 97.93
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 97.89
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 97.87
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 97.85
d1wi1a_126 Calcium-dependent activator protein for secretion, 97.77
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 97.74
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 97.73
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 97.7
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 97.67
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 97.55
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 97.46
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 97.39
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 97.36
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 97.31
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 97.16
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 97.11
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 97.01
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 96.94
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 96.89
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 96.89
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 96.85
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 96.76
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 96.6
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 96.01
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 94.59
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 92.66
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 91.53
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 89.07
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 86.63
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 84.66
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: SET binding factor 1, Sbf1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.73  E-value=5.4e-09  Score=71.46  Aligned_cols=66  Identities=21%  Similarity=0.394  Sum_probs=56.8

Q ss_pred             CCCCCcceeEEeecCceeeeeccccCCCCCccceeEEeeeccccceeeeecChhHHHHHHHHHHHH
Q 041344            3 RNEPTVKGTITFDENSTIAISPVNFHGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAA   68 (236)
Q Consensus         3 R~e~~~kG~I~fDa~STitiSPvNf~g~~kYDgCCfyIgtpqkK~yfLcAETp~aaraWvstl~At   68 (236)
                      .+|..++|+|.++..+.|.+...+.......+.+||++.++..+.|||||||+...+.||..|+.+
T Consensus        44 ~~~~~p~g~i~l~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~s~~e~~~Wv~~l~~a  109 (117)
T d1v5ua_          44 RMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRIQSC  109 (117)
T ss_dssp             SSCSSCCCEEEGGGEEEEECCCCCTTSCSSSCTTTCEEEEESSCEEEEECSSHHHHHHHHHHHHTT
T ss_pred             ccccCcceEEEecceEEEeecccccccccccccceEEEeeCCCcEEEEEeCCHHHHHHHHHHHHHH
Confidence            467889999999999989888888888777777777777777789999999999999999999754



>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure