Citrus Sinensis ID: 041786


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MTTVAAAKTSKEDYFAAVNHIANIVRHDIYAERTLNRLNLTLISELSMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHVCFVRMIRKGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPVRSAKQMVNKMIKQGSVPDLETFNSLIETICKSGELGLCADVNTNKISIPAVSKEFMIDEAFRLLCNLVEDGHKLFPSLGQFDDAFCFFSEMQIKTHPPNRPVYA
cHHHHccccccccHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccccc
ccHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHccccccEEEHHHHHHHHHHcccccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccEEEEc
MTTVAAAKTSKEDYFAAVNHIANIVRHDIYAERTLNRLNLTLISELSMWKTIelmkpdslsvfPQTLSLIIEEFGKHGLIDNAVEVFNKctafncqqcvLLYNSLHVCFVRMIrkgfvpdkrthTILVNAwcssgkmrEAQEFLQELsdkgfnppvrSAKQMVNKMikqgsvpdletFNSLIETICKsgelglcadvntnkisipavskeFMIDEAFRLLCNLVEdghklfpslgqfddafcffsemqikthppnrpvya
mttvaaaktskedyfAAVNHIANIVRHDIYAERTLNRLNLTLISELSMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHVCFVRMIRkgfvpdkrthTILVNAWCSSGKMREAQEFLQELSDKGFNPPVRSAKQMVNKMIKQGSVPDLETFNSLIETICKSgelglcadvntNKISIPAVSKEFMIDEAFRLLCNLVEDGHKLFPSLGQFDDAFCFFSEMqikthppnrpvya
MTTVAAAKTSKEDYFAAVNHIANIVRHDIYAERTLNRLNLTLISELSMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHVCFVRMIRKGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPVRSAKQMVNKMIKQGSVPDLETFNSLIETICKSGELGLCADVNTNKISIPAVSKEFMIDEAFRLLCNLVEDGHKLFPSLGQFDDAFCFFSEMQIKTHPPNRPVYA
************DYFAAVNHIANIVRHDIYAERTLNRLNLTLISELSMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHVCFVRMIRKGFVPDKRTHTILVNAWCSSG************************************VPDLETFNSLIETICKSGELGLCADVNTNKISIPAVSKEFMIDEAFRLLCNLVEDGHKLFPSLGQFDDAFCFFSEMQ************
MTTVA*AKTSKEDYFAAVNHIANIVRHDIYAERTLNRLNLTLISELSMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHVCFVRMIRKGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPVRSAKQMVNKMIKQGSVPDLETFNSLIETICKSGELGLCADVNTNKISIPAVSKEFMIDEAFRLLCNLVEDGHKLFPSLGQFDDAFCFFSEMQIKTHPPNRPVYA
*********SKEDYFAAVNHIANIVRHDIYAERTLNRLNLTLISELSMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHVCFVRMIRKGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPVRSAKQMVNKMIKQGSVPDLETFNSLIETICKSGELGLCADVNTNKISIPAVSKEFMIDEAFRLLCNLVEDGHKLFPSLGQFDDAFCFFSEMQIKTHPPNRPVYA
MTTVAAAKTSKEDYFAAVNHIANIVRHDIYAERTLNRLNLTLISELSMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHVCFVRMIRKGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPVRSAKQMVNKMIKQGSVPDLETFNSLIETICKSGELGLCADVNTNKISIPAVSKEFMIDEAFRLLCNLVEDGHKLFPSLGQFDDAFCFFSEMQIKTHPPNRPVYA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTVAAAKTSKEDYFAAVNHIANIVRHDIYAERTLNRLNLTLISELSMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHVCFVRMIRKGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPVRSAKQMVNKMIKQGSVPDLETFNSLIETICKSGELGLCADVNTNKISIPAVSKEFMIDEAFRLLCNLVEDGHKLFPSLGQFDDAFCFFSEMQIKTHPPNRPVYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query260 2.2.26 [Sep-21-2011]
Q94JX6459 Pentatricopeptide repeat- yes no 0.961 0.544 0.453 1e-73
Q9LPX2 644 Pentatricopeptide repeat- no no 0.476 0.192 0.287 2e-11
Q9FMF6 730 Pentatricopeptide repeat- no no 0.715 0.254 0.270 6e-11
Q9M302 659 Pentatricopeptide repeat- no no 0.657 0.259 0.261 7e-11
Q9LSL9 915 Pentatricopeptide repeat- no no 0.746 0.212 0.257 1e-10
Q9FIX3 747 Pentatricopeptide repeat- no no 0.657 0.228 0.258 2e-10
Q9ZUE9536 Pentatricopeptide repeat- no no 0.738 0.358 0.242 3e-10
Q9ASZ8 621 Pentatricopeptide repeat- no no 0.565 0.236 0.241 4e-10
Q9SZ521112 Pentatricopeptide repeat- no no 0.630 0.147 0.252 4e-10
Q9SAJ5 780 Pentatricopeptide repeat- no no 0.811 0.270 0.211 6e-10
>sp|Q94JX6|PP391_ARATH Pentatricopeptide repeat-containing protein At5g18390, mitochondrial OS=Arabidopsis thaliana GN=At5g18390 PE=2 SV=2 Back     alignment and function desciption
 Score =  276 bits (705), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 160/353 (45%), Positives = 192/353 (54%), Gaps = 103/353 (29%)

Query: 10  SKEDYFAAVNHIANIVRHDIYAERTLNRLNLTLISEL----------------------- 46
           +K DYFAA+NH+ NIVR +I+ ER+LN L L + SE                        
Sbjct: 43  TKGDYFAAINHVVNIVRREIHPERSLNSLRLPVTSEFVFRVLRATSRSSNDSLRFFNWAR 102

Query: 47  --------------------------SMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLI 80
                                     SMWK ++ MK  SL +  +TL  IIE++GK+G +
Sbjct: 103 SNPSYTPTSMEYEELAKSLASHKKYESMWKILKQMKDLSLDISGETLCFIIEQYGKNGHV 162

Query: 81  DNAVEVFNKC-TAFNCQQCVLLYNSL-------------HVCFVRMIRKGFVPDKRTHTI 126
           D AVE+FN       CQQ V +YNSL             +    RMIRKG  PDKRT+ I
Sbjct: 163 DQAVELFNGVPKTLGCQQTVDVYNSLLHALCDVKMFHGAYALIRRMIRKGLKPDKRTYAI 222

Query: 127 LVNAWCSSGKMREAQEFLQELSDKGFNPPVR----------------SAKQMVNKMIKQG 170
           LVN WCS+GKM+EAQEFL E+S +GFNPP R                SAK+MV+KM K G
Sbjct: 223 LVNGWCSAGKMKEAQEFLDEMSRRGFNPPARGRDLLIEGLLNAGYLESAKEMVSKMTKGG 282

Query: 171 SVPDLETFNSLIETICKSGE-------------LGLCADVNTNKISIPAVSKEFMIDEAF 217
            VPD++TFN LIE I KSGE             LGLC D++T K  IPAVSK   IDEAF
Sbjct: 283 FVPDIQTFNILIEAISKSGEVEFCIEMYYTACKLGLCVDIDTYKTLIPAVSKIGKIDEAF 342

Query: 218 RLLCNLVEDGHKLFPSL-----------GQFDDAFCFFSEMQIKTHPPNRPVY 259
           RLL N VEDGHK FPSL           G FDDAF FFS+M++K HPPNRPVY
Sbjct: 343 RLLNNCVEDGHKPFPSLYAPIIKGMCRNGMFDDAFSFFSDMKVKAHPPNRPVY 395





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 Back     alignment and function description
>sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 Back     alignment and function description
>sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1 Back     alignment and function description
>sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SAJ5|PP133_ARATH Pentatricopeptide repeat-containing protein At1g79540 OS=Arabidopsis thaliana GN=At1g79540 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
224144668 422 predicted protein [Populus trichocarpa] 0.984 0.606 0.463 2e-76
449449535 455 PREDICTED: pentatricopeptide repeat-cont 0.984 0.562 0.443 4e-73
255562047 451 pentatricopeptide repeat-containing prot 0.984 0.567 0.444 1e-72
15238810 459 pentatricopeptide repeat-containing prot 0.961 0.544 0.453 7e-72
297807861 459 pentatricopeptide repeat-containing prot 0.961 0.544 0.450 3e-71
225430658 454 PREDICTED: pentatricopeptide repeat-cont 0.95 0.544 0.429 4e-70
356510681 450 PREDICTED: pentatricopeptide repeat-cont 0.988 0.571 0.413 4e-67
125562258 465 hypothetical protein OsI_29963 [Oryza sa 0.965 0.539 0.365 1e-57
125604075 461 hypothetical protein OsJ_28005 [Oryza sa 0.965 0.544 0.365 1e-57
326513918 459 predicted protein [Hordeum vulgare subsp 0.965 0.546 0.353 4e-55
>gi|224144668|ref|XP_002325369.1| predicted protein [Populus trichocarpa] gi|222862244|gb|EEE99750.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 167/360 (46%), Positives = 205/360 (56%), Gaps = 104/360 (28%)

Query: 5   AAAKTSKEDYFAAVNHIANIVRHDIYAERTLNRLNLTLISEL------------------ 46
           +    +++ YF+ +++I NI+R ++Y ERTLN+LNL + SEL                  
Sbjct: 1   STTTNNRDAYFSLIHNITNIIRKEVYPERTLNKLNLPITSELVFRVLRACSNSPSESLRF 60

Query: 47  -----------------------------SMWKTIELMK---PDSLSVFPQTLSLIIEEF 74
                                        SMWK I  +K    D  SV   T+  IIEE+
Sbjct: 61  FNWARSYYSPTTIEYEELIITLVRNKKYASMWKLIAQVKDNLGDKFSVSSDTVCSIIEEY 120

Query: 75  GKHGLIDNAVEVFNKCT-AFNCQQCVLLYNSL--HVCFV-----------RMIRKGFVPD 120
           GKHGLID AVEVFNKC+ + NCQ  V +YNSL   +C V           RMIRKG VPD
Sbjct: 121 GKHGLIDQAVEVFNKCSRSLNCQHNVCVYNSLLFALCEVKMFHGAYALVRRMIRKGIVPD 180

Query: 121 KRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPVR----------------SAKQMVN 164
           KRT+ +LVN WCSSGK+REA+ FL+E+S KGFNPPVR                SAK MV 
Sbjct: 181 KRTYGVLVNGWCSSGKLREAKGFLEEMSKKGFNPPVRGRDLLIEGLLNAGYLESAKDMVR 240

Query: 165 KMIKQGSVPDLETFNSLIETICKSGE-------------LGLCADVNTNKISIPAVSKEF 211
           +M+K+G VPD+ TFNS++E IC +GE             LG C D+N+ KI IPAVSK  
Sbjct: 241 RMMKEGLVPDVNTFNSMVEAICNAGEVDFCVDMYHSVCKLGFCPDINSYKILIPAVSKVG 300

Query: 212 MIDEAFRLLCNLVEDGHKLFPSL-----------GQFDDAFCFFSEMQIKTHPPNRPVYA 260
            IDEAFRLL NL+EDGHK FPSL           GQFDDAFCFFSEM++K HPPNRPVY 
Sbjct: 301 RIDEAFRLLHNLIEDGHKPFPSLYAPIIKGMFRRGQFDDAFCFFSEMKVKGHPPNRPVYT 360




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449449535|ref|XP_004142520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Cucumis sativus] gi|449518358|ref|XP_004166209.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255562047|ref|XP_002522032.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538836|gb|EEF40436.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15238810|ref|NP_197340.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635760|sp|Q94JX6.2|PP391_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g18390, mitochondrial; Flags: Precursor gi|332005166|gb|AED92549.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297807861|ref|XP_002871814.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317651|gb|EFH48073.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225430658|ref|XP_002268375.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vitis vinifera] gi|296085168|emb|CBI28663.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356510681|ref|XP_003524064.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|125562258|gb|EAZ07706.1| hypothetical protein OsI_29963 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|125604075|gb|EAZ43400.1| hypothetical protein OsJ_28005 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|326513918|dbj|BAJ92109.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
TAIR|locus:2146288459 AT5G18390 "AT5G18390" [Arabido 0.776 0.440 0.424 4.2e-47
TAIR|locus:2095309 687 AT3G09060 "AT3G09060" [Arabido 0.730 0.276 0.254 2.8e-09
TAIR|locus:2150024729 AT5G01110 [Arabidopsis thalian 0.7 0.249 0.266 4.8e-08
TAIR|locus:2164910 747 EMB2745 "EMBRYO DEFECTIVE 2745 0.588 0.204 0.269 1.9e-07
TAIR|locus:2024296 598 AT1G09900 "AT1G09900" [Arabido 0.707 0.307 0.236 3.1e-07
TAIR|locus:1009023134 644 AT1G12775 [Arabidopsis thalian 0.476 0.192 0.294 3.5e-07
TAIR|locus:2099458 659 AT3G48810 "AT3G48810" [Arabido 0.865 0.341 0.236 4.8e-07
TAIR|locus:2012883 537 AT1G20300 [Arabidopsis thalian 0.530 0.256 0.231 1e-06
TAIR|locus:2049756 757 AT2G37230 [Arabidopsis thalian 0.773 0.265 0.257 1.7e-06
TAIR|locus:2038451323 AT1G63230 [Arabidopsis thalian 0.488 0.393 0.243 2.7e-06
TAIR|locus:2146288 AT5G18390 "AT5G18390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 396 (144.5 bits), Expect = 4.2e-47, Sum P(2) = 4.2e-47
 Identities = 104/245 (42%), Positives = 136/245 (55%)

Query:    47 SMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCT-AFNCQQCVLLYNSL 105
             SMWK ++ MK  SL +  +TL  IIE++GK+G +D AVE+FN       CQQ V +YNSL
Sbjct:   129 SMWKILKQMKDLSLDISGETLCFIIEQYGKNGHVDQAVELFNGVPKTLGCQQTVDVYNSL 188

Query:   106 -H-VCFV-----------RMIRKGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGF 152
              H +C V           RMIRKG  PDKRT+ ILVN WCS+GKM+EAQEFL E+S +GF
Sbjct:   189 LHALCDVKMFHGAYALIRRMIRKGLKPDKRTYAILVNGWCSAGKMKEAQEFLDEMSRRGF 248

Query:   153 NPPVR----------------SAKQMVNKMIKQGSVPDLETFNSLIETICKSGELGLCAD 196
             NPP R                SAK+MV+KM K G VPD++TFN LIE I KSGE+  C +
Sbjct:   249 NPPARGRDLLIEGLLNAGYLESAKEMVSKMTKGGFVPDIQTFNILIEAISKSGEVEFCIE 308

Query:   197 VNTNKISIPAVSKEFMID-EAFRLLCNLVEDGHKLFPSLGQFDDAFCFFSEMQIKTHPPN 255
             +        A      +D + ++ L   V         +G+ D+AF   +      H P 
Sbjct:   309 MYYT-----ACKLGLCVDIDTYKTLIPAVS-------KIGKIDEAFRLLNNCVEDGHKPF 356

Query:   256 RPVYA 260
               +YA
Sbjct:   357 PSLYA 361


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2095309 AT3G09060 "AT3G09060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150024 AT5G01110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024296 AT1G09900 "AT1G09900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023134 AT1G12775 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099458 AT3G48810 "AT3G48810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012883 AT1G20300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049756 AT2G37230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038451 AT1G63230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-04
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
 Score = 40.8 bits (97), Expect = 1e-05
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 115 KGFVPDKRTHTILVNAWCSSGKMREAQEFLQE 146
           KG  PD  T+  L++  C +G++ EA E L E
Sbjct: 1   KGLKPDVVTYNTLIDGLCRAGRVDEAVELLDE 32


This family matches additional variants of the PPR repeat that were not captured by the model for pfam01535. The exact function is not known. Length = 34

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 260
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PF1304150 PPR_2: PPR repeat family 99.55
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.51
PF1304150 PPR_2: PPR repeat family 99.49
PRK11788389 tetratricopeptide repeat protein; Provisional 99.44
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.42
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.32
PF1285434 PPR_1: PPR repeat 99.21
PF1285434 PPR_1: PPR repeat 99.16
PRK11788389 tetratricopeptide repeat protein; Provisional 99.09
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.97
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.66
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.64
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.63
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.63
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.5
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.46
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.38
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.26
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.22
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.2
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.16
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.96
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.95
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 97.94
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.94
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 97.92
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 97.9
PRK14574 822 hmsH outer membrane protein; Provisional 97.85
KOG1126638 consensus DNA-binding cell division cycle control 97.8
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.79
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.75
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 97.68
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.63
KOG1129478 consensus TPR repeat-containing protein [General f 97.63
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.59
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.54
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.5
PRK12370553 invasion protein regulator; Provisional 97.48
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.46
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.43
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.41
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.38
KOG1126638 consensus DNA-binding cell division cycle control 97.38
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.38
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.37
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.33
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.33
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.32
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.27
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.2
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.18
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.09
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.05
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.02
PRK14574 822 hmsH outer membrane protein; Provisional 96.97
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 96.97
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 96.89
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 96.88
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 96.81
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.78
PRK12370553 invasion protein regulator; Provisional 96.73
cd05804355 StaR_like StaR_like; a well-conserved protein foun 96.69
PRK15359144 type III secretion system chaperone protein SscB; 96.62
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.51
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.5
PRK11189296 lipoprotein NlpI; Provisional 96.46
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.43
PRK15359144 type III secretion system chaperone protein SscB; 96.41
KOG3941 406 consensus Intermediate in Toll signal transduction 96.34
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.26
KOG2003840 consensus TPR repeat-containing protein [General f 96.26
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.22
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 96.21
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.07
PRK10370198 formate-dependent nitrite reductase complex subuni 96.02
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.01
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.01
TIGR02552135 LcrH_SycD type III secretion low calcium response 95.98
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 95.95
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.92
KOG2047 835 consensus mRNA splicing factor [RNA processing and 95.9
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.78
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.77
KOG0547606 consensus Translocase of outer mitochondrial membr 95.76
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 95.72
PRK11189296 lipoprotein NlpI; Provisional 95.67
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.64
KOG2076 895 consensus RNA polymerase III transcription factor 95.62
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 95.53
KOG0547606 consensus Translocase of outer mitochondrial membr 95.53
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 95.46
KOG2003 840 consensus TPR repeat-containing protein [General f 95.44
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 95.42
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 95.27
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 95.27
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 95.25
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 95.23
KOG1129478 consensus TPR repeat-containing protein [General f 95.16
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.1
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.01
KOG1915 677 consensus Cell cycle control protein (crooked neck 94.97
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 94.82
KOG2047 835 consensus mRNA splicing factor [RNA processing and 94.77
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.73
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 94.73
PRK10370198 formate-dependent nitrite reductase complex subuni 94.55
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 94.53
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 94.52
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 94.44
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 94.37
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 94.27
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.19
cd00189100 TPR Tetratricopeptide repeat domain; typically con 94.0
KOG1915 677 consensus Cell cycle control protein (crooked neck 93.87
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 93.69
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.59
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 93.39
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 93.33
KOG3941 406 consensus Intermediate in Toll signal transduction 93.22
KOG2076 895 consensus RNA polymerase III transcription factor 93.19
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 93.15
KOG0495913 consensus HAT repeat protein [RNA processing and m 92.71
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 92.7
KOG1914656 consensus mRNA cleavage and polyadenylation factor 92.61
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 92.56
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.54
KOG4340 459 consensus Uncharacterized conserved protein [Funct 92.49
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 92.39
COG3629280 DnrI DNA-binding transcriptional activator of the 92.31
KOG4570 418 consensus Uncharacterized conserved protein [Funct 92.1
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 91.84
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 91.65
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 91.62
PF1337173 TPR_9: Tetratricopeptide repeat 91.57
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.48
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 91.2
COG3629280 DnrI DNA-binding transcriptional activator of the 91.18
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 91.02
PRK10803263 tol-pal system protein YbgF; Provisional 90.44
CHL00033168 ycf3 photosystem I assembly protein Ycf3 90.42
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 90.35
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 90.11
KOG3616 1636 consensus Selective LIM binding factor [Transcript 89.8
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 89.77
KOG3060289 consensus Uncharacterized conserved protein [Funct 89.72
KOG0495 913 consensus HAT repeat protein [RNA processing and m 89.66
KOG4340 459 consensus Uncharacterized conserved protein [Funct 89.56
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 89.47
PRK10153517 DNA-binding transcriptional activator CadC; Provis 89.41
KOG1125579 consensus TPR repeat-containing protein [General f 88.63
PF13762145 MNE1: Mitochondrial splicing apparatus component 88.58
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 88.56
KOG0553304 consensus TPR repeat-containing protein [General f 88.51
PRK02603172 photosystem I assembly protein Ycf3; Provisional 87.84
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 87.61
PF1342844 TPR_14: Tetratricopeptide repeat 87.24
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 86.42
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 86.27
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 86.11
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.79
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.67
KOG3785557 consensus Uncharacterized conserved protein [Funct 85.58
PF1342844 TPR_14: Tetratricopeptide repeat 85.21
KOG3616 1636 consensus Selective LIM binding factor [Transcript 85.19
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 85.16
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 85.13
PRK02603172 photosystem I assembly protein Ycf3; Provisional 84.92
KOG1125579 consensus TPR repeat-containing protein [General f 84.75
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 84.71
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 84.58
PRK10803263 tol-pal system protein YbgF; Provisional 84.57
smart00299140 CLH Clathrin heavy chain repeat homology. 84.2
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.84
KOG4570418 consensus Uncharacterized conserved protein [Funct 83.47
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 83.28
PRK10153517 DNA-binding transcriptional activator CadC; Provis 83.17
KOG1128 777 consensus Uncharacterized conserved protein, conta 83.11
PF12688120 TPR_5: Tetratrico peptide repeat 83.06
PF13170297 DUF4003: Protein of unknown function (DUF4003) 82.37
smart00299140 CLH Clathrin heavy chain repeat homology. 82.34
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 82.3
PRK14720 906 transcript cleavage factor/unknown domain fusion p 82.12
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 81.91
PRK14720 906 transcript cleavage factor/unknown domain fusion p 81.9
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 81.63
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 81.53
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 80.58
PF1337173 TPR_9: Tetratricopeptide repeat 80.42
PF12688120 TPR_5: Tetratrico peptide repeat 80.31
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.3e-40  Score=301.51  Aligned_cols=233  Identities=19%  Similarity=0.204  Sum_probs=181.9

Q ss_pred             ccchhHHHHHhhhhhcchHHHHHHHHhcccCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHhhhcCCCCcHHHHHHHHH
Q 041786           28 DIYAERTLNRLNLTLISELSMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHV  107 (260)
Q Consensus        28 ~~~~~~~~~~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~  107 (260)
                      +..+++.++..+.+++....|.++|++|.+.|+.||..+|+.||.+|++.|++++|.++|++|.+.|+.||..+|+.||.
T Consensus       471 D~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~  550 (1060)
T PLN03218        471 DCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALIS  550 (1060)
T ss_pred             CHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHH
Confidence            44556778888888888888888888888888888888888888888888888888888888888888888888888885


Q ss_pred             HH-------------HHHHh--CCCCCCHhhHHHHHHHHhccCCHHHHHHHHHHHHhCCCCCCHH---------------
Q 041786          108 CF-------------VRMIR--KGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPVR---------------  157 (260)
Q Consensus       108 ~~-------------~~m~~--~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~~~~---------------  157 (260)
                      ++             ++|..  .|+.||..+|++||.+|+++|++++|.++|++|.+.|+.|+..               
T Consensus       551 a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e~gi~p~~~tynsLI~ay~k~G~~  630 (1060)
T PLN03218        551 ACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDW  630 (1060)
T ss_pred             HHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCH
Confidence            54             55654  5788888888888888888888888888888888888766654               


Q ss_pred             -HHHHHHHHHHHCCCCCChhchHHHHHHHHhcCC-------------CCCCcchHHHHHHHHhhhhhccHHHHHHHHHHH
Q 041786          158 -SAKQMVNKMIKQGSVPDLETFNSLIETICKSGE-------------LGLCADVNTNKISIPAVSKEFMIDEAFRLLCNL  223 (260)
Q Consensus       158 -~a~~l~~~m~~~g~~p~~~~~~~li~~~~~~~~-------------~~~~~~~~t~~~li~~~~~~g~~~~a~~~~~~m  223 (260)
                       +|.++|++|.+.|+.||..+|+++|++|++.|+             .|+.||..+|+.||.+|++.|++++|.++|++|
T Consensus       631 deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM  710 (1060)
T PLN03218        631 DFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDI  710 (1060)
T ss_pred             HHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHH
Confidence             778888888888888888888888888888777             566777777777777777777777777777777


Q ss_pred             HHCCCCcCCCc-----------ccHHHHHHHHHHHHhcCCCCCCCCCC
Q 041786          224 VEDGHKLFPSL-----------GQFDDAFCFFSEMQIKTHPPNRPVYA  260 (260)
Q Consensus       224 ~~~~~~p~~~~-----------g~~~~a~~~~~~m~~~g~~p~~~ty~  260 (260)
                      .+.|+.|+..+           |++++|.++|++|...|+.||..||+
T Consensus       711 ~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~  758 (1060)
T PLN03218        711 KSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYS  758 (1060)
T ss_pred             HHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHH
Confidence            77777766655           67777777777777677777766653



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 47.5 bits (111), Expect = 2e-06
 Identities = 15/141 (10%), Positives = 33/141 (23%), Gaps = 38/141 (26%)

Query: 50  KTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHVCF 109
                     LS   Q L    +       +  A  +                       
Sbjct: 113 APSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVV-------------------H 153

Query: 110 VRMIRKGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPVRSAKQMVNKMIKQ 169
               +K  +     +  ++  W   G  +E    L  + D G  P               
Sbjct: 154 HGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTP--------------- 198

Query: 170 GSVPDLETFNSLIETICKSGE 190
               DL ++ + ++ + +  +
Sbjct: 199 ----DLLSYAAALQCMGRQDQ 215


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.85
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.79
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.64
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.6
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.95
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.77
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.75
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.73
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.72
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.71
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.69
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.61
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.61
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.59
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.56
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.55
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.53
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.51
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.5
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.49
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.49
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.43
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.41
2gw1_A514 Mitochondrial precursor proteins import receptor; 98.41
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.4
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.4
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.38
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.35
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.34
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.33
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.33
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 98.3
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.29
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.27
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.25
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.23
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.23
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.16
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.15
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.09
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.03
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.96
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 97.95
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.94
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.93
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.91
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 97.89
3u4t_A272 TPR repeat-containing protein; structural genomics 97.84
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.76
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.73
3u4t_A272 TPR repeat-containing protein; structural genomics 97.73
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.67
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.66
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.61
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.59
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.58
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.54
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 97.49
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.48
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 97.42
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.37
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.34
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.33
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.33
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.32
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.32
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.31
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.27
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.26
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.25
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.24
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.22
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 97.2
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.19
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.19
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.17
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.16
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.15
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.14
4g1t_A472 Interferon-induced protein with tetratricopeptide 97.13
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.13
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.12
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.12
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.08
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.07
4g1t_A472 Interferon-induced protein with tetratricopeptide 97.06
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.04
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.04
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.03
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.02
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.01
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.99
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.99
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.97
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.96
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.94
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 96.93
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 96.92
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.91
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.91
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.9
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.88
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.84
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.81
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 96.74
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.71
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.71
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.7
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.65
3q15_A378 PSP28, response regulator aspartate phosphatase H; 96.64
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.64
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.62
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.56
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.56
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 96.56
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 96.53
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.53
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.5
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.48
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.47
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.46
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.42
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.42
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.39
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 96.3
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 96.3
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.29
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.28
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 96.23
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.21
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 96.21
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 96.2
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 96.14
3k9i_A117 BH0479 protein; putative protein binding protein, 96.14
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 96.13
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.12
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.11
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.11
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.07
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.99
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.98
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.96
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.95
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.91
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.88
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.84
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 95.79
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.73
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 95.66
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.61
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.56
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.48
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 95.43
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 95.38
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 95.35
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 95.35
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.3
3k9i_A117 BH0479 protein; putative protein binding protein, 95.26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 95.11
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 95.09
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.0
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 94.7
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 94.67
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 94.43
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 94.38
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 94.34
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.24
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.21
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 94.05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 93.99
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 93.39
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 93.26
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 93.01
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 92.99
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 92.71
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 91.91
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 91.33
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 91.22
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 91.03
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 90.9
2l6j_A111 TPR repeat-containing protein associated with HSP; 90.84
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 90.07
1pc2_A152 Mitochondria fission protein; unknown function; NM 89.83
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 89.48
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 89.39
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 89.1
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 89.06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 88.99
2kat_A115 Uncharacterized protein; NESG, structure, structur 88.15
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 87.93
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.83
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 87.03
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 86.8
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 86.35
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 85.73
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 84.79
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 84.59
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.16
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 84.08
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 82.64
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 81.7
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 81.51
1klx_A138 Cysteine rich protein B; structural genomics, heli 81.02
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=99.97  E-value=2.3e-31  Score=229.35  Aligned_cols=169  Identities=15%  Similarity=0.184  Sum_probs=138.2

Q ss_pred             HHHHHHHhcccCCCCCCH-HHHHHHHHHHHhcCChHHHHHHHHHhhhcCCCCcHHHHHHHHHHH----------------
Q 041786           47 SMWKTIELMKPDSLSVFP-QTLSLIIEEFGKHGLIDNAVEVFNKCTAFNCQQCVLLYNSLHVCF----------------  109 (260)
Q Consensus        47 ~a~~~~~~m~~~g~~~~~-~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~----------------  109 (260)
                      .+..+.+.+.+++..+.. ..++.+|++|++.|++++|+++|++|.+.|++||..|||+||.++                
T Consensus         8 ~~e~L~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~   87 (501)
T 4g26_A            8 PSENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLS   87 (501)
T ss_dssp             ----------------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHH
T ss_pred             hHHHHHHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHH
Confidence            345566777777766554 457888888888888888888888888888888888888888432                


Q ss_pred             ------HHHHhCCCCCCHhhHHHHHHHHhccCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHCCCCCChhchHHHHH
Q 041786          110 ------VRMIRKGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPVRSAKQMVNKMIKQGSVPDLETFNSLIE  183 (260)
Q Consensus       110 ------~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~a~~l~~~m~~~g~~p~~~~~~~li~  183 (260)
                            ++|.+.|+.||..|||+||++|++.|++++|.++|++|.                   +.|+.||..||++||.
T Consensus        88 ~A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~-------------------~~g~~Pd~~tyn~lI~  148 (501)
T 4g26_A           88 RGFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMK-------------------AFGIQPRLRSYGPALF  148 (501)
T ss_dssp             HHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHH-------------------HTTCCCCHHHHHHHHH
T ss_pred             HHHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHH-------------------HcCCCCccceehHHHH
Confidence                  678889999999999999999999999999999988887                   4568899999999999


Q ss_pred             HHHhcCC-------------CCCCcchHHHHHHHHhhhhhccHHHHHHHHHHHHHCCCCcCCCc
Q 041786          184 TICKSGE-------------LGLCADVNTNKISIPAVSKEFMIDEAFRLLCNLVEDGHKLFPSL  234 (260)
Q Consensus       184 ~~~~~~~-------------~~~~~~~~t~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~  234 (260)
                      +|++.|+             .|+.||..||++||.+|++.|++++|.++|++|.+.|+.|+..|
T Consensus       149 ~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T  212 (501)
T 4g26_A          149 GFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKST  212 (501)
T ss_dssp             HHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHH
T ss_pred             HHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHH
Confidence            9999998             89999999999999999999999999999999999999999888



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.35
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.18
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.1
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.75
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.35
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.18
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.08
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.96
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.94
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.9
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.82
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.81
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 96.56
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.47
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 96.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.37
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.36
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.27
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.2
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.18
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.17
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 96.02
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 95.68
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.61
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.57
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 95.46
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 94.22
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 94.14
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 93.88
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 93.77
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 93.42
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 93.28
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 93.19
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 92.11
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 91.37
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 90.48
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 90.43
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 89.53
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 87.77
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.74
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 85.77
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 85.55
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 85.52
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.53  E-value=1.6e-05  Score=62.76  Aligned_cols=231  Identities=13%  Similarity=0.043  Sum_probs=143.8

Q ss_pred             chhhhhHHHHHHHHcccch---hHHHHHhhhhhcchHHHHHHHHhcccCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHH
Q 041786           13 DYFAAVNHIANIVRHDIYA---ERTLNRLNLTLISELSMWKTIELMKPDSLSVFPQTLSLIIEEFGKHGLIDNAVEVFNK   89 (260)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~li~~~~~~~~~~~a~~~~~~   89 (260)
                      .+..+...+...++.++..   ...+-.++...+...+|.+.|+...+.. +-+...|..+...|.+.|++++|+..+..
T Consensus        14 ~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~~~A~~~~~~   92 (388)
T d1w3ba_          14 DFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQLQEAIEHYRH   92 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhcccccccccccc
Confidence            3445566666666555432   3444455666777779999999876543 22578899999999999999999999998


Q ss_pred             hhhcCCCCcHHHHHHHHHHH------------------------------------------------------------
Q 041786           90 CTAFNCQQCVLLYNSLHVCF------------------------------------------------------------  109 (260)
Q Consensus        90 m~~~~~~~~~~~~~~li~~~------------------------------------------------------------  109 (260)
                      ..+.................                                                            
T Consensus        93 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  172 (388)
T d1w3ba_          93 ALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAW  172 (388)
T ss_dssp             HHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHH
Confidence            88754322211111111000                                                            


Q ss_pred             --------------------HHHHhCCCCC-CHhhHHHHHHHHhccCCHHHHHHHHHHHHhCCC---------------C
Q 041786          110 --------------------VRMIRKGFVP-DKRTHTILVNAWCSSGKMREAQEFLQELSDKGF---------------N  153 (260)
Q Consensus       110 --------------------~~m~~~g~~p-~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~---------------~  153 (260)
                                          ++..  ...| +...|..+-..+...|++++|...+......+.               .
T Consensus       173 ~~l~~~~~~~~~~~~A~~~~~~al--~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~  250 (388)
T d1w3ba_         173 SNLGCVFNAQGEIWLAIHHFEKAV--TLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQ  250 (388)
T ss_dssp             HHHHHHHHTTTCHHHHHHHHHHHH--HHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHT
T ss_pred             HhhcccccccCcHHHHHHHHHHHH--HhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHC
Confidence                                0000  1123 234555566666677777777777766554322               1


Q ss_pred             CCHHHHHHHHHHHHHCCCCCChhchHHHHHHHHhcCC------------CCCCcchHHHHHHHHhhhhhccHHHHHHHHH
Q 041786          154 PPVRSAKQMVNKMIKQGSVPDLETFNSLIETICKSGE------------LGLCADVNTNKISIPAVSKEFMIDEAFRLLC  221 (260)
Q Consensus       154 ~~~~~a~~l~~~m~~~g~~p~~~~~~~li~~~~~~~~------------~~~~~~~~t~~~li~~~~~~g~~~~a~~~~~  221 (260)
                      .+..+|...|+...+.. +-+...|..+...|...|+            .....+...+..+...+.+.|++++|...|+
T Consensus       251 ~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~  329 (388)
T d1w3ba_         251 GLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYR  329 (388)
T ss_dssp             TCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHH
Confidence            22236777777766543 2245677777777777776            2233455677777788888888888888888


Q ss_pred             HHHHCCCCcCCCc------------ccHHHHHHHHHHHHh
Q 041786          222 NLVEDGHKLFPSL------------GQFDDAFCFFSEMQI  249 (260)
Q Consensus       222 ~m~~~~~~p~~~~------------g~~~~a~~~~~~m~~  249 (260)
                      +..+.  .|+...            |++++|+..|++..+
T Consensus       330 ~al~~--~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  367 (388)
T d1w3ba_         330 KALEV--FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR  367 (388)
T ss_dssp             HHTTS--CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT
T ss_pred             HHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            87653  344332            888888888887764



>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure