Citrus Sinensis ID: 041672
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 127 | ||||||
| 224129806 | 271 | predicted protein [Populus trichocarpa] | 0.866 | 0.405 | 0.507 | 2e-29 | |
| 164562219 | 258 | zinc finger-homeodomain protein 2 [Sarum | 0.795 | 0.391 | 0.598 | 8e-26 | |
| 224119848 | 177 | predicted protein [Populus trichocarpa] | 0.779 | 0.559 | 0.507 | 8e-26 | |
| 255569812 | 311 | transcription factor, putative [Ricinus | 0.850 | 0.347 | 0.434 | 7e-25 | |
| 359486213 | 281 | PREDICTED: ZF-HD homeobox protein At4g24 | 0.866 | 0.391 | 0.440 | 3e-24 | |
| 356522109 | 283 | PREDICTED: ZF-HD homeobox protein At4g24 | 0.496 | 0.222 | 0.782 | 6e-24 | |
| 224168739 | 175 | predicted protein [Populus trichocarpa] | 0.834 | 0.605 | 0.5 | 1e-23 | |
| 224080087 | 212 | predicted protein [Populus trichocarpa] | 0.850 | 0.509 | 0.435 | 1e-23 | |
| 356563811 | 286 | PREDICTED: ZF-HD homeobox protein At4g24 | 0.921 | 0.409 | 0.454 | 2e-23 | |
| 116783202 | 249 | unknown [Picea sitchensis] | 0.984 | 0.502 | 0.418 | 3e-23 |
| >gi|224129806|ref|XP_002328807.1| predicted protein [Populus trichocarpa] gi|222839105|gb|EEE77456.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 133 bits (335), Expect = 2e-29, Method: Compositional matrix adjust.
Identities = 72/142 (50%), Positives = 91/142 (64%), Gaps = 32/142 (22%)
Query: 8 PCKKVVRYKECLKNHAAAIGGSATDGCGEFMPSGEEGSIESLKCSACNCHRNFHRKEI-- 65
P KK+VRY+ECLKNHAA++GG+ATDGCGEFMPSGEEGSIE+L CSACNCHRNFHRKEI
Sbjct: 72 PYKKMVRYRECLKNHAASMGGNATDGCGEFMPSGEEGSIEALTCSACNCHRNFHRKEIEG 131
Query: 66 ------------GCDAHYHHLHQQAM--------MMLSGNSGSAHSASDEKVERRGVVVG 105
H++ L ++ + M++S N GS S SDE+ + GV++
Sbjct: 132 EHTSCTGDHCYHNSPVHFNRLGRKVILASAPHHQMIMSYNMGSLPSESDEQEDGGGVLMA 191
Query: 106 RPAPADDDDHQKRMMMRKRFRT 127
RPA +M+KRFRT
Sbjct: 192 RPA----------QLMKKRFRT 203
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|164562219|gb|ABY61024.1| zinc finger-homeodomain protein 2 [Saruma henryi] | Back alignment and taxonomy information |
|---|
| >gi|224119848|ref|XP_002331077.1| predicted protein [Populus trichocarpa] gi|222872805|gb|EEF09936.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255569812|ref|XP_002525870.1| transcription factor, putative [Ricinus communis] gi|223534875|gb|EEF36564.1| transcription factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359486213|ref|XP_003633412.1| PREDICTED: ZF-HD homeobox protein At4g24660 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356522109|ref|XP_003529692.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224168739|ref|XP_002339186.1| predicted protein [Populus trichocarpa] gi|222874604|gb|EEF11735.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224080087|ref|XP_002306012.1| predicted protein [Populus trichocarpa] gi|222848976|gb|EEE86523.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356563811|ref|XP_003550152.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|116783202|gb|ABK22835.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 127 | ||||||
| TAIR|locus:2012602 | 312 | HB31 "AT1G14440" [Arabidopsis | 0.440 | 0.179 | 0.821 | 4.2e-24 | |
| TAIR|locus:2025121 | 309 | HB33 "AT1G75240" [Arabidopsis | 0.590 | 0.242 | 0.597 | 8.7e-24 | |
| TAIR|locus:2065304 | 310 | HB21 "homeobox protein 21" [Ar | 0.417 | 0.170 | 0.811 | 3.4e-22 | |
| TAIR|locus:2150871 | 271 | HB30 "AT5G15210" [Arabidopsis | 0.496 | 0.232 | 0.6 | 2.9e-21 | |
| TAIR|locus:2121989 | 220 | HB22 "AT4G24660" [Arabidopsis | 0.456 | 0.263 | 0.688 | 4.4e-20 | |
| TAIR|locus:2168240 | 279 | HB25 "AT5G65410" [Arabidopsis | 0.480 | 0.218 | 0.625 | 1.9e-19 | |
| TAIR|locus:2062141 | 262 | HB24 "AT2G18350" [Arabidopsis | 0.409 | 0.198 | 0.730 | 8.3e-19 | |
| TAIR|locus:2167052 | 334 | HB23 "AT5G39760" [Arabidopsis | 0.480 | 0.182 | 0.6 | 1.6e-18 | |
| TAIR|locus:2077957 | 249 | HB28 "homeobox protein 28" [Ar | 0.937 | 0.477 | 0.357 | 4.6e-18 | |
| TAIR|locus:2026734 | 242 | ZFHD1 "AT1G69600" [Arabidopsis | 0.409 | 0.214 | 0.666 | 8.9e-18 |
| TAIR|locus:2012602 HB31 "AT1G14440" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 276 (102.2 bits), Expect = 4.2e-24, P = 4.2e-24
Identities = 46/56 (82%), Positives = 54/56 (96%)
Query: 10 KKVVRYKECLKNHAAAIGGSATDGCGEFMPSGEEGSIESLKCSACNCHRNFHRKEI 65
K +++YKECLKNHAAA+GG+ATDGCGEFMPSGE+GSIE+L CSACNCHRNFHRKE+
Sbjct: 85 KPMIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEV 140
|
|
| TAIR|locus:2025121 HB33 "AT1G75240" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2065304 HB21 "homeobox protein 21" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150871 HB30 "AT5G15210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121989 HB22 "AT4G24660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168240 HB25 "AT5G65410" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2062141 HB24 "AT2G18350" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167052 HB23 "AT5G39760" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2077957 HB28 "homeobox protein 28" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2026734 ZFHD1 "AT1G69600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 127 | |||
| pfam04770 | 60 | pfam04770, ZF-HD_dimer, ZF-HD protein dimerisation | 1e-30 | |
| TIGR01566 | 53 | TIGR01566, ZF_HD_prot_N, ZF-HD homeobox protein Cy | 6e-25 |
| >gnl|CDD|218256 pfam04770, ZF-HD_dimer, ZF-HD protein dimerisation region | Back alignment and domain information |
|---|
Score = 103 bits (260), Expect = 1e-30
Identities = 42/54 (77%), Positives = 48/54 (88%)
Query: 12 VVRYKECLKNHAAAIGGSATDGCGEFMPSGEEGSIESLKCSACNCHRNFHRKEI 65
VRY+ECLKNHAA+IGG A DGCGEFMPSGEEG+ +SLKC+AC CHRNFHR+E
Sbjct: 3 GVRYRECLKNHAASIGGHAVDGCGEFMPSGEEGTPDSLKCAACGCHRNFHRREP 56
|
This family of proteins has are plant transcription factors, and have been named ZF-HD for zinc finger homeodomain proteins, on the basis of similarity to proteins of known structure. This region is thought to be involved in the formation of homo and heterodimers, and may form a zinc finger. Length = 60 |
| >gnl|CDD|130629 TIGR01566, ZF_HD_prot_N, ZF-HD homeobox protein Cys/His-rich dimerization domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 127 | |||
| PF04770 | 60 | ZF-HD_dimer: ZF-HD protein dimerisation region; In | 100.0 | |
| TIGR01566 | 53 | ZF_HD_prot_N ZF-HD homeobox protein Cys/His-rich d | 100.0 |
| >PF04770 ZF-HD_dimer: ZF-HD protein dimerisation region; InterPro: IPR006456 The homeodomain (HD) is a 60-amino acid DNA-binding domain found in many transcription factors | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-40 Score=224.41 Aligned_cols=58 Identities=76% Similarity=1.422 Sum_probs=55.3
Q ss_pred ceeehHHHhhhhhhhcCCccccCccccccC-CCCCCccccccccccccccccccccCCC
Q 041672 11 KVVRYKECLKNHAAAIGGSATDGCGEFMPS-GEEGSIESLKCSACNCHRNFHRKEIGCD 68 (127)
Q Consensus 11 ~~v~Y~EC~kNHAa~~GghavDGCgEFmps-g~~gt~~aL~CaACgCHRnFHRre~~~~ 68 (127)
.+|+|+||||||||+||||+||||+||||+ +++|++++|+||||||||||||||++++
T Consensus 2 ~~v~Y~EC~kNHAa~~Gg~a~DGCgEFm~~~g~eg~~~al~CaACgCHRnFHRre~~~e 60 (60)
T PF04770_consen 2 KVVRYRECLKNHAASIGGHAVDGCGEFMPSPGEEGTPEALKCAACGCHRNFHRREVEGE 60 (60)
T ss_pred CceeHHHHHhhHhHhhCCcccccccccccCCCCCCCcccceecccCcchhcccCCcCCC
Confidence 479999999999999999999999999999 8899999999999999999999998764
|
HD-containing proteins are found in diverse organisms such as humans, Drosophila, nematode worms, and plants, where they play important roles in development. Zinc-finger-homeodomain (ZF- HD) subfamily proteins have only been identified in plants, and likely play plant specific roles. ZF-HD proteins are expressed predominantly or exclusively in floral tissue, indicating a likely regulatory role during floral development []. The ZF-HD class of homeodomain proteins may also be involved in the photosynthesis-related mesophyll-specific gene expression of phosphoenolpyruvate carboxylase in C4 species [] and in pathogen signaling and plant defense mechanisms []. These proteins share three domains of high sequence similarity: the homeodomain (II) located at the carboxy-terminus, and two other segments (Ia and Ib) located in the amino-terminal part. These N-terminal domains contain five conserved cysteine residues and at least three conserved histidine residues whose spacing ressembles zinc-binding domains involved in dimerization of transcription factors. Although the two domains contain at least eight potential zinc-binding amino-acids, the unique spacing of the conserved cysteine and histidine residues within domain Ib suggests that both domains form one rather than two zinc finger structures. The two conserved motifs Ia and Ib constitute a dimerization domain which is sufficient for the formation of homo- and heterodimers []. This entry represents the N-terminal Cysteine/Histidine-rich dimerization domain. The companion ZF-HD homeobox domain is described in IPR006455 from INTERPRO. |
| >TIGR01566 ZF_HD_prot_N ZF-HD homeobox protein Cys/His-rich dimerization domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00