Citrus Sinensis ID: 041525

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
PTYSRKLSRVRCNVENSSTKGEPEPRNALLKIAWYGSELLGIAASFLRSPSPSDVENDLKLATDGSGAAELDRATVVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKRNCTNFGLLIDKSNMNLTRWDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRHVEHWNVPKMALFKQILRPSRVGRRKSGG
ccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEccccccccHHHHHHHHHHcccccccccEEEEEEEEcccEEEEEEEEEEEEccccccEEEEEEEEEEEEEcccccEEEEEEEccccHHHHHHHHccccccccccccc
ccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEcccccHHHccccEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEEEEEcccccccEEEEccEEEEEEccccccEEEEEccccccHHHHHHHHHcccccccccccc
ptysrklsrvrcnvensstkgepeprNALLKIAWYGSELLGIAAsflrspspsdvendlklatdgsgaaelDRATVVEAIKEDFARSyfvtgnitldayeedcefadpagsfkglRRFKrnctnfgllidksnmnltrwddfedkgighwrfncimsfpwrpilsatgyteyyfnaetgrvcrhvehwnvpkmALFKqilrpsrvgrrksgg
ptysrklsrvrcnvensstkgepeprnALLKIAWYGSELLGIAASFLRSPSPSDVENDLKLAtdgsgaaeldRATVVEAIKEDFARSYFVTGNITLDAYEEDCEFAdpagsfkglrrFKRNCTNFgllidksnmnltRWDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRHVEHWNVPkmalfkqilrpsrvgrrksgg
PTYSRKLSRVRCNVENSSTKGEPEPRNALLKIAWYGSELLGIAASFLRSPSPSDVENDLKLATDGSGAAELDRATVVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKRNCTNFGLLIDKSNMNLTRWDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRHVEHWNVPKMALFKQILRPSRVGRRKSGG
***************************ALLKIAWYGSELLGIAASFL***********************LDRATVVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKRNCTNFGLLIDKSNMNLTRWDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRHVEHWNVPKMALFKQIL************
*******************************IAWYGSELL***********************************VVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKRNCTNFGLLIDKSNMNLTRWDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRHVEHWNVPKMALFKQILR***********
***********************EPRNALLKIAWYGSELLGIAASFLRSPSPSDVENDLKLATDGSGAAELDRATVVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKRNCTNFGLLIDKSNMNLTRWDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRHVEHWNVPKMALFKQILRPS*********
****RKLSRVRCNVEN*STK*EPEPRNALLKIAWYGSELLGIAASFLR*********************ELDRATVVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKRNCTNFGLLIDKSNMNLTRWDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRHVEHWNVPKMALFKQILRPS*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PTYSRKLSRVRCNVENSSTKGEPEPRNALLKIAWYGSELLGIAASFLRSPSPSDVENDLKLATDGSGAAELDRATVVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKRNCTNFGLLIDKSNMNLTRWDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRHVEHWNVPKMALFKQILRPSRVGRRKSGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
255541694235 conserved hypothetical protein [Ricinus 0.962 0.868 0.747 6e-89
225454326256 PREDICTED: uncharacterized protein LOC10 0.952 0.789 0.736 8e-87
297745341240 unnamed protein product [Vitis vinifera] 0.952 0.841 0.736 2e-86
224067926245 predicted protein [Populus trichocarpa] 0.952 0.824 0.688 3e-82
449495217248 PREDICTED: uncharacterized LOC101218208 0.981 0.838 0.669 6e-80
449441428239 PREDICTED: uncharacterized protein LOC10 0.981 0.870 0.669 6e-80
356560693238 PREDICTED: uncharacterized protein LOC10 0.900 0.802 0.698 8e-78
30690220240 Nuclear transport factor 2 (NTF2) family 0.882 0.779 0.705 3e-76
357504325243 hypothetical protein MTR_7g037920 [Medic 0.896 0.781 0.673 5e-76
297824667241 hypothetical protein ARALYDRAFT_483757 [ 0.910 0.800 0.658 6e-75
>gi|255541694|ref|XP_002511911.1| conserved hypothetical protein [Ricinus communis] gi|223549091|gb|EEF50580.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  332 bits (851), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 157/210 (74%), Positives = 181/210 (86%), Gaps = 6/210 (2%)

Query: 1   PTYSRKLSRVRCNVENSSTKGEPEPRNALLKIAWYGSELLGIAASFLRSPSPSDVENDLK 60
           P Y RK +R+RCN EN ST+ E EP NALLK+AWY SELLGIAASF RSPS +  E + K
Sbjct: 25  PIYPRKFNRIRCNGENPSTRKESEPENALLKVAWYSSELLGIAASFFRSPSVTS-EANFK 83

Query: 61  LATDGSGAAELDRATVVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKR 120
           L+ D  G+  +DRATVV++IK+DF RSYFVTGN+T DAYEEDCEFADPAGSFKGLRRFKR
Sbjct: 84  LSIDDLGS--IDRATVVQSIKDDFQRSYFVTGNLTSDAYEEDCEFADPAGSFKGLRRFKR 141

Query: 121 NCTNFGLLIDKSNMNLTRWDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGR 180
           NCTNFGLL++KSNM L +W+DFEDKGIG+WRF+CIMSFPW+PILSATGYTEYYF+ ++GR
Sbjct: 142 NCTNFGLLLEKSNMKLMKWEDFEDKGIGYWRFSCIMSFPWKPILSATGYTEYYFDVQSGR 201

Query: 181 VCRHVEHWNVPKMALFKQILRPS---RVGR 207
           VCRHVEHWNVPKMAL KQILRPS   R+GR
Sbjct: 202 VCRHVEHWNVPKMALLKQILRPSQRFRLGR 231

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225454326|ref|XP_002277369.1| PREDICTED: uncharacterized protein LOC100258452 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745341|emb|CBI40421.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224067926|ref|XP_002302602.1| predicted protein [Populus trichocarpa] gi|222844328|gb|EEE81875.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449495217|ref|XP_004159768.1| PREDICTED: uncharacterized LOC101218208 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441428|ref|XP_004138484.1| PREDICTED: uncharacterized protein LOC101218208 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356560693|ref|XP_003548624.1| PREDICTED: uncharacterized protein LOC100801965 [Glycine max] Back     alignment and taxonomy information
>gi|30690220|ref|NP_182134.2| Nuclear transport factor 2 (NTF2) family protein [Arabidopsis thaliana] gi|48310194|gb|AAT41772.1| At2g46100 [Arabidopsis thaliana] gi|50198900|gb|AAT70469.1| At2g46100 [Arabidopsis thaliana] gi|330255549|gb|AEC10643.1| Nuclear transport factor 2 (NTF2) family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357504325|ref|XP_003622451.1| hypothetical protein MTR_7g037920 [Medicago truncatula] gi|355497466|gb|AES78669.1| hypothetical protein MTR_7g037920 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297824667|ref|XP_002880216.1| hypothetical protein ARALYDRAFT_483757 [Arabidopsis lyrata subsp. lyrata] gi|297326055|gb|EFH56475.1| hypothetical protein ARALYDRAFT_483757 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
TAIR|locus:2062989240 AT2G46100 "AT2G46100" [Arabido 0.882 0.779 0.705 2.2e-73
TAIR|locus:2114875221 AT3G04890 "AT3G04890" [Arabido 0.693 0.665 0.278 5.6e-13
TAIR|locus:2062989 AT2G46100 "AT2G46100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 741 (265.9 bits), Expect = 2.2e-73, P = 2.2e-73
 Identities = 134/190 (70%), Positives = 158/190 (83%)

Query:    15 ENSSTKGEPEPRNALLKIAWYGSELLGIAASFLRSPSPSDVENDLKLATDGSGAAELDRA 74
             E  ++KG PEP N LLKIAWYGSELLGIAAS  RSP  S +    ++  D SG A   R 
Sbjct:    47 EPQTSKG-PEPDNVLLKIAWYGSELLGIAASVFRSPETSPIVTGFEVPVDCSGRAV--RV 103

Query:    75 TVVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKRNCTNFGLLIDKSNM 134
              VV++IK+DF RSYFVTGN+T + YEE CEFADPAGSFKGL RFKRNCTNFG LI+KSNM
Sbjct:   104 AVVDSIKQDFKRSYFVTGNLTPEVYEEKCEFADPAGSFKGLARFKRNCTNFGSLIEKSNM 163

Query:   135 NLTRWDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRHVEHWNVPKMA 194
              L +W++FEDKGIGHW+F+C+MSFPW+PILSATGYTEYYF+ E+G++CRHVEHWNVPK+A
Sbjct:   164 KLMKWENFEDKGIGHWKFSCVMSFPWKPILSATGYTEYYFDTESGKICRHVEHWNVPKIA 223

Query:   195 LFKQILRPSR 204
             LFKQ+LRPSR
Sbjct:   224 LFKQLLRPSR 233
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2114875 AT3G04890 "AT3G04890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00026915001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (240 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00026214001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (278 aa)
  •     0.505
GSVIVG00032449001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (502 aa)
  •     0.503
GSVIVG00022014001
SubName- Full=Chromosome chr18 scaffold_24, whole genome shotgun sequence; (291 aa)
  •     0.503
GSVIVG00006111001
SubName- Full=Chromosome chr14 scaffold_164, whole genome shotgun sequence; (332 aa)
  •     0.502
GSVIVG00019398001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (323 aa)
  •     0.499
GSVIVG00019306001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (234 aa)
  •     0.493
GSVIVG00004261001
SubName- Full=Chromosome undetermined scaffold_644, whole genome shotgun sequence; (209 aa)
  •     0.483
GSVIVG00026887001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (268 aa)
  •     0.478
GSVIVG00037960001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (267 aa)
  •     0.468
GSVIVG00023729001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (169 aa)
  •     0.463

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
pfam10184113 pfam10184, DUF2358, Uncharacterized conserved prot 5e-18
>gnl|CDD|220621 pfam10184, DUF2358, Uncharacterized conserved protein (DUF2358) Back     alignment and domain information 
 Score = 75.8 bits (187), Expect = 5e-18
 Identities = 32/116 (27%), Positives = 48/116 (41%), Gaps = 8/116 (6%)

Query: 74  ATVVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKRNCTN----FGLLI 129
           A  +EA++ED  R      +     Y +D  F DP   F+G+ R+KRN         L  
Sbjct: 1   ADAIEALREDLPR--LFPKDQDYSIYSDDVYFEDPLNKFRGIDRYKRNFWLIRFLGRLFF 58

Query: 130 DKSNMNLTR-WDDFEDKGIGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRH 184
               + L       ED     W  + I   PW+P L+  G + Y  N++ G +  H
Sbjct: 59  ADIRLELHDITQTPEDTIKTRWTLSGIPRLPWKPRLTFDGTSTYKLNSD-GLIYSH 113

DUF2358 is a family of conserved proteins found from plants to humans. The function is unknown. Length = 113

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 212
PF10184113 DUF2358: Uncharacterized conserved protein (DUF235 99.96
TIGR02096129 conserved hypothetical protein, steroid delta-isom 99.54
cd00781122 ketosteroid_isomerase ketosteroid isomerase: Many 99.44
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 99.34
PF07366126 SnoaL: SnoaL-like polyketide cyclase; InterPro: IP 99.28
KOG4457202 consensus Uncharacterized conserved protein [Funct 98.94
PF07858125 LEH: Limonene-1,2-epoxide hydrolase catalytic doma 98.59
PRK08241339 RNA polymerase factor sigma-70; Validated 98.47
TIGR02960324 SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa 98.25
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 97.61
TIGR02246128 conserved hypothetical protein. This family consis 97.17
COG3631133 Ketosteroid isomerase-related protein [General fun 97.12
COG4319137 Ketosteroid isomerase homolog [Function unknown] 97.02
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 96.51
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 96.46
COG4308130 LimA Limonene-1,2-epoxide hydrolase [Secondary met 95.01
COG5485131 Predicted ester cyclase [General function predicti 94.98
PF13577127 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF 92.13
PRK09636293 RNA polymerase sigma factor SigJ; Provisional 91.48
PF02136118 NTF2: Nuclear transport factor 2 (NTF2) domain; In 90.66
cd00780119 NTF2 Nuclear transport factor 2 (NTF2) domain play 83.63
COG4922129 Uncharacterized protein conserved in bacteria [Fun 83.2
KOG2546 483 consensus Abl interactor ABI-1, contains SH3 domai 80.32
>PF10184 DUF2358: Uncharacterized conserved protein (DUF2358); InterPro: IPR018790 This entry represents a family of conserved proteins Back     alignment and domain information 
Probab=99.96  E-value=8.7e-29  Score=192.95  Aligned_cols=107  Identities=34%  Similarity=0.700  Sum_probs=101.0

Q ss_pred             HHHHHHHHHhhhccCcCCCccccccCCCeEEeCCCCcccchHHHHHH---HHHHhc-ccccceEEEeEeEEeCC-eEEEE
Q 041525           75 TVVEAIKEDFARSYFVTGNITLDAYEEDCEFADPAGSFKGLRRFKRN---CTNFGL-LIDKSNMNLTRWDDFED-KGIGH  149 (212)
Q Consensus        75 ~vl~~L~~dy~~~Yf~tg~~~~~iY~~Dv~F~DP~~~f~Gld~y~~~---f~~L~~-~~~~~~f~l~~~~~~~~-~~~~~  149 (212)
                      ++++.|++||++  |++|+++.+||++||+|+||+++|+|+++|+++   +..+.. ++.+++++|+++.+.++ .+.++
T Consensus         2 ~~~~~Lr~D~~~--~f~~~~~~~iY~~dv~F~Dp~~~f~g~~~Y~~~~~~l~~l~~~~~~~~~~~v~~i~~~~~~~I~~r   79 (113)
T PF10184_consen    2 DVIRTLREDLPR--FFTGDLDYSIYDEDVVFIDPIVSFKGLDRYKRNLWALRFLGRLFFSDPSLEVLSIEQDGEDTIRAR   79 (113)
T ss_pred             hHHHHHHHHHHH--HhcCCCChhhcCCCeEEECCCCceecHHHHHHHHHHHHHHHhhccCCcEEEEEEEEECCCCEEEEE
Confidence            579999999998  459999999999999999999999999999999   777777 78999999999999876 89999


Q ss_pred             EEEEEEecCCCCCeeEEEEEEEEEEeCCCCCEEEE
Q 041525          150 WRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRH  184 (212)
Q Consensus       150 W~m~~~lkLpw~p~i~v~G~S~l~fd~d~GkI~~H  184 (212)
                      |+|++.+++||+|.+.++|+|+|++|++ |+|++|
T Consensus        80 W~~~g~~~l~w~p~~~~~G~S~~~ln~~-g~I~~H  113 (113)
T PF10184_consen   80 WRLRGVPRLPWRPRISFDGTSTYTLNSD-GLIYRH  113 (113)
T ss_pred             EEEEEEeCCCcCCcEEEEEEEEEEECCC-CcEEeC
Confidence            9999999999999999999999999998 899998

The function is unknown.
>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related Back     alignment and domain information
>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon Back     alignment and domain information
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information
>PF07366 SnoaL: SnoaL-like polyketide cyclase; InterPro: IPR009959 This domain is found in SnoaL [] a polyketide cyclase involved in nogalamycin biosynthesis Back     alignment and domain information
>KOG4457 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07858 LEH: Limonene-1,2-epoxide hydrolase catalytic domain; InterPro: IPR013100 Epoxide hydrolases catalyse the hydrolysis of epoxides to corresponding diols, which is important in detoxification, synthesis of signal molecules, or metabolism Back     alignment and domain information
>PRK08241 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>COG3631 Ketosteroid isomerase-related protein [General function prediction only] Back     alignment and domain information
>COG4319 Ketosteroid isomerase homolog [Function unknown] Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>COG4308 LimA Limonene-1,2-epoxide hydrolase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG5485 Predicted ester cyclase [General function prediction only] Back     alignment and domain information
>PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B Back     alignment and domain information
>PRK09636 RNA polymerase sigma factor SigJ; Provisional Back     alignment and domain information
>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein Back     alignment and domain information
>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
>COG4922 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2546 consensus Abl interactor ABI-1, contains SH3 domain [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
4h3u_A158 Hypothetical protein; structural genomics, PSI-bio 99.68
3rga_A283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 99.65
3dxo_A121 Uncharacterized snoal-like protein; putative isome 99.64
2a15_A139 Hypothetical protein RV0760C; beta-alpha-barrel, s 99.63
2gex_A152 SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St 99.59
3rga_A 283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 99.57
2gey_A158 ACLR protein; alpha+beta barrel, oxidoreductase; H 99.57
3k0z_A159 Putative polyketide cyclase; structural genomics, 99.55
2f99_A153 Aklanonic acid methyl ester cyclase, AKNH; anthrac 99.55
3hk4_A136 MLR7391 protein; NTF2-like protein, structural gen 99.55
3f9s_A146 Putative polyketide cyclase; structural genomics, 99.54
3ehc_A128 Snoal-like polyketide cyclase; structural genomics 99.53
3kkg_A146 Putative snoal-like polyketide cyclase; structural 99.52
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 99.52
3fh1_A129 Uncharacterized NTF2-like protein; structural geno 99.51
1sjw_A144 Nogalonic acid methyl ester cyclase; anthracycline 99.51
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 99.5
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 99.49
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 99.48
1oh0_A131 Steroid delta-isomerase; ketosteroid isomerase, KS 99.48
1ohp_A125 Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 99.47
3mso_A143 Steroid delta-isomerase; structural genomics, join 99.44
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 99.44
3f7x_A151 Putative polyketide cyclase; structural genomics, 99.37
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 99.37
3h3h_A122 Uncharacterized snoal-like protein; structural gen 99.33
1z1s_A163 Hypothetical protein PA3332; beta barrel, conserve 99.33
3f8h_A150 Putative polyketide cyclase; structural genomics, 99.33
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 99.32
3grd_A134 Uncharacterized NTF2-superfamily protein; NP_97724 99.31
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 99.3
3f8x_A148 Putative delta-5-3-ketosteroid isomerase; structur 99.3
3g8z_A148 Protein of unknown function with cystatin-like FO; 99.27
1tuh_A156 BAL32A, hypothetical protein EGC068; unknown funct 99.25
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 99.25
3g16_A156 Uncharacterized protein with cystatin-like fold; Y 99.21
2k54_A123 Protein ATU0742; protein of unknown function, stru 99.11
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 99.01
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 98.99
3dmc_A134 NTF2-like protein; structural genomics, joint cent 98.99
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 98.93
3g0k_A148 Putative membrane protein; snoal-like polyketide c 98.92
3f14_A112 Uncharacterized NTF2-like protein; YP_680363.1, NT 98.84
3ff0_A163 Phenazine biosynthesis protein PHZB 2; cystatin-li 98.75
3ff2_A117 Uncharacterized cystatin fold protein (YP_497570. 98.73
3flj_A155 Uncharacterized protein conserved in bacteria WIT 98.62
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 98.46
3h51_A156 Putative calcium/calmodulin dependent protein KIN 98.44
3f40_A114 Uncharacterized NTF2-like protein; YP_677363.1, NT 98.42
3gzb_A154 Putative snoal-like polyketide cyclase; YP_0011826 98.4
3ke7_A134 Putative ketosteroid isomerase; structural genomic 98.37
3rob_A139 Uncharacterized conserved protein; structural geno 98.11
3f7s_A142 Uncharacterized NTF2-like protein; structural geno 97.9
3bb9_A148 Putative orphan protein; structural genomics, join 97.89
2ux0_A143 Calcium-calmodulin dependent protein kinase (CAM I 97.64
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 97.48
1tp6_A128 Hypothetical protein PA1314; structural genomics, 97.44
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 97.41
3ecf_A130 NTF2-like protein; structural genomics, joint cent 97.31
3cu3_A172 Domain of unknown function with A cystatin-like F; 97.03
3cnx_A170 Uncharacterized protein; putative dehydratase, NTF 96.88
3lyg_A120 NTF2-like protein of unknown function; structural 96.68
2chc_A170 Protein RV3472; hypothetical protein; 1.69A {Mycob 96.66
2rfr_A155 Uncharacterized protein; structural genomics, join 96.55
3b7c_A122 Uncharacterized protein; NTF-2 like protein, struc 96.53
3soy_A145 NTF2-like superfamily protein; structural genomics 96.3
3gzr_A146 Uncharacterized protein with A NTF2-like fold; str 96.18
3b8l_A163 Uncharacterized protein; putative aromatic ring hy 96.0
2f86_B143 Hypothetical protein K11E8.1D; UNC-43, oligomeriza 95.78
3fsd_A134 NTF2-like protein of unknown function in nutrient; 95.72
2r4i_A123 Uncharacterized protein; NTF2-like protein, struct 95.7
3a76_A176 Gamma-hexachlorocyclohexane dehydrochlorinase; bar 95.35
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 95.24
2rgq_A144 Domain of unknown function with A cystatin-like F; 94.17
3ef8_A150 Putative scyalone dehydratase; YP_496742.1, struct 93.2
2rcd_A129 Uncharacterized protein; structural genomics, join 91.48
3ejv_A179 Uncharacterized protein with cystatin-like fold; s 89.76
3mg1_A323 OCP, orange carotenoid protein; carotenoid binding 88.27
4gb5_A159 Uncharacterized protein; structural genomics, PSI- 86.57
3blz_A128 NTF2-like protein of unknown function; structural 81.79
>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} Back     alignment and structure
Probab=99.68  E-value=2.6e-16  Score=124.61  Aligned_cols=127  Identities=10%  Similarity=0.060  Sum_probs=104.9

Q ss_pred             CCHHHHHHHHHHHhhhccCcCCC--ccccccCCCeEEeCCCC--cccchHHHHHHHHHHhcccccceEEEeEeEEeCCeE
Q 041525           71 LDRATVVEAIKEDFARSYFVTGN--ITLDAYEEDCEFADPAG--SFKGLRRFKRNCTNFGLLIDKSNMNLTRWDDFEDKG  146 (212)
Q Consensus        71 ~~~~~vl~~L~~dy~~~Yf~tg~--~~~~iY~~Dv~F~DP~~--~f~Gld~y~~~f~~L~~~~~~~~f~l~~~~~~~~~~  146 (212)
                      ++..++++.+-+-++     .++  .+.++|++||+|.||..  .++|++++++++..+...+.+.++++.++...++.+
T Consensus        25 mt~~eiv~~y~~A~n-----~~D~d~~~~l~a~D~v~~d~~~g~~~~Greai~~~~~~~~~~~~d~~~~v~~~~~~gd~v   99 (158)
T 4h3u_A           25 MTTPEIVTAWAAAWT-----GTNPNALGTLFAADGTYVDHAIGATMTGREQISGWKARTDAMIENVHVTITKAYRAGDHV   99 (158)
T ss_dssp             CCCCHHHHHHHHHHH-----SSCHHHHHTTEEEEEEEEETTTTEEEESHHHHHHHHHHHHHHEEEEEEEEEEEEEETTEE
T ss_pred             CCHHHHHHHHHHHHH-----cCCHHHHHHHhcccceEeccCCCceEecchhhhhhhhhhhccCCccceeEeEEeecCceE
Confidence            333455555555444     344  47899999999999974  589999999999999999999999999999999999


Q ss_pred             EEEEEEEEEecCCCCCeeEEEEEEEEEEeCCCCCEEEEEEeccCChhhHHHHHhcCCCCcc
Q 041525          147 IGHWRFNCIMSFPWRPILSATGYTEYYFNAETGRVCRHVEHWNVPKMALFKQILRPSRVGR  207 (212)
Q Consensus       147 ~~~W~m~~~lkLpw~p~i~v~G~S~l~fd~d~GkI~~HrDyWD~sa~~~l~q~f~p~~~~~  207 (212)
                      .++|++++.++- -+..+.+.|++.++|++  |||++|+||||..  +.++|+=.|..|.+
T Consensus       100 ~~~~~~~gt~~~-tG~~~~~~~~~v~~~~d--GkI~~~~~y~D~~--~ll~QlGlp~~w~p  155 (158)
T 4h3u_A          100 TIEAVYGGHIKG-APTPFAVPMATLLRTRG--EEITSDQDYYSLS--SVLAQSGLPADWTP  155 (158)
T ss_dssp             EEEEEEEEEETT-SSSCEEEEEEEEEEEET--TEEEEEEEEECHH--HHHHHHTCCTTCCC
T ss_pred             EEEEEEEEEecC-ccCcceeeeEEEEEEEC--CEEEEEEEEECHH--HHHHHcCCCCCCCC
Confidence            999999999873 34568999999999985  9999999999975  45788877777654
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 Back     alignment and structure
>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Back     alignment and structure
>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Back     alignment and structure
>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* Back     alignment and structure
>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} Back     alignment and structure
>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Back     alignment and structure
>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Back     alignment and structure
>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP} Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Back     alignment and structure
>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Back     alignment and structure
>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Back     alignment and structure
>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 Back     alignment and structure
>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Back     alignment and structure
>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Back     alignment and structure
>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Back     alignment and structure
>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Back     alignment and structure
>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Back     alignment and structure
>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Back     alignment and structure
>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0 Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Back     alignment and structure
>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Back     alignment and structure
>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Back     alignment and structure
>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Back     alignment and structure
>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans} Back     alignment and structure
>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* Back     alignment and structure
>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Back     alignment and structure
>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>3ecf_A NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Anabaena variabilis atcc 29413} SCOP: d.17.4.21 Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Back     alignment and structure
>3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea} Back     alignment and structure
>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 Back     alignment and structure
>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 Back     alignment and structure
>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Back     alignment and structure
>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7 Back     alignment and structure
>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0 Back     alignment and structure
>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 Back     alignment and structure
>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25 Back     alignment and structure
>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 Back     alignment and structure
>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 Back     alignment and structure
>3ejv_A Uncharacterized protein with cystatin-like fold; structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.40A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.28 Back     alignment and structure
>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Back     alignment and structure
>4gb5_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, snoal-like domain, unknown function; HET: PGE; 1.55A {Kribbella flavida} Back     alignment and structure
>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
d2gexa1138 Nogalamycin biosynthesis protein SnoL {Streptomyce 99.61
d3dxoa1117 Uncharacterized protein Atu0744 {Agrobacterium tum 99.59
d2a15a1132 Hypothetical protein Rv0760c {Mycobacterium tuberc 99.57
d1oh0a_125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 99.52
d1ohpa1125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 99.51
d1nwwa_145 Limonene-1,2-epoxide hydrolase {Rhodococcus erythr 99.49
d3ebta1131 Uncharacterized protein BPSS0132 {Burkholderia pse 99.49
d2bnga1132 Uncharacterized protein Mb2760 {Mycobacterium tube 99.46
d3dm8a1135 Uncharacterized protein Rpa4348 {Rhodopseudomonas 99.44
d2geya1144 Putative hydroxylase AclR {Streptomyces galilaeus 99.41
d2f99a1140 Aklanonic acid methyl ester cyclase, AknH {Strepto 99.38
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 99.32
d1sjwa_142 Nogalonic acid methyl ester cyclase SnoaL {Strepto 99.3
d1z1sa1129 Uncharacterized protein PA3332 {Pseudomonas aerugi 99.27
d3ec9a1130 Uncharacterized protein BTHI0051 {Burkholderia tha 99.24
d3dmca1133 Uncharacterized protein Ava2261 {Anabaena variabil 99.13
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 99.11
d1tuha_131 Hypothetical protein egc068 from a soil-derived mo 98.98
d2k54a1123 Uncharacterized protein Atu0742 {Agrobacterium tum 98.68
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 98.21
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 97.85
d3bb9a1121 Uncharacterized protein Sfri1973 {Shewanella frigi 97.39
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 97.31
d2r4ia1122 Uncharacterized protein CHU142 {Cytophaga hutchins 97.11
d3cnxa1153 Uncharacterized protein SAV4671 {Streptomyces aver 96.82
d3er7a1118 Uncharacterized protein Exig0174 {Exiguobacterium 96.79
d2rgqa1133 Uncharacterized protein NpunR3134 {Nostoc punctifo 96.72
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 96.61
d3b8la1144 Uncharacterized protein Saro3538 {Novosphingobium 96.39
d2owpa1128 Hypothetical protein BxeB1374 {Burkholderia xenovo 96.28
d2chca1167 Uncharacterized protein Rv3472 {Mycobacterium tube 96.22
d3ef8a1149 Uncharacterized protein Saro1465 {Novosphingobium 96.11
d2ux0a1135 Association domain of calcium/calmodulin-dependent 95.96
d2rfra1153 Uncharacterized protein Saro3722 {Novosphingobium 95.96
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 95.87
d3b7ca1121 Uncharacterized protein SO0125 {Shewanella oneiden 94.86
d2f86b1129 Association domain of calcium/calmodulin-dependent 94.8
d3ecfa1128 Uncharacterized protein Ava4193 {Anabaena variabil 92.51
d3ejva1159 Uncharacterized protein Saro2766 {Novosphingobium 92.44
d1idpa_147 Scytalone dehydratase {Fungus (Magnaporthe grisea) 82.64
d1gy7a_121 Nuclear transport factor-2 (NTF2) {Baker's yeast ( 81.86
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: SnoaL-like polyketide cyclase
domain: Nogalamycin biosynthesis protein SnoL
species: Streptomyces nogalater [TaxId: 38314]

Probab=99.61  E-value=6.7e-15  Score=111.99  Aligned_cols=114  Identities=13%  Similarity=0.053  Sum_probs=97.5

Q ss_pred             HHHHHHHhhhccCcCCC--ccccccCCCeEEeCCCCcccchHHHHHHHHHHhcccccceEEEeEeEEeCCeEEEEEEEEE
Q 041525           77 VEAIKEDFARSYFVTGN--ITLDAYEEDCEFADPAGSFKGLRRFKRNCTNFGLLIDKSNMNLTRWDDFEDKGIGHWRFNC  154 (212)
Q Consensus        77 l~~L~~dy~~~Yf~tg~--~~~~iY~~Dv~F~DP~~~f~Gld~y~~~f~~L~~~~~~~~f~l~~~~~~~~~~~~~W~m~~  154 (212)
                      .+++++.|+.  |-.++  .+.++|++||+|.+|.....|++.++.++..+...+.+.+++++++...++.+.+.|++++
T Consensus         6 ~e~~~~~~~a--~~~~D~~~~~~~~a~D~~~~~~~~~~~G~~~~~~~~~~~~~~~~d~~~~~~~~~~~gd~v~~~~~~~~   83 (138)
T d2gexa1           6 KERCLEMVAA--WNRWDVSGVVAHWAPDVVHYDDEDKPVSAEEVVRRMNSAVEAFPDLRLDVRSIVGEGDRVMLRITCSA   83 (138)
T ss_dssp             HHHHHHHHHH--HHTTCHHHHHTTEEEEEEEECTTSCEECHHHHHHHHHHHHHHCTTCEEEEEEEEEETTEEEEEEEEEE
T ss_pred             HHHHHHHHHH--HHccCHHHHHHHhCccccccCCCCCccCHHHHHHHHHHHHHhccCceeeeeeeeeccccceeeecccc
Confidence            4455555554  34455  4889999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecC------CCCCeeEEEEEEEEEEeCCCCCEEEEEEeccCChh
Q 041525          155 IMSF------PWRPILSATGYTEYYFNAETGRVCRHVEHWNVPKM  193 (212)
Q Consensus       155 ~lkL------pw~p~i~v~G~S~l~fd~d~GkI~~HrDyWD~sa~  193 (212)
                      .+.-      +-+..+.+.|++.++|+++ |||++|+||||...|
T Consensus        84 ~~~g~~~~~~~tG~~v~~~~~~~~~~~d~-GkI~e~~~~~D~~~~  127 (138)
T d2gexa1          84 THQGVFMGIAPTGRKVRWTYLEELRFSEA-GKVVEHWDVFNFSPL  127 (138)
T ss_dssp             ECCSCBTTBCCCCCEEEEEEEEEEEECTT-SCEEEEEEEEECHHH
T ss_pred             cccccccccCCcccEEEEEEEEEEEEccC-CEEEEEEEEECHHHH
Confidence            9852      2355789999999999987 999999999998654
>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Back     information, alignment and structure
>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Back     information, alignment and structure
>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]} Back     information, alignment and structure
>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3ecfa1 d.17.4.21 (A:2-129) Uncharacterized protein Ava4193 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d1idpa_ d.17.4.1 (A:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure