Citrus Sinensis ID: 041475

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MYGEQSHMRIAILMYLPNITKRHTFCSYKFSELPFLLYISLFEFIYCTLFSFRNGIGRSTWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEIPLPDYKKIGGTNKAHSYINMDNEEQRLKTLRLSEA
ccccccHHHHHHHHHcHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHcccccccc
cccHHHHHHHHHHHHcccccccccEccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHcccccccccc
MYGEQSHMRIAILMYLpnitkrhtfcsykfselpFLLYISLFEFIYCTLFsfrngigrstWTAKQNKLFENALaiydkdtpdrWHNLARAVGGKTVEEVKRHYEMLAEDVsrieageiplpdykkiggtnkahsyiNMDNEEQRLKTLRLSEA
MYGEQSHMRIAILMYLPNITKRHTFCSYKFSELPFLLYISLFEFIYCTLFSFRNGIGRSTWTAKQNKLFENALAIYDKDTPDRWHNLAravggktveeVKRHYEMLaedvsrieageiplpdykkiggtnkahsyinmdneeqrlktlrlsea
MYGEQSHMRIAILMYLPNITKRHTFCSYKFSELPFLLYISLFEFIYCTLFSFRNGIGRSTWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEIPLPDYKKIGGTNKAHSYINMDNEEQRLKTLRLSEA
*******MRIAILMYLPNITKRHTFCSYKFSELPFLLYISLFEFIYCTLFSFRNGIGRSTWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEIPLPDYKKIG**************************
********RIAILMYLPNITKRHT*****************************************NKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEIPLPD*******************************
********RIAILMYLPNITKRHTFCSYKFSELPFLLYISLFEFIYCTLFSFRNGIGRSTWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEIPLPDYKKIGGTNKAHSYINMDNEEQR*********
*Y**QSHMRIAILMYLPNITKRHTFCSYKFSELPFLLYISLFEFIYCTLFSFR*GIGRSTWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEIPLPDYK*****************************
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYGEQSHMRIAILMYLPNITKRHTFCSYKFSELPFLLYISLFEFIYCTLFSFRNGIGRSTWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEIPLPDYKKIGGTNKAHSYINMDNEEQRLKTLRLSEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
Q1A17397 Protein RADIALIS-like 6 O no no 0.575 0.907 0.576 2e-25
F4JVB8100 Protein RADIALIS-like 1 O no no 0.568 0.87 0.538 2e-25
Q58FS393 Transcription factor RADI N/A no 0.568 0.935 0.541 8e-25
Q9SIJ5101 Protein RADIALIS-like 2 O no no 0.568 0.861 0.543 1e-24
Q6NNN081 Protein RADIALIS-like 3 O no no 0.450 0.851 0.652 2e-22
Q8GW75100 Protein RADIALIS-like 5 O no no 0.496 0.76 0.565 2e-20
Q1G3C477 Protein RADIALIS-like 4 O no no 0.398 0.792 0.622 7e-17
Q8S9H7 307 Transcription factor DIVA N/A no 0.431 0.214 0.573 3e-16
P54103621 DnaJ homolog subfamily C yes no 0.405 0.099 0.387 3e-06
Q7TQ20621 DnaJ homolog subfamily C yes no 0.372 0.091 0.403 6e-06
>sp|Q1A173|RADL6_ARATH Protein RADIALIS-like 6 OS=Arabidopsis thaliana GN=RL6 PE=2 SV=1 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/92 (57%), Positives = 71/92 (77%), Gaps = 4/92 (4%)

Query: 59  STWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEI 118
           S WT  QNK+FE ALA+YDKDTPDRWHN+A+AVGGKTVEEVKRHY++L ED+  IE G +
Sbjct: 10  SPWTFSQNKMFERALAVYDKDTPDRWHNVAKAVGGKTVEEVKRHYDILVEDLINIETGRV 69

Query: 119 PLPDYKKIGGTNKAHSYINMDNEEQRLKTLRL 150
           PLP+YK     +++   IN D + +++K L++
Sbjct: 70  PLPNYKTFESNSRS---IN-DFDTRKMKNLKI 97
Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|F4JVB8|RADL1_ARATH Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1 Back     alignment and function description
>sp|Q58FS3|RAD_ANTMA Transcription factor RADIALIS OS=Antirrhinum majus GN=RAD PE=1 SV=1 Back     alignment and function description
>sp|Q9SIJ5|RADL2_ARATH Protein RADIALIS-like 2 OS=Arabidopsis thaliana GN=RL2 PE=2 SV=1 Back     alignment and function description
>sp|Q6NNN0|RADL3_ARATH Protein RADIALIS-like 3 OS=Arabidopsis thaliana GN=RL3 PE=2 SV=1 Back     alignment and function description
>sp|Q8GW75|RADL5_ARATH Protein RADIALIS-like 5 OS=Arabidopsis thaliana GN=RL5 PE=3 SV=1 Back     alignment and function description
>sp|Q1G3C4|RADL4_ARATH Protein RADIALIS-like 4 OS=Arabidopsis thaliana GN=RL4 PE=2 SV=1 Back     alignment and function description
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description
>sp|P54103|DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus GN=Dnajc2 PE=1 SV=2 Back     alignment and function description
>sp|Q7TQ20|DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus GN=Dnajc2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
25553865495 DNA binding protein, putative [Ricinus c 0.588 0.947 0.739 9e-32
22545827791 PREDICTED: dnaJ homolog subfamily C memb 0.568 0.956 0.677 3e-30
22407017096 predicted protein [Populus trichocarpa] 0.601 0.958 0.677 4e-29
35655388398 PREDICTED: dnaJ homolog subfamily C memb 0.581 0.908 0.645 3e-28
11848968496 unknown [Populus trichocarpa x Populus d 0.601 0.958 0.656 1e-27
44946026794 PREDICTED: protein RADIALIS-like 1-like 0.588 0.957 0.623 7e-27
14776732196 hypothetical protein VITISV_033596 [Viti 0.562 0.895 0.6 1e-26
297741464111 unnamed protein product [Vitis vinifera] 0.562 0.774 0.6 2e-26
359475334101 PREDICTED: dnaJ homolog subfamily C memb 0.562 0.851 0.6 2e-26
110931770100 MYB transcription factor MYB164 [Glycine 0.562 0.86 0.634 3e-26
>gi|255538654|ref|XP_002510392.1| DNA binding protein, putative [Ricinus communis] gi|223551093|gb|EEF52579.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  141 bits (355), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/92 (73%), Positives = 76/92 (82%), Gaps = 2/92 (2%)

Query: 59  STWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEI 118
           S+WT KQNKLFENALAIYDKDTPDRWHNLARAVGGKT+EEVKRHYE+L EDV  IEAG +
Sbjct: 5   SSWTPKQNKLFENALAIYDKDTPDRWHNLARAVGGKTIEEVKRHYELLVEDVREIEAGHV 64

Query: 119 PLPDYKKIGGTNKAHSYINMDNEEQRLKTLRL 150
           PLP+YKK G  +K   Y +   EEQRLK L+L
Sbjct: 65  PLPNYKKAGLGSKG--YCSFVEEEQRLKGLKL 94

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225458277|ref|XP_002282461.1| PREDICTED: dnaJ homolog subfamily C member 2 [Vitis vinifera] gi|302142498|emb|CBI19701.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224070170|ref|XP_002303127.1| predicted protein [Populus trichocarpa] gi|118483240|gb|ABK93523.1| unknown [Populus trichocarpa] gi|222844853|gb|EEE82400.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553883|ref|XP_003545280.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Glycine max] Back     alignment and taxonomy information
>gi|118489684|gb|ABK96643.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|449460267|ref|XP_004147867.1| PREDICTED: protein RADIALIS-like 1-like [Cucumis sativus] gi|449476806|ref|XP_004154839.1| PREDICTED: protein RADIALIS-like 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147767321|emb|CAN68999.1| hypothetical protein VITISV_033596 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741464|emb|CBI32595.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475334|ref|XP_003631660.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|110931770|gb|ABH02884.1| MYB transcription factor MYB164 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
TAIR|locus:202518297 RL6 "RAD-like 6" [Arabidopsis 0.575 0.907 0.576 1.4e-25
TAIR|locus:2049374101 MEE3 "MATERNAL EFFECT EMBRYO A 0.588 0.891 0.536 5.9e-25
TAIR|locus:2136283100 RL1 "RAD-like 1" [Arabidopsis 0.568 0.87 0.538 2.6e-24
UNIPROTKB|Q58FS393 RAD "Transcription factor RADI 0.568 0.935 0.541 5.3e-24
TAIR|locus:2016417100 RL5 "RAD-like 5" [Arabidopsis 0.581 0.89 0.537 7.8e-23
TAIR|locus:211526081 RL3 "RAD-like 3" [Arabidopsis 0.470 0.888 0.625 2.1e-22
TAIR|locus:401071363177 RL4 "RAD-like 4" [Arabidopsis 0.464 0.922 0.591 9.2e-20
TAIR|locus:2042872 298 AT2G38090 [Arabidopsis thalian 0.431 0.221 0.626 3.2e-17
TAIR|locus:2154508 288 AT5G58900 [Arabidopsis thalian 0.450 0.239 0.585 4.1e-17
UNIPROTKB|Q8S9H7 307 DIVARICATA "Transcription fact 0.431 0.214 0.573 1.8e-16
TAIR|locus:2025182 RL6 "RAD-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 290 (107.1 bits), Expect = 1.4e-25, P = 1.4e-25
 Identities = 53/92 (57%), Positives = 71/92 (77%)

Query:    59 STWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEI 118
             S WT  QNK+FE ALA+YDKDTPDRWHN+A+AVGGKTVEEVKRHY++L ED+  IE G +
Sbjct:    10 SPWTFSQNKMFERALAVYDKDTPDRWHNVAKAVGGKTVEEVKRHYDILVEDLINIETGRV 69

Query:   119 PLPDYKKIGGTNKAHSYINMDNEEQRLKTLRL 150
             PLP+YK     +++   IN D + +++K L++
Sbjct:    70 PLPNYKTFESNSRS---IN-DFDTRKMKNLKI 97
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0009507 "chloroplast" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2049374 MEE3 "MATERNAL EFFECT EMBRYO ARREST 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136283 RL1 "RAD-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q58FS3 RAD "Transcription factor RADIALIS" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2016417 RL5 "RAD-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115260 RL3 "RAD-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713631 RL4 "RAD-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154508 AT5G58900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 9e-06
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-05
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 6e-05
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information 
 Score = 40.3 bits (95), Expect = 9e-06
 Identities = 11/49 (22%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query: 58  RSTWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEML 106
           +  WT ++++L    +  Y K+    W  +A+ + G+T E+ +  +  L
Sbjct: 1   KGEWTEEEDELLIELVKKYGKN---NWEKIAKELPGRTAEQCRERWRNL 46

Length = 49
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.4
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.19
PLN03212 249 Transcription repressor MYB5; Provisional 99.15
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.13
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.05
KOG0048 238 consensus Transcription factor, Myb superfamily [T 98.93
PLN03091 459 hypothetical protein; Provisional 98.85
PLN03212249 Transcription repressor MYB5; Provisional 98.51
KOG0724 335 consensus Zuotin and related molecular chaperones 98.5
PLN03091 459 hypothetical protein; Provisional 98.37
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.19
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.93
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.93
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.72
KOG1279 506 consensus Chromatin remodeling factor subunit and 97.66
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.65
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.51
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.44
KOG4167 907 consensus Predicted DNA-binding protein, contains 97.37
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.94
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.67
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.63
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.56
COG5147 512 REB1 Myb superfamily proteins, including transcrip 96.17
KOG0051 607 consensus RNA polymerase I termination factor, Myb 95.81
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 95.64
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 94.35
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 94.25
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 93.82
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 92.85
KOG4282 345 consensus Transcription factor GT-2 and related pr 92.77
KOG1194 534 consensus Predicted DNA-binding protein, contains 92.66
smart0059589 MADF subfamily of SANT domain. 92.51
PRK13923170 putative spore coat protein regulator protein YlbO 91.37
COG5147 512 REB1 Myb superfamily proteins, including transcrip 91.07
KOG4329445 consensus DNA-binding protein [General function pr 90.54
KOG0051607 consensus RNA polymerase I termination factor, Myb 89.35
KOG4468 782 consensus Polycomb-group transcriptional regulator 88.8
PF0450498 DUF573: Protein of unknown function, DUF573; Inter 87.81
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 87.53
PF11035 344 SnAPC_2_like: Small nuclear RNA activating complex 87.09
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 86.95
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 86.65
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 86.25
KOG2656 445 consensus DNA methyltransferase 1-associated prote 86.23
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information 
Probab=99.40  E-value=6.6e-13  Score=84.83  Aligned_cols=45  Identities=27%  Similarity=0.677  Sum_probs=41.0

Q ss_pred             CCCCHHHHHHHHHHHhhcCCCCchHHHHHHHHcC-CCCHHHHHHHHHHH
Q 041475           59 STWTAKQNKLFENALAIYDKDTPDRWHNLARAVG-GKTVEEVKRHYEML  106 (153)
Q Consensus        59 ~~WT~EEdK~LE~ALakyp~~tp~RWekIAa~VP-GKT~kqcr~Ryk~L  106 (153)
                      ..||.||++.|.+|+.+|+.+   +|.+||..|| |||..||+.||..+
T Consensus         2 ~~Wt~eE~~~l~~~v~~~g~~---~W~~Ia~~~~~~Rt~~qc~~~~~~~   47 (48)
T PF00249_consen    2 GPWTEEEDEKLLEAVKKYGKD---NWKKIAKRMPGGRTAKQCRSRYQNL   47 (48)
T ss_dssp             -SS-HHHHHHHHHHHHHSTTT---HHHHHHHHHSSSSTHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHhCCc---HHHHHHHHcCCCCCHHHHHHHHHhh
Confidence            479999999999999999975   8999999999 99999999999976

These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B ....
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PF04504 DUF573: Protein of unknown function, DUF573; InterPro: IPR007592 This is a family of uncharacterised proteins Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information
>PF11035 SnAPC_2_like: Small nuclear RNA activating complex subunit 2-like; InterPro: IPR021281 This family of proteins is SnAPC subunit 2-like Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
2cjj_A93 Crystal Structure Of The Myb Domain Of The Rad Tran 8e-26
4eef_G74 Crystal Structure Of The Designed Inhibitor Protein 1e-08
2m2e_A73 Solution Nmr Structure Of The Sant Domain Of Human 6e-07
>pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (280), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (72%), Gaps = 9/96 (9%)
Query: 55  GIGRSTWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIE 114
           G GR  W+AK+NK FE ALA+YDKDTPDRW N+ARAV G+T EEVK+HYE+L ED+  IE
Sbjct: 6   GSGRP-WSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIE 64
Query: 115 AGEIPLPDYKKIGGTNKAHSYINMDNEEQRLKTLRL 150
           +G++P P+Y+  GG        NM  +E+R + L++
Sbjct: 65  SGKVPFPNYRTTGG--------NMKTDEKRFRNLKI 92
>pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 Back     alignment and structure
>pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
2cjj_A93 Radialis; plant development, DNA-binding protein, 6e-39
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 2e-28
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 4e-24
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 5e-10
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 4e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 9e-07
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 2e-06
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 6e-06
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 7e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 1e-05
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 1e-05
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 4e-05
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 9e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 5e-04
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 7e-04
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
 Score =  126 bits (318), Expect = 6e-39
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 8/94 (8%)

Query: 57  GRSTWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAG 116
               W+AK+NK FE ALA+YDKDTPDRW N+ARAV G+T EEVK+HYE+L ED+  IE+G
Sbjct: 7   SGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESG 66

Query: 117 EIPLPDYKKIGGTNKAHSYINMDNEEQRLKTLRL 150
           ++P P+Y+  GG        NM  +E+R + L++
Sbjct: 67  KVPFPNYRTTGG--------NMKTDEKRFRNLKI 92
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.95
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.9
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.77
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.77
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 99.73
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.62
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.54
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.47
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.44
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.41
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.4
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.4
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.37
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.37
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.36
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.35
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.33
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.33
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.32
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.31
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.31
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.3
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.27
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.2
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.18
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.17
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.14
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.13
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.1
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.61
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.01
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.97
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.94
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.92
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.91
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.88
2crg_A70 Metastasis associated protein MTA3; transcription 98.8
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.79
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.72
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.71
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.65
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.62
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.44
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.42
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.42
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.25
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.1
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.15
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.7
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.53
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.48
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.24
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 97.05
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 96.38
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.83
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 95.44
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.94
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 94.29
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 91.73
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 91.13
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 85.19
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 83.85
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.95  E-value=6.9e-28  Score=175.44  Aligned_cols=88  Identities=55%  Similarity=1.002  Sum_probs=61.6

Q ss_pred             CCCCCCCHHHHHHHHHHHhhcCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHhhhhhhcCCCCCCCCCCCCCCCCCCCC
Q 041475           56 IGRSTWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEIPLPDYKKIGGTNKAHSY  135 (153)
Q Consensus        56 ~s~~~WT~EEdK~LE~ALakyp~~tp~RWekIAa~VPGKT~kqcr~Ryk~L~eDVk~IEsG~v~lP~y~~~~~~s~~~~~  135 (153)
                      .+...||.|||++|++||++|+.++++||++||++|||||++||++||+.|++||+.||+|.||+|.|.+.+        
T Consensus         6 ~~~~~WT~eEd~~L~~al~~~~~~~~~rW~~IA~~vpGRT~~q~k~ry~~l~~dv~~iesg~vp~P~y~~~~--------   77 (93)
T 2cjj_A            6 GSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPFPNYRTTG--------   77 (93)
T ss_dssp             --CCSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC---------------
T ss_pred             CCCCCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCC--------
Confidence            345689999999999999999999999999999999999999999999999999999999999999997654        


Q ss_pred             CCCCcHHHHHhhcccc
Q 041475          136 INMDNEEQRLKTLRLS  151 (153)
Q Consensus       136 ~~~~eee~rl~~l~l~  151 (153)
                      ..-.+|++|+++|+|+
T Consensus        78 ~~~~~~~~~~~~~~~~   93 (93)
T 2cjj_A           78 GNMKTDEKRFRNLKIR   93 (93)
T ss_dssp             ----------------
T ss_pred             CCcccHHHHHhcccCC
Confidence            1233789999999885
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 153
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 2e-21
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-17
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-08
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 6e-05
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 2e-04
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 9e-04
d1wgxa_73 a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1 0.002
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: DnaJ homolog subfamily C member 1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 79.4 bits (196), Expect = 2e-21
 Identities = 12/53 (22%), Positives = 24/53 (45%), Gaps = 1/53 (1%)

Query: 61  WTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRI 113
           WT +       ++  +   TP RW  +A  + G++V +V    + L + V+  
Sbjct: 4   WTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL-GRSVTDVTTKAKQLKDSVTCS 55
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.89
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.79
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.71
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.44
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.39
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.38
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.3
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.29
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.2
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.2
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.18
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.14
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.11
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.05
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.97
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.81
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 98.53
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.54
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.5
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 92.87
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 90.57
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 89.78
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]

Probab=99.89  E-value=1.9e-23  Score=139.32  Aligned_cols=62  Identities=65%  Similarity=1.138  Sum_probs=60.3

Q ss_pred             CCCCHHHHHHHHHHHhhcCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHhhhhhhcCCCCC
Q 041475           59 STWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEIPL  120 (153)
Q Consensus        59 ~~WT~EEdK~LE~ALakyp~~tp~RWekIAa~VPGKT~kqcr~Ryk~L~eDVk~IEsG~v~l  120 (153)
                      +.||.|||++|+.|+++|+.+.+++|.+||+.|||||++||++||+.|.+||+.||+|+|||
T Consensus         2 ~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~gRt~~qc~~r~~~L~~dik~iesg~vpf   63 (63)
T d2cjja1           2 RPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF   63 (63)
T ss_dssp             CSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred             cCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHHhhccccCCCCC
Confidence            57999999999999999999999999999999999999999999999999999999999986
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure