Citrus Sinensis ID: 041408

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-----
MSQRIYDYRILLPFCKTNEQNLLLFLSKLLIKLLLSESRSRTHKQKPQQQHIIILSLLFQMDDHQDIEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTPNHTLRRLIQAWCADNSAYGIDRIPTPKAPLSKLQIIKLIKDIWKPELQTKTLIQLEVFAAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVGGLEGALSILHFFKITSEYMKLSAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASSKFLQRLKPQIFQNIIRVLKQRVIAQQGINAALKLMLDACPSGRNRMIMVESGAVFELIELELTASEKKTTELILGILFHLCSCADGRAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGNFNFVVQEMSRV
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHcc
ccccEEEEEEEccHHccccccHcHHHHHHHHHHHHHHHHHHHHHcccccccccHccccHHcccccccccccccccccEHHHccccEEEEccccccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHcHcHHHHHHHHHHcccHHcHHHHHHHHHHHHHccccHHHHHHHHHcc
MSQRIYDYRILLPFCKTNEQNLLLFLSKLLIKLLLSesrsrthkqkpqQQHIIILSLLFqmddhqdieipeyficpislqimkdpvtaitgitydrESIEHWLFqgnnnaecpvtkqplpkdldltpnhTLRRLIQAWCAdnsaygidriptpkaplsKLQIIKLIKDIwkpelqtkTLIQLEVFAAENERNRKcmaeagvpRAMLTYIVNCcdknqvggleGALSILHFFKITSEYMKLSAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASSKFLQRLKPQIFQNIIRVLKQRVIAQQGINAALKLMLDacpsgrnrmimVESGAVFELIELELTASEKKTTELILGILFHLCSCADGRAQFLSHRAAIAVVTKRImqvspaadDRAILILSLICKFSGNFNFVVQEMSRV
msqriydyRILLPFCKTNEQNLLLFLSKLLIKLLLSEsrsrthkqkpqQQHIIILSLLFQMDDHQDIEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTPNHTLRRLIQAWCADNsaygidriptpkaplsKLQIIKLIKDIWKPELQTKTLIQLEVFAAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVGGLEGALSILHFFKITSEYMKLSAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASSKFLQRLKPQIFQNIIRVLKQRVIAQQGINAALKLMLDACPSGRNRMIMVESGAVFELIELELTASEKKTTELILGILFHLCSCADGRAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGNFNFvvqemsrv
MSQRIYDYRILLPFCKTNEQNlllflsklliklllsESRSRThkqkpqqqhiiiLSLLFQMDDHQDIEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTPNHTLRRLIQAWCADNSAYGIDRIPTPKAPLSKLQIIKLIKDIWKPELQTKTLIQLEVFAAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVGGLEGALSILHFFKITSEYMKLSAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASSKFLQRLKPQIFQNIIRVLKQRVIAQQGINAALKLMLDACPSGRNRMIMVESGAVFELIELELTASEKKTTELILGILFHLCSCADGRAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGNFNFVVQEMSRV
****IYDYRILLPFCKTNEQNLLLFLSKLLIKLLL***************HIIILSLLFQMDDHQDIEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTPNHTLRRLIQAWCADNSAYGIDRIPTPKAPLSKLQIIKLIKDIWKPELQTKTLIQLEVFAAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVGGLEGALSILHFFKITSEYMKLSAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASSKFLQRLKPQIFQNIIRVLKQRVIAQQGINAALKLMLDACPSGRNRMIMVESGAVFELIELELTASEKKTTELILGILFHLCSCADGRAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGNFNFVV******
*****************************LI***************************************EYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTPNHTLRRLIQAWCADNSAYGIDRIP**KAPLSKLQIIKLIKD********KTLIQLEVFAAENERNRKCMAEAGVPRAMLTYIV**********LEGALSILHFFKITSEYMKLSAFEIDKIVESFTWVLALDD*******EIKSHALRILKNIIQAASSKFLQRLKPQIFQNIIRVLKQRVIAQQGINAALKLMLDACPSGRNRMIMVESGAVFELIELELTASEKKTTELILGILFHLCSCADGRAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGNFNFVVQEMSRV
MSQRIYDYRILLPFCKTNEQNLLLFLSKLLIKLLLSES***********QHIIILSLLFQMDDHQDIEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTPNHTLRRLIQAWCADNSAYGIDRIPTPKAPLSKLQIIKLIKDIWKPELQTKTLIQLEVFAAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVGGLEGALSILHFFKITSEYMKLSAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASSKFLQRLKPQIFQNIIRVLKQRVIAQQGINAALKLMLDACPSGRNRMIMVESGAVFELIELELTASEKKTTELILGILFHLCSCADGRAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGNFNFVVQEMSRV
***RIYDYRILLPFCKTNEQNLLLFLSKLLIKLLLSESRSRTH*********************QDIEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTPNHTLRRLIQAWCADNSAYGIDRIPTPKAPLSKLQIIKLIKDIWKPELQTKTLIQLEVFAAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVGGLEGALSILHFFKITSEYMKLSAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASSKFLQRLKPQIFQNIIRVLKQRVIAQQGINAALKLMLDACPSGRNRMIMVESGAVFELIELELTASEKKTTELILGILFHLCSCADGRAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGNFNFVVQE*SR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQRIYDYRILLPFCKTNEQNLLLFLSKLLIKLLLSESRSRTHKQKPQQQHIIILSLLFQMDDHQDIEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTPNHTLRRLIQAWCADNSAYGIDRIPTPKAPLSKLQIIKLIKDIWKPELQTKTLIQLEVFAAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVGGLEGALSILHFFKITSEYMKLSAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASSKFLQRLKPQIFQNIIRVLKQRVIAQQGINAALKLMLDACPSGRNRMIMVESGAVFELIELELTASEKKTTELILGILFHLCSCADGRAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGNFNFVVQEMSRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query425 2.2.26 [Sep-21-2011]
Q9SF15456 E3 ubiquitin-protein liga yes no 0.825 0.769 0.430 3e-84
Q84TG3411 E3 ubiquitin-protein liga no no 0.795 0.822 0.431 2e-72
Q9SVC6435 E3 ubiquitin-protein liga no no 0.818 0.8 0.378 2e-63
Q9LT79421 U-box domain-containing p no no 0.788 0.795 0.313 1e-36
Q9FXA4421 U-box domain-containing p no no 0.774 0.781 0.309 8e-32
Q9C8D1431 U-box domain-containing p no no 0.738 0.728 0.280 7e-29
Q5PNY6435 U-box domain-containing p no no 0.776 0.758 0.280 2e-26
Q0IMG9694 E3 ubiquitin-protein liga no no 0.395 0.242 0.346 1e-20
A2ZLU6694 Protein spotted leaf 11 O N/A no 0.395 0.242 0.346 1e-20
Q9LSA6415 U-box domain-containing p no no 0.778 0.797 0.266 1e-19
>sp|Q9SF15|PUB24_ARATH E3 ubiquitin-protein ligase PUB24 OS=Arabidopsis thaliana GN=PUB24 PE=1 SV=1 Back     alignment and function desciption
 Score =  312 bits (800), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 178/413 (43%), Positives = 249/413 (60%), Gaps = 62/413 (15%)

Query: 61  MD-DHQDIEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPL 119
           MD + ++IEIP YFICPISL+IMKDPVT ++GITYDR++I  WL        CPVTKQPL
Sbjct: 1   MDQEEEEIEIPNYFICPISLEIMKDPVTTVSGITYDRQNIVKWL---EKVPSCPVTKQPL 57

Query: 120 PKDLDLTPNHTLRRLIQAWCADNSAYGIDRIPTPKAPLSKLQIIKLIKDIWKPELQT--- 176
           P D DLTPNH LRRLIQ WC +N   G+ RI TP+ P  KL +++ IK++ K   +    
Sbjct: 58  PLDSDLTPNHMLRRLIQHWCVENETRGVVRISTPRVPPGKLNVVEEIKNLKKFGQEALGR 117

Query: 177 -KTLIQLEVFAAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVG-----GLEGALSILHF 230
            +TL +LEV A +   NR+ M E GV ++++ ++V C  +++ G     GL+ +L +LH 
Sbjct: 118 EETLQKLEVLAMDG-NNRRLMCECGVHKSLILFVVKCTSEDEDGRRRIKGLDESLRLLHL 176

Query: 231 FKITSEYMKLSAFEIDKIVESFTWVLALDDESIENHKE---IKSHALRILKNIIQAASSK 287
             I S   K    E D+++ES TWVL         H+E    K++ + +L+N+ +  SS 
Sbjct: 177 IGIPSNDAKTILMENDRVMESLTWVL---------HQEDFLSKAYTIVLLRNLTEYTSSH 227

Query: 288 FLQRLKPQIFQNIIRVLKQRV----------------------------------IAQQG 313
            ++RL P+IF+ II  LK  V                                  + +Q 
Sbjct: 228 IVERLNPEIFKGIIGFLKDVVNSVNRTSPTVRETVQSSSRPSLGKTEPSKLDHSLVIKQA 287

Query: 314 INAALKLMLDACPSGRNRMIMVESGAVFELIELELT-ASEKKTTELILGILFHLCSCADG 372
           + AAL ++L+     RNR ++V+ GAV ELIELE++   EK+ TEL+LG+L  LC CA+G
Sbjct: 288 VTAALMILLETSSWSRNRSLLVDLGAVSELIELEISYTGEKRITELMLGVLSRLCCCANG 347

Query: 373 RAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGNFNFVVQEMSRV 425
           RA+ L+HR  IAVVTKR+++VSPAADDRAI IL+ + KFS   N VV+EM  V
Sbjct: 348 RAEILAHRGGIAVVTKRLLRVSPAADDRAISILTTVSKFSPE-NMVVEEMVNV 399
E3 ubiquitin-protein ligase that acts as negative regulator of the immunity triggered by the pathogen-associated molecular patterns (PAMPs), in association with PUB22 and PUB23.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q84TG3|PUB23_ARATH E3 ubiquitin-protein ligase PUB23 OS=Arabidopsis thaliana GN=PUB23 PE=1 SV=1 Back     alignment and function description
>sp|Q9SVC6|PUB22_ARATH E3 ubiquitin-protein ligase PUB22 OS=Arabidopsis thaliana GN=PUB22 PE=1 SV=1 Back     alignment and function description
>sp|Q9LT79|PUB25_ARATH U-box domain-containing protein 25 OS=Arabidopsis thaliana GN=PUB25 PE=2 SV=1 Back     alignment and function description
>sp|Q9FXA4|PUB26_ARATH U-box domain-containing protein 26 OS=Arabidopsis thaliana GN=PUB26 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8D1|PUB20_ARATH U-box domain-containing protein 20 OS=Arabidopsis thaliana GN=PUB20 PE=2 SV=1 Back     alignment and function description
>sp|Q5PNY6|PUB21_ARATH U-box domain-containing protein 21 OS=Arabidopsis thaliana GN=PUB21 PE=2 SV=1 Back     alignment and function description
>sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 Back     alignment and function description
>sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2 Back     alignment and function description
>sp|Q9LSA6|PUB29_ARATH U-box domain-containing protein 29 OS=Arabidopsis thaliana GN=PUB29 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query425
224088100409 predicted protein [Populus trichocarpa] 0.832 0.865 0.642 1e-130
255566135403 Spotted leaf protein, putative [Ricinus 0.835 0.880 0.65 1e-129
225439450406 PREDICTED: E3 ubiquitin-protein ligase P 0.828 0.866 0.610 1e-124
224140016408 predicted protein [Populus trichocarpa] 0.832 0.867 0.602 1e-122
356498689405 PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu 0.828 0.869 0.581 1e-111
359479109466 PREDICTED: E3 ubiquitin-protein ligase P 0.832 0.759 0.522 1e-105
147853384437 hypothetical protein VITISV_017908 [Viti 0.832 0.810 0.516 1e-103
224106714410 predicted protein [Populus trichocarpa] 0.837 0.868 0.528 1e-102
224059214408 predicted protein [Populus trichocarpa] 0.835 0.870 0.533 1e-102
255545323347 Spotted leaf protein, putative [Ricinus 0.797 0.976 0.505 8e-96
>gi|224088100|ref|XP_002308324.1| predicted protein [Populus trichocarpa] gi|222854300|gb|EEE91847.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/361 (64%), Positives = 285/361 (78%), Gaps = 7/361 (1%)

Query: 66  DIEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDL 125
           DIE+P++F+CPISLQIMKDPVT ITGITYDRESIEHWLF   N A CPVTKQPL KDLDL
Sbjct: 3   DIEVPKFFVCPISLQIMKDPVTTITGITYDRESIEHWLFTSQNTA-CPVTKQPLQKDLDL 61

Query: 126 TPNHTLRRLIQAWCADNSAYGIDRIPTPKAPLSKLQIIKLIKDIWKPELQTKTLIQLEVF 185
           TPNHTLRRLIQAWC +N+++G+DRIPTPK  L K  ++KLIK++   ELQ KTL +LE+ 
Sbjct: 62  TPNHTLRRLIQAWCTENASHGVDRIPTPKPCLDKAHVLKLIKNLSHHELQIKTLTRLELL 121

Query: 186 AAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVGGLEGALSILHFFKIT-SEYMKLSAFE 244
           AAENERNRKCM +AG+P+AML +I  C  K QV G++ ALSIL F +I  SE     +  
Sbjct: 122 AAENERNRKCMVDAGLPKAMLLFIAACFKKGQVSGIQEALSILCFIRIPRSESRAFYSEN 181

Query: 245 IDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASSKFLQRLKPQIFQNIIRVL 304
            DKI+ES TWVL      +EN+  +KSHA  +LK +++ ASS  L+RLKP+ F+ I+ VL
Sbjct: 182 DDKIIESLTWVLGC---KMENYATVKSHAASVLKMLLEEASSSVLERLKPEFFERIVGVL 238

Query: 305 KQRVIAQQGINAALKLMLDACPSGRNRMIMVESGAVFELIELELTASEKKTTELILGILF 364
           ++R I  QGINAAL+++L+ACP GRNR +MVESGAVFELIELEL + E++TTEL LG+LF
Sbjct: 239 RER-ITHQGINAALQVLLNACPWGRNRKMMVESGAVFELIELELGSPERRTTELNLGVLF 297

Query: 365 HLCSCADGRAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGNFNFVVQEMSR 424
           HLC CA+GRAQFLSH  +IAVV KRI++VSPA DDRAILILS ICKFSG  + V+QEM+ 
Sbjct: 298 HLCCCAEGRAQFLSHGGSIAVVAKRILRVSPAVDDRAILILSQICKFSGT-SMVIQEMAD 356

Query: 425 V 425
           V
Sbjct: 357 V 357

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255566135|ref|XP_002524055.1| Spotted leaf protein, putative [Ricinus communis] gi|223536623|gb|EEF38265.1| Spotted leaf protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225439450|ref|XP_002265057.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140016|ref|XP_002323383.1| predicted protein [Populus trichocarpa] gi|222868013|gb|EEF05144.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356498689|ref|XP_003518182.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase PUB24-like [Glycine max] Back     alignment and taxonomy information
>gi|359479109|ref|XP_002275220.2| PREDICTED: E3 ubiquitin-protein ligase PUB24-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147853384|emb|CAN80214.1| hypothetical protein VITISV_017908 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106714|ref|XP_002314258.1| predicted protein [Populus trichocarpa] gi|222850666|gb|EEE88213.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224059214|ref|XP_002299771.1| predicted protein [Populus trichocarpa] gi|222847029|gb|EEE84576.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255545323|ref|XP_002513722.1| Spotted leaf protein, putative [Ricinus communis] gi|223547173|gb|EEF48669.1| Spotted leaf protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query425
TAIR|locus:2039265411 PUB23 "plant U-box 23" [Arabid 0.788 0.815 0.440 5.5e-70
TAIR|locus:2079964435 PUB22 "plant U-box 22" [Arabid 0.348 0.340 0.562 1.6e-40
TAIR|locus:2090604421 PUB25 "plant U-box 25" [Arabid 0.788 0.795 0.313 3.4e-38
TAIR|locus:2012136421 PUB26 "plant U-box 26" [Arabid 0.783 0.790 0.295 2.4e-35
TAIR|locus:2169861435 AT5G37490 [Arabidopsis thalian 0.825 0.806 0.263 1.5e-28
TAIR|locus:2013850431 CMPG1 ""CYS, MET, PRO, and GLY 0.774 0.763 0.297 8.2e-28
TAIR|locus:2144846409 AT5G09800 [Arabidopsis thalian 0.783 0.814 0.292 2e-22
TAIR|locus:2093974415 PUB29 "plant U-box 29" [Arabid 0.785 0.804 0.268 4.4e-22
TAIR|locus:2152049444 AT5G65920 [Arabidopsis thalian 0.16 0.153 0.535 1.3e-19
TAIR|locus:2174814420 CMPG2 ""CYS, MET, PRO, and GLY 0.776 0.785 0.263 4.2e-18
TAIR|locus:2039265 PUB23 "plant U-box 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 709 (254.6 bits), Expect = 5.5e-70, P = 5.5e-70
 Identities = 156/354 (44%), Positives = 229/354 (64%)

Query:    65 QDIEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLD 124
             ++IEIP +F+CPISL+IMKDPV   TGITYDR+SIE WLF G  N+ CPVTKQ +  D D
Sbjct:     8 EEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNS-CPVTKQDIT-DAD 65

Query:   125 LTPNHTLRRLIQAWCADNSAYGIDRIPTPKAPLSKLQIIKLIKDIWKP-ELQTKTLIQLE 183
             LTPNHTLRRLIQ+WC  N++YG++RIPTP+ P+ K +I KLI+D     E Q K L +L 
Sbjct:    66 LTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIRDSASSHENQVKCLKRLR 125

Query:   184 VFAAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVGGL-EGALSILHFFKITSEYMK--L 240
                +EN  N++C+  AGVP   L  IV+   +N  G L + AL++L+  + +   +K  L
Sbjct:   126 QIVSENATNKRCLEAAGVPE-FLANIVSNDSEN--GSLTDEALNLLYHLETSETVLKNLL 182

Query:   241 SAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASSKFLQRLKPQIFQNI 300
             +  + + IV+S T ++           E + +A  +LKNI++ A       LKP++F  +
Sbjct:   183 NNKKDNNIVKSLTKIMQ------RGMYESRVYATLLLKNILEVADPMQSMTLKPEVFTEV 236

Query:   301 IRVLKQRVIAQQGINAALKLMLDACPSGRNRMIMVESGAVFELIEL---ELTASEKKTTE 357
             +++L  R I+Q+   AA+ ++++ CP GRNR   VE+G +  +IEL   E   SE++  E
Sbjct:   237 VQILDDR-ISQKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERRGPE 295

Query:   358 LILGILFHLCSCADGRAQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKF 411
             + + +L  LC CA+GRA+FL+H AAIAVV K+I++VS  A DRA+ +L  + +F
Sbjct:   296 MAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRF 349
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA;IGI;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0016567 "protein ubiquitination" evidence=IEA;IDA
GO:0010200 "response to chitin" evidence=IEP;RCA
GO:0005829 "cytosol" evidence=IDA
GO:0009414 "response to water deprivation" evidence=IMP
GO:0002679 "respiratory burst involved in defense response" evidence=IGI;RCA
GO:0006952 "defense response" evidence=IGI
GO:0051865 "protein autoubiquitination" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0035556 "intracellular signal transduction" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TAIR|locus:2079964 PUB22 "plant U-box 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090604 PUB25 "plant U-box 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012136 PUB26 "plant U-box 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169861 AT5G37490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013850 CMPG1 ""CYS, MET, PRO, and GLY protein 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144846 AT5G09800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093974 PUB29 "plant U-box 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152049 AT5G65920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174814 CMPG2 ""CYS, MET, PRO, and GLY protein 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query425
smart0050463 smart00504, Ubox, Modified RING finger domain 2e-22
pfam0456473 pfam04564, U-box, U-box domain 6e-19
COG5113929 COG5113, UFD2, Ubiquitin fusion degradation protei 8e-06
pfam1178957 pfam11789, zf-Nse, Zinc-finger of the MIZ type in 8e-05
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 2e-04
>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information 
 Score = 90.0 bits (224), Expect = 2e-22
 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 72  YFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTPNHTL 131
            F+CPISL++MKDPV   +G TY+R +IE WL    ++   PVT QPL    DL PN  L
Sbjct: 1   EFLCPISLEVMKDPVILPSGQTYERSAIEKWL---LSHGTDPVTGQPLT-HEDLIPNLAL 56

Query: 132 RRLIQAW 138
           +  IQ W
Sbjct: 57  KSAIQEW 63

Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination. Length = 63
>gnl|CDD|203049 pfam04564, U-box, U-box domain Back     alignment and domain information
>gnl|CDD|227444 COG5113, UFD2, Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|192832 pfam11789, zf-Nse, Zinc-finger of the MIZ type in Nse subunit Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 425
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.92
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.92
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.88
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 99.87
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.86
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.85
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.85
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.85
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.82
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.7
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.69
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.57
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.55
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.44
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.42
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.34
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.34
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.32
KOG1048 717 consensus Neural adherens junction protein Plakoph 99.28
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.27
KOG1048 717 consensus Neural adherens junction protein Plakoph 99.25
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.23
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.23
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.16
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 99.16
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.16
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 98.99
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.94
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.9
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.86
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.86
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 98.8
KOG2042943 consensus Ubiquitin fusion degradation protein-2 [ 98.73
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.71
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.71
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.71
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.71
KOG0287442 consensus Postreplication repair protein RAD18 [Re 98.7
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 98.7
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 98.68
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.66
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 98.66
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.65
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.59
PHA02929238 N1R/p28-like protein; Provisional 98.57
COG5113929 UFD2 Ubiquitin fusion degradation protein 2 [Postt 98.56
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.56
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.53
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.51
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.5
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.49
PRK09687280 putative lyase; Provisional 98.48
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.47
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.45
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.45
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.44
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.39
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.27
PHA02926242 zinc finger-like protein; Provisional 98.24
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.18
PRK09687280 putative lyase; Provisional 98.14
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.1
COG5222427 Uncharacterized conserved protein, contains RING Z 98.09
KOG4646173 consensus Uncharacterized conserved protein, conta 98.06
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.06
PF1463444 zf-RING_5: zinc-RING finger domain 98.02
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.0
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.95
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.94
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 97.94
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 97.9
KOG2660331 consensus Locus-specific chromosome binding protei 97.9
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.9
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 97.88
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 97.88
KOG4646173 consensus Uncharacterized conserved protein, conta 97.87
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.83
KOG1293 678 consensus Proteins containing armadillo/beta-caten 97.82
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 97.79
KOG0297391 consensus TNF receptor-associated factor [Signal t 97.74
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.73
KOG2973353 consensus Uncharacterized conserved protein [Funct 97.71
PF05536 543 Neurochondrin: Neurochondrin 97.7
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.69
KOG0289 506 consensus mRNA splicing factor [General function p 97.68
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 97.68
KOG2734 536 consensus Uncharacterized conserved protein [Funct 97.67
PF05536 543 Neurochondrin: Neurochondrin 97.65
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.63
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 97.6
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.58
KOG1293678 consensus Proteins containing armadillo/beta-caten 97.57
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 97.51
PF04641260 Rtf2: Rtf2 RING-finger 97.47
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.41
KOG2734 536 consensus Uncharacterized conserved protein [Funct 97.38
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.29
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.29
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.27
KOG2973 353 consensus Uncharacterized conserved protein [Funct 97.22
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.19
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.19
PF14664 371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.17
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.17
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.15
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.15
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.13
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.13
PTZ00429 746 beta-adaptin; Provisional 97.12
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.08
COG5369743 Uncharacterized conserved protein [Function unknow 97.07
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 96.94
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.84
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.84
PTZ00429 746 beta-adaptin; Provisional 96.82
KOG4367 699 consensus Predicted Zn-finger protein [Function un 96.79
COG5152259 Uncharacterized conserved protein, contains RING a 96.79
KOG3036293 consensus Protein involved in cell differentiation 96.76
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.73
COG5369 743 Uncharacterized conserved protein [Function unknow 96.72
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.7
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.66
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 96.66
KOG4413 524 consensus 26S proteasome regulatory complex, subun 96.64
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.62
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.61
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.49
KOG2759 442 consensus Vacuolar H+-ATPase V1 sector, subunit H 96.41
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 96.41
KOG2979262 consensus Protein involved in DNA repair [General 96.4
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 96.37
TIGR02270 410 conserved hypothetical protein. Members are found 96.31
KOG3678 832 consensus SARM protein (with sterile alpha and arm 96.25
KOG3678 832 consensus SARM protein (with sterile alpha and arm 96.24
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.16
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.07
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.97
TIGR02270 410 conserved hypothetical protein. Members are found 95.95
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.85
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 95.8
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 95.62
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 95.62
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 95.52
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 95.51
KOG3113293 consensus Uncharacterized conserved protein [Funct 95.42
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 95.37
KOG3036293 consensus Protein involved in cell differentiation 95.3
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.26
KOG0212 675 consensus Uncharacterized conserved protein [Funct 95.08
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 95.04
KOG1242569 consensus Protein containing adaptin N-terminal re 94.99
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 94.95
COG1413335 FOG: HEAT repeat [Energy production and conversion 94.85
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 94.84
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 94.84
KOG1242 569 consensus Protein containing adaptin N-terminal re 94.81
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.72
KOG4413 524 consensus 26S proteasome regulatory complex, subun 94.69
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 94.68
PF05004309 IFRD: Interferon-related developmental regulator ( 94.66
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 94.58
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.57
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 94.54
COG5096 757 Vesicle coat complex, various subunits [Intracellu 94.47
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 94.45
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 94.34
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.33
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 94.05
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 93.97
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 93.83
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 93.62
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 93.59
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 93.58
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 93.5
PF05004309 IFRD: Interferon-related developmental regulator ( 93.49
PF08045257 CDC14: Cell division control protein 14, SIN compo 93.48
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 93.43
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 93.4
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 93.33
COG5109396 Uncharacterized conserved protein, contains RING Z 93.28
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 93.19
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 93.1
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 93.06
PF06025 379 DUF913: Domain of Unknown Function (DUF913); Inter 93.06
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 93.05
KOG0825 1134 consensus PHD Zn-finger protein [General function 92.91
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 92.83
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 92.61
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 92.52
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 92.3
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 92.24
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 92.21
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 92.07
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 92.05
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 92.01
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 91.94
COG5627275 MMS21 DNA repair protein MMS21 [DNA replication, r 91.87
KOG1001674 consensus Helicase-like transcription factor HLTF/ 91.7
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 91.43
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 91.39
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 91.33
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 90.92
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 90.91
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 90.78
PF11701157 UNC45-central: Myosin-binding striated muscle asse 90.56
PF08167165 RIX1: rRNA processing/ribosome biogenesis 90.41
PF08045257 CDC14: Cell division control protein 14, SIN compo 90.36
COG1413 335 FOG: HEAT repeat [Energy production and conversion 90.31
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 90.16
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 89.78
KOG0212 675 consensus Uncharacterized conserved protein [Funct 89.74
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 89.53
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 89.47
KOG2259 823 consensus Uncharacterized conserved protein [Funct 89.22
KOG0883 518 consensus Cyclophilin type, U box-containing pepti 89.17
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 88.99
COG52191525 Uncharacterized conserved protein, contains RING Z 88.88
KOG4535 728 consensus HEAT and armadillo repeat-containing pro 88.78
KOG2259 823 consensus Uncharacterized conserved protein [Funct 88.69
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 88.58
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 88.52
KOG18241233 consensus TATA-binding protein-interacting protein 88.51
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 88.37
PF11701157 UNC45-central: Myosin-binding striated muscle asse 88.1
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 87.98
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 87.84
KOG1824 1233 consensus TATA-binding protein-interacting protein 87.84
KOG149384 consensus Anaphase-promoting complex (APC), subuni 87.53
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 87.49
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 87.46
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 87.44
KOG3002299 consensus Zn finger protein [General function pred 87.04
PF04641260 Rtf2: Rtf2 RING-finger 86.89
COG5096 757 Vesicle coat complex, various subunits [Intracellu 86.83
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 86.55
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 86.49
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 86.48
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 86.41
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 85.8
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 85.49
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 85.49
PF07814361 WAPL: Wings apart-like protein regulation of heter 85.25
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 85.09
COG5175 480 MOT2 Transcriptional repressor [Transcription] 84.98
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 84.95
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 84.89
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 84.8
KOG4535728 consensus HEAT and armadillo repeat-containing pro 84.54
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 84.45
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 84.43
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 84.23
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 84.2
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 84.15
PRK06266178 transcription initiation factor E subunit alpha; V 83.61
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 82.75
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 82.41
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 82.17
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 81.87
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 81.82
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 81.59
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 81.51
KOG2025 892 consensus Chromosome condensation complex Condensi 81.51
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 81.17
KOG2956516 consensus CLIP-associating protein [General functi 80.82
KOG2032533 consensus Uncharacterized conserved protein [Funct 80.78
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 80.73
COG5209315 RCD1 Uncharacterized protein involved in cell diff 80.67
PF08167165 RIX1: rRNA processing/ribosome biogenesis 80.59
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 80.44
COG5209315 RCD1 Uncharacterized protein involved in cell diff 80.23
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information 
Probab=99.92  E-value=7.8e-24  Score=238.36  Aligned_cols=245  Identities=16%  Similarity=0.159  Sum_probs=206.0

Q ss_pred             HHHHHHHHHHhcC--hhHHHHHHHHHHHHhhhchhhhhHHhhcCcHHHHHHHHhhcccCCCcccHHHHHHHHHhcCCChH
Q 041408          159 KLQIIKLIKDIWK--PELQTKTLIQLEVFAAENERNRKCMAEAGVPRAMLTYIVNCCDKNQVGGLEGALSILHFFKITSE  236 (425)
Q Consensus       159 ~~~i~~lv~~l~s--~~~~~~Al~~L~~la~~~~~~r~~i~~~G~i~~Lv~lL~s~~~~~~~~~~~~Al~~L~~L~~~~~  236 (425)
                      .++++.|+..|++  ...+..|++.|++++.++++++..|+++|+||.|+++|.+++..    .+++|+++|.|++.+++
T Consensus       445 ~ggIp~LV~LL~s~s~~iQ~~A~~~L~nLa~~ndenr~aIieaGaIP~LV~LL~s~~~~----iqeeAawAL~NLa~~~~  520 (2102)
T PLN03200        445 REGVQLLISLLGLSSEQQQEYAVALLAILTDEVDESKWAITAAGGIPPLVQLLETGSQK----AKEDSATVLWNLCCHSE  520 (2102)
T ss_pred             cCcHHHHHHHHcCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCCHHHHHHHHcCCCHH----HHHHHHHHHHHHhCCcH
Confidence            3568889988854  57889999999999999999999999999999999999877543    49999999999999887


Q ss_pred             HHHhhhhchhchHHHHHHHHccccccccCCHHHHHHHHHHHHHHHhcccc------------------------------
Q 041408          237 YMKLSAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQAASS------------------------------  286 (425)
Q Consensus       237 ~~~~~v~~~~g~i~~Lv~lL~~~~~~~~~~~~~~~~A~~~L~~L~~~~~~------------------------------  286 (425)
                      +.+.++... |+++.|+.+|++      ++.+.+..|+++|.+|+...++                              
T Consensus       521 qir~iV~~a-GAIppLV~LL~s------gd~~~q~~Aa~AL~nLi~~~d~~~I~~Lv~LLlsdd~~~~~~aL~vLgnIls  593 (2102)
T PLN03200        521 DIRACVESA-GAVPALLWLLKN------GGPKGQEIAAKTLTKLVRTADAATISQLTALLLGDLPESKVHVLDVLGHVLS  593 (2102)
T ss_pred             HHHHHHHHC-CCHHHHHHHHhC------CCHHHHHHHHHHHHHHHhccchhHHHHHHHHhcCCChhHHHHHHHHHHHHHh
Confidence            778877643 899999999987      7888888888888888532111                              


Q ss_pred             -------------------------------------------------hhHhhcchhHHHHHHHHhccccCChHHHHHH
Q 041408          287 -------------------------------------------------KFLQRLKPQIFQNIIRVLKQRVIAQQGINAA  317 (425)
Q Consensus       287 -------------------------------------------------~~~~~~~~g~i~~Lv~lL~~~~~~~~~~~~A  317 (425)
                                                                       ........|+||+|+.+|+++  +.+.++.|
T Consensus       594 l~~~~d~~~~g~~~~ggL~~Lv~LL~sgs~~ikk~Aa~iLsnL~a~~~d~~~avv~agaIpPLV~LLss~--~~~v~keA  671 (2102)
T PLN03200        594 VASLEDLVREGSAANDALRTLIQLLSSSKEETQEKAASVLADIFSSRQDLCESLATDEIINPCIKLLTNN--TEAVATQS  671 (2102)
T ss_pred             hcchhHHHHHhhhccccHHHHHHHHcCCCHHHHHHHHHHHHHHhcCChHHHHHHHHcCCHHHHHHHHhcC--ChHHHHHH
Confidence                                                             011122346778888888777  77888899


Q ss_pred             HHHHHHhCCC--CCchHHHHhhCchHHHHHHhhccCCcchHHHHHHHHHHHhCCHhhHHHHhhccccHHHHHHHHhcCCh
Q 041408          318 LKLMLDACPS--GRNRMIMVESGAVFELIELELTASEKKTTELILGILFHLCSCADGRAQFLSHRAAIAVVTKRIMQVSP  395 (425)
Q Consensus       318 ~~aL~~L~~~--~~n~~~iv~~G~v~~Lv~lL~~~~~~~~~e~Al~~L~~L~~~~e~r~~~~~~~g~i~~Lv~ll~~~s~  395 (425)
                      +++|.+|..+  .+++..++++|+||+|+++|.+. +..+++.|+.+|.+++..++++.++.. .|+++.|+++|..+++
T Consensus       672 A~AL~nL~~~~~~~q~~~~v~~GaV~pL~~LL~~~-d~~v~e~Al~ALanLl~~~e~~~ei~~-~~~I~~Lv~lLr~G~~  749 (2102)
T PLN03200        672 ARALAALSRSIKENRKVSYAAEDAIKPLIKLAKSS-SIEVAEQAVCALANLLSDPEVAAEALA-EDIILPLTRVLREGTL  749 (2102)
T ss_pred             HHHHHHHHhCCCHHHHHHHHHcCCHHHHHHHHhCC-ChHHHHHHHHHHHHHHcCchHHHHHHh-cCcHHHHHHHHHhCCh
Confidence            9999999963  35678889999999999999886 889999999999999999999999976 6789999999999999


Q ss_pred             HHHHHHHHHHHHHhccCCChHHHH
Q 041408          396 AADDRAILILSLICKFSGNFNFVV  419 (425)
Q Consensus       396 ~~~e~a~~~L~~l~~~~~~~~~~v  419 (425)
                      +.+++|+++|..||++.+. .+++
T Consensus       750 ~~k~~Aa~AL~~L~~~~~~-~~~~  772 (2102)
T PLN03200        750 EGKRNAARALAQLLKHFPV-DDVL  772 (2102)
T ss_pred             HHHHHHHHHHHHHHhCCCh-hHHH
Confidence            9999999999999999886 4544

>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query425
1t1h_A78 Nmr Solution Structure Of The U Box Domain From Atp 3e-15
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 2e-07
2f42_A179 Dimerization And U-Box Domains Of Zebrafish C-Termi 3e-07
2oxq_C80 Structure Of The Ubch5 :chip U-Box Complex Length = 6e-07
2c2v_S78 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 1e-06
>pdb|1T1H|A Chain A, Nmr Solution Structure Of The U Box Domain From Atpub14, An Armadillo Repeat Containing Protein From Arabidopsis Thaliana Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 38/75 (50%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
Query: 68  EIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTP 127
           E PEYF CPISL++MKDPV   TG TY+R SI+ WL  G+    CP +++ L     LTP
Sbjct: 4   EFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKT--CPKSQETL-LHAGLTP 60
Query: 128 NHTLRRLIQAWCADN 142
           N+ L+ LI  WC  N
Sbjct: 61  NYVLKSLIALWCESN 75
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|2F42|A Chain A, Dimerization And U-Box Domains Of Zebrafish C-Terminal Of Hsp70 Interacting Protein Length = 179 Back     alignment and structure
>pdb|2OXQ|C Chain C, Structure Of The Ubch5 :chip U-Box Complex Length = 80 Back     alignment and structure
>pdb|2C2V|S Chain S, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 78 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query425
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 2e-37
2f42_A179 STIP1 homology and U-box containing protein 1; cha 2e-34
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 2e-31
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 1e-30
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 3e-30
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 2e-21
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 3e-20
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 8e-19
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 2e-14
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 6e-12
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 3e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 4e-07
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-06
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 6e-06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 9e-06
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-05
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-05
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-04
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-05
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-05
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-05
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 4e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-05
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 4e-04
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 4e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 5e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 6e-04
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 Back     alignment and structure
 Score =  129 bits (327), Expect = 2e-37
 Identities = 38/75 (50%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 68  EIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTP 127
           E PEYF CPISL++MKDPV   TG TY+R SI+ WL  G+    CP +++ L     LTP
Sbjct: 4   EFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKT--CPKSQETLL-HAGLTP 60

Query: 128 NHTLRRLIQAWCADN 142
           N+ L+ LI  WC  N
Sbjct: 61  NYVLKSLIALWCESN 75
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query425
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.95
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.95
3nmz_A458 APC variant protein; protein-protein complex, arma 99.94
3nmz_A458 APC variant protein; protein-protein complex, arma 99.94
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.93
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.93
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.93
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.91
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.91
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.9
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.9
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.9
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.9
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.89
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.88
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.88
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.88
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.88
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.87
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.87
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.86
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.86
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.86
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.85
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.85
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.85
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.85
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.84
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.84
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.84
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.84
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.83
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.82
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.82
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.82
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.81
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.81
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.8
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.79
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.78
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.77
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.77
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.74
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.72
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.7
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.65
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 99.64
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.59
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.53
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.49
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.48
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.44
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.43
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.41
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.4
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.39
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.39
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.38
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.38
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.37
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.35
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.35
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.35
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.35
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.34
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.33
3grl_A 651 General vesicular transport factor P115; vesicle t 99.32
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.31
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.31
3grl_A 651 General vesicular transport factor P115; vesicle t 99.28
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.27
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.25
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.22
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.2
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.19
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.18
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.16
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.15
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.12
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.12
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.11
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.04
2ect_A78 Ring finger protein 126; metal binding protein, st 99.02
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.92
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.9
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.88
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.88
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.86
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.85
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.85
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.84
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.83
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.82
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.79
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.76
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.74
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.71
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.69
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.67
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.66
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.65
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.57
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.55
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.55
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.54
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.52
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.52
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.46
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.44
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.32
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.27
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.25
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.24
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.23
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 98.22
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.2
2ea5_A68 Cell growth regulator with ring finger domain prot 98.18
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.12
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 98.1
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.1
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 97.99
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.97
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.94
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 97.92
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.92
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.9
1qgr_A 876 Protein (importin beta subunit); transport recepto 97.85
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.83
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 97.74
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.74
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.73
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 97.71
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.69
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 97.64
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.6
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.55
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 97.54
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.51
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.39
1qgr_A 876 Protein (importin beta subunit); transport recepto 97.29
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.08
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.02
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.02
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.0
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.94
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.94
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.83
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.71
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.61
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 96.49
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 96.0
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.69
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.62
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 95.57
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 95.56
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.53
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 95.34
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.3
1ho8_A 480 Vacuolar ATP synthase subunit H; heat repeat, hydr 95.2
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 94.87
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.6
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.32
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 93.91
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 93.79
3nw0_A238 Non-structural maintenance of chromosomes element 92.41
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 92.09
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 91.86
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 91.21
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 89.84
3c2g_A 619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 89.27
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 88.64
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 88.19
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 87.32
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 86.53
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 85.92
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 85.86
2x1g_F 971 Cadmus; transport protein, developmental protein, 84.71
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 84.57
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 84.22
3eg5_B 383 Protein diaphanous homolog 1; protein-protein comp 84.22
2kkx_A102 Uncharacterized protein ECS2156; methods developme 82.86
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 82.82
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 81.13
2x19_B 963 Importin-13; nuclear transport, protein transport; 80.6
2x1g_F 971 Cadmus; transport protein, developmental protein, 80.46
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
Probab=99.95  E-value=3.6e-27  Score=231.89  Aligned_cols=242  Identities=12%  Similarity=0.074  Sum_probs=203.5

Q ss_pred             HHHHHHHHHHhc-------------ChhHHHHHHHHHHHHhhhchhhhhHHhh-cCcHHHHHHHHhhcccCCCcccHHHH
Q 041408          159 KLQIIKLIKDIW-------------KPELQTKTLIQLEVFAAENERNRKCMAE-AGVPRAMLTYIVNCCDKNQVGGLEGA  224 (425)
Q Consensus       159 ~~~i~~lv~~l~-------------s~~~~~~Al~~L~~la~~~~~~r~~i~~-~G~i~~Lv~lL~s~~~~~~~~~~~~A  224 (425)
                      .+++++|+..+.             ++..+..|+++|.+++.+++.+|..+.. .|+||.|+.+|.+++.    .+++.|
T Consensus        72 ~G~l~~Lv~LL~~~~~~~~~~~~~~~~~~q~~Aa~aL~nLa~~~~~~k~~i~~~~GaIp~LV~LL~s~~~----~v~~~A  147 (354)
T 3nmw_A           72 LGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESE----DLQQVI  147 (354)
T ss_dssp             TTHHHHHHHHHHHHHHHHTTSCCHHHHHHHHHHHHHHHHHTSSCHHHHHHHHHCHHHHHHHHHGGGCSCH----HHHHHH
T ss_pred             cCCHHHHHHHHhcccccccccCCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHcCCcHHHHHHHHCCCCH----HHHHHH
Confidence            356777777762             1367899999999999888889988865 5669999999987654    449999


Q ss_pred             HHHHHhcCCC-hHHHHhhhhchhchHHHHHHHHccccccccCCHHHHHHHHHHHHHHHh-cccchhHhhcchhHHHHHHH
Q 041408          225 LSILHFFKIT-SEYMKLSAFEIDKIVESFTWVLALDDESIENHKEIKSHALRILKNIIQ-AASSKFLQRLKPQIFQNIIR  302 (425)
Q Consensus       225 l~~L~~L~~~-~~~~~~~v~~~~g~i~~Lv~lL~~~~~~~~~~~~~~~~A~~~L~~L~~-~~~~~~~~~~~~g~i~~Lv~  302 (425)
                      +++|.+|+.+ ++..+..+.+. |+|+.|+.+|.+     .++.+.++.|+.+|++|+. .++++..++...|++|.|++
T Consensus       148 ~~aL~nLs~~~~~~~k~~i~~~-G~Ip~Lv~lL~~-----~~~~~~~~~A~~aL~nLs~~~~~nk~~i~~~~Gai~~Lv~  221 (354)
T 3nmw_A          148 ASVLRNLSWRADVNSKKTLREV-GSVKALMECALE-----VKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVG  221 (354)
T ss_dssp             HHHHHHHHTTCCHHHHHHHHHT-THHHHHHHHHHH-----CCCHHHHHHHHHHHHHHHTTCHHHHHHHHHSTTHHHHHHH
T ss_pred             HHHHHHHhccCCHHHHHHHHHC-CCHHHHHHHHhc-----CCCHHHHHHHHHHHHHHHccChhhhHHHHHhcCcHHHHHH
Confidence            9999999975 44455555543 999999998643     2788999999999999998 45666666656799999999


Q ss_pred             HhccccCCh----HHHHHHHHHHHHhCC----CCCchHHHHhhCchHHHHHHhhccCCcchHHHHHHHHHHHhC-CHhhH
Q 041408          303 VLKQRVIAQ----QGINAALKLMLDACP----SGRNRMIMVESGAVFELIELELTASEKKTTELILGILFHLCS-CADGR  373 (425)
Q Consensus       303 lL~~~~~~~----~~~~~A~~aL~~L~~----~~~n~~~iv~~G~v~~Lv~lL~~~~~~~~~e~Al~~L~~L~~-~~e~r  373 (425)
                      +|..+  ++    ++++.|+++|+||+.    +++++..++++|+||+|+++|.++ +..+++.|+++|.+|+. +++++
T Consensus       222 lL~~~--~~~~~~~v~~~A~~aL~nLs~~~a~~~~~~~~i~~~g~i~~Lv~lL~~~-~~~v~~~A~~aL~nLa~~~~~~~  298 (354)
T 3nmw_A          222 TLTYR--SQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSH-SLTIVSNACGTLWNLSARNPKDQ  298 (354)
T ss_dssp             HTTCC--CSSSCCHHHHHHHHHHHHHHHHHTTCHHHHHHHHTTTHHHHHHHHTTCS-CHHHHHHHHHHHHHHTSSCHHHH
T ss_pred             HhccC--CCcccHHHHHHHHHHHHHHHhhccCCHHHHHHHHHcCCHHHHHHHHcCC-ChHHHHHHHHHHHHHhCCCHHHH
Confidence            99876  43    589999999999995    778999999999999999999986 88899999999999995 78888


Q ss_pred             HHHhhccccHHHHHHHHhcCChHHHHHHHHHHHHHhccCCC
Q 041408          374 AQFLSHRAAIAVVTKRIMQVSPAADDRAILILSLICKFSGN  414 (425)
Q Consensus       374 ~~~~~~~g~i~~Lv~ll~~~s~~~~e~a~~~L~~l~~~~~~  414 (425)
                      ..+++ .|++|.|+++|..++...++.|+++|++|+.+.+.
T Consensus       299 ~~i~~-~G~i~~Lv~LL~s~~~~i~~~A~~aL~nL~~~~~~  338 (354)
T 3nmw_A          299 EALWD-MGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPA  338 (354)
T ss_dssp             HHHHH-TTHHHHHHTTTTCSSHHHHHHHHHHHHHHHTTCCG
T ss_pred             HHHHH-CCCHHHHHHHHhCCCHHHHHHHHHHHHHHHcCCHH
Confidence            88866 78999999988888899999999999999998776
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2kkx_A Uncharacterized protein ECS2156; methods development, U-box domain, structural genomics, PSI- protein structure initiative; NMR {Escherichia coli} PDB: 2kky_A Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 425
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 5e-19
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 1e-13
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-13
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 2e-12
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 4e-05
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.003
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: E3 ubiquitin ligase PUB14
species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 79.0 bits (194), Expect = 5e-19
 Identities = 38/75 (50%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 68  EIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTP 127
           E PEYF CPISL++MKDPV   TG TY+R SI+ WL  G+    CP +++ L     LTP
Sbjct: 4   EFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKT--CPKSQETLLHA-GLTP 60

Query: 128 NHTLRRLIQAWCADN 142
           N+ L+ LI  WC  N
Sbjct: 61  NYVLKSLIALWCESN 75
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query425
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.87
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.86
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.83
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.8
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.8
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.79
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.78
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.75
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.74
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.57
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.53
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.52
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.44
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.09
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.98
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.98
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.75
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.73
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.58
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.36
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.23
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 97.78
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.75
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.69
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 97.68
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 97.65
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.5
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.46
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.4
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 97.33
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.16
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.04
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 96.96
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 96.84
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.77
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 96.59
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 96.58
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 96.55
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 96.43
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 96.39
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.12
d1ho8a_ 477 Regulatory subunit H of the V-type ATPase {Baker's 95.11
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 94.75
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 94.46
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 86.21
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 84.09
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 81.08
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.87  E-value=3.5e-23  Score=157.15  Aligned_cols=75  Identities=36%  Similarity=0.647  Sum_probs=70.9

Q ss_pred             CCCCCcccCcCCccCCCCceecCCCccccHHHHHHHHHcCCCCCCCCCCCCCCCCCCCCCccHHHHHHHHHHHHcCCC
Q 041408           67 IEIPEYFICPISLQIMKDPVTAITGITYDRESIEHWLFQGNNNAECPVTKQPLPKDLDLTPNHTLRRLIQAWCADNSA  144 (425)
Q Consensus        67 ~~~p~~~~Cpi~~~~m~dPV~~~~g~t~~r~~I~~~~~~~~~~~~cP~~~~~l~~~~~l~pn~~l~~~I~~~~~~n~~  144 (425)
                      .++|++|.||||+++|+|||+++|||||||.||++|+..+  ..+||.|++++.. .++.||..|+++|++|...|+|
T Consensus         2 ~eiP~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~~~--~~~cP~c~~~l~~-~~l~pN~~L~~~I~~~l~~~~~   76 (80)
T d2c2la2           2 RDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRV--GHFNPVTRSPLTQ-EQLIPNLAMKEVIDAFISENGW   76 (80)
T ss_dssp             CCCCSTTBCTTTCSBCSSEEECSSCCEEETTHHHHHHHHT--CSSCTTTCCCCCG-GGCEECHHHHHHHHHHHTTCSC
T ss_pred             CCCCccccCcCcCchhhhhcccCCcCeecHHHHHHHHhcC--CccCCCccccccc-cccccHHHHHHHHHHHHHHCCC
Confidence            4799999999999999999999999999999999999876  4789999999987 8999999999999999999997
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure