Citrus Sinensis ID: 041970


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MSFFSLGHFFKRLPYKQLTRHQNLFTLIKQKPRTQLTTPSSVLIKVSAPSSSSSSSPCASLSSIYPPSVESPYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSIFPECKDVDECILNTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEWNVQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGTVDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLSSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccHHHHHHHHHHHccccEEEEEccccccccccccEEEEEEccccccHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHccccEEEEcccEEEcccccccccEEEcccccccccccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccHHHHcccccccccccccccEEEEEccHHHHHHHHHHHHHHcccccEEEEEEccccc
cccccHHHHHHcccHHHHHHHHHHHHHHHccccEEEEcccHHHHHEccccccccccccccccccccccccccEEEEEEEccHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEEEEcccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHcccEEEccEEEEEccccccEEEEEEcccccccccccHHHHHHHHHHHHccccccEEEEEcEEcccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHccEEEEcccccccccccccccEEHHHHHHHHHHHHHHHHHHHcccccEEEEEHHHccc
msffslghffkrlpykqlTRHQNLFTlikqkprtqlttpssvlikvsapssssssspcaslssiyppsvespyLLVRICCQKHALdmfseaplcfgasstsvdehdndadensdeiyidsifpeckdvDECILNTansiglkeipryevkmgEQCNWIKKAQesfhpvevtkglwivpewnvqatniilnpglafgtgehaTTKLCLLLLRSLIKGGElfldygtvdidpqvIKSAHQNaalnnigpkkmklhlvpdrtfpssmnERVDGIVEYLSShkirgiseteeYDVVIANILLNPLLQLADHIVSyakpgavvgisgilseq
MSFFSLGHFFKRLPYKQLTRHQNLFtlikqkprtqlttpssVLIKVsapssssssspcASLSSIYPPSVESPYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSIFPECKDVDECILNTansiglkeiprYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEWNVQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGTVDIDPQVIKSAHQNAAlnnigpkkmklHLVPDRTFPSSMNERVDGIVEYLSSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ
MSFFSLGHFFKRLPYKQLTRHQNLFTLIKQKPRTQLTTPssvlikvsapssssssspcaslssiYPPSVESPYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSIFPECKDVDECILNTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEWNVQATNIILNPGLAFGTGEHATTKlcllllrslIKGGELFLDYGTVDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLSSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ
**FFSLGHFFKRLPYKQLTRHQNLFTLIK***************************************VESPYLLVRICCQKHALDMFSEAPLCFGA*****************EIYIDSIFPECKDVDECILNTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEWNVQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGTVDIDPQVIKSAHQNAALNNIGPKKMKLHLVPD********ERVDGIVEYLSSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGI****
******GHFFKRLPYKQLT************************************************SVESPYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSIFPECKDVDECILNTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEWNVQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGTVDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLSSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ
MSFFSLGHFFKRLPYKQLTRHQNLFTLIKQKPRTQLTTPSSVLIK******************IYPPSVESPYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSIFPECKDVDECILNTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEWNVQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGTVDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLSSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ
*SFFSLGHFFKRLPYKQLTRHQNLFTLIKQKPRTQLTTPSSVLIKVS****************IYPPSVESPYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSIFPECKDVDECILNTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEWNVQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGTVDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLSSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFFSLGHFFKRLPYKQLTRHQNLFTLIKQKPRTQLTTPSSVLIKVSAPSSSSSSSPCASLSSIYPPSVESPYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSIFPECKDVDECILNTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEWNVQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGTVDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLSSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query327 2.2.26 [Sep-21-2011]
A4JBD7300 Ribosomal protein L11 met yes no 0.681 0.743 0.295 2e-28
Q478R6296 Ribosomal protein L11 met yes no 0.489 0.540 0.367 5e-28
A0K4C9300 Ribosomal protein L11 met yes no 0.681 0.743 0.305 6e-28
Q1BZC1300 Ribosomal protein L11 met yes no 0.681 0.743 0.305 6e-28
B1JVC0300 Ribosomal protein L11 met yes no 0.681 0.743 0.302 9e-28
A9AI41300 Ribosomal protein L11 met yes no 0.681 0.743 0.298 1e-27
B4E5V2300 Ribosomal protein L11 met yes no 0.681 0.743 0.305 1e-27
Q0BIF9300 Ribosomal protein L11 met yes no 0.681 0.743 0.298 2e-27
B1YSW5300 Ribosomal protein L11 met yes no 0.681 0.743 0.298 2e-27
Q3SMB4296 Ribosomal protein L11 met yes no 0.694 0.766 0.317 4e-27
>sp|A4JBD7|PRMA_BURVG Ribosomal protein L11 methyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=prmA PE=3 SV=1 Back     alignment and function desciption
 Score =  126 bits (317), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/291 (29%), Positives = 133/291 (45%), Gaps = 68/291 (23%)

Query: 75  LVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSIFPE---------- 124
           LV    ++HA +  S+A L  GA S SV++ D D  +         + PE          
Sbjct: 6   LVVELAREHA-EALSDALLDLGALSVSVEDADADTPDEQPLFGEPGLVPERTAWQHSRVV 64

Query: 125 ---CKDVDECIL--NTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPE 179
                D++  +L    AN IG+ + P+++V+  E+ +W++  Q  F P+ + + +W+VP 
Sbjct: 65  ALLSPDLEPAVLLAAAANEIGIADTPKFDVREVEEQDWVRLTQSQFEPIPIGERIWVVPS 124

Query: 180 W----NVQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYG----------- 224
           W    +  A  + L+PGLAFGTG H TT+LC+  L   +K G+  LDYG           
Sbjct: 125 WHDAPDPDALILELDPGLAFGTGSHPTTRLCMEWLEQTVKPGQSVLDYGCGSGILAILAR 184

Query: 225 --------TVDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLS 276
                    +DIDPQ ++SA QN+  N+           PD                   
Sbjct: 185 KCGADPVIGIDIDPQAVESARQNSERNHADVTYGLPDACPDG------------------ 226

Query: 277 SHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ 327
                      E+D+V+ANIL NPL  +A  + S  KPG  + +SG+L+ Q
Sbjct: 227 -----------EFDIVVANILSNPLKLMASMLASKVKPGGRIALSGVLARQ 266




Methylates ribosomal protein L11.
Burkholderia vietnamiensis (strain G4 / LMG 22486) (taxid: 269482)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q478R6|PRMA_DECAR Ribosomal protein L11 methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=prmA PE=3 SV=1 Back     alignment and function description
>sp|A0K4C9|PRMA_BURCH Ribosomal protein L11 methyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=prmA PE=3 SV=1 Back     alignment and function description
>sp|Q1BZC1|PRMA_BURCA Ribosomal protein L11 methyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=prmA PE=3 SV=1 Back     alignment and function description
>sp|B1JVC0|PRMA_BURCC Ribosomal protein L11 methyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=prmA PE=3 SV=1 Back     alignment and function description
>sp|A9AI41|PRMA_BURM1 Ribosomal protein L11 methyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=prmA PE=3 SV=1 Back     alignment and function description
>sp|B4E5V2|PRMA_BURCJ Ribosomal protein L11 methyltransferase OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=prmA PE=3 SV=1 Back     alignment and function description
>sp|Q0BIF9|PRMA_BURCM Ribosomal protein L11 methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=prmA PE=3 SV=1 Back     alignment and function description
>sp|B1YSW5|PRMA_BURA4 Ribosomal protein L11 methyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=prmA PE=3 SV=1 Back     alignment and function description
>sp|Q3SMB4|PRMA_THIDA Ribosomal protein L11 methyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=prmA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
225461518367 PREDICTED: ribosomal protein L11 methylt 0.908 0.809 0.530 7e-79
356514667381 PREDICTED: ribosomal protein L11 methylt 0.795 0.682 0.536 2e-77
388507954397 unknown [Lotus japonicus] 0.773 0.637 0.551 2e-73
449507116390 PREDICTED: ribosomal protein L11 methylt 0.737 0.617 0.518 4e-71
449456729390 PREDICTED: ribosomal protein L11 methylt 0.737 0.617 0.518 5e-71
297792815368 hypothetical protein ARALYDRAFT_495472 [ 0.899 0.798 0.512 1e-69
15238878371 ribosomal protein L11 methyltransferase- 0.923 0.814 0.502 7e-69
224117126322 predicted protein [Populus trichocarpa] 0.660 0.670 0.645 5e-68
255584405373 RNA methyltransferase, putative [Ricinus 0.865 0.758 0.462 3e-64
413949759 428 hypothetical protein ZEAMMB73_385495 [Ze 0.776 0.593 0.469 1e-62
>gi|225461518|ref|XP_002282613.1| PREDICTED: ribosomal protein L11 methyltransferase [Vitis vinifera] gi|302142971|emb|CBI20266.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  300 bits (768), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 222/349 (63%), Gaps = 52/349 (14%)

Query: 8   HFFKRLPYKQLTRHQNLFTLIKQKPRTQL--TTPSSV----LIKVSAPSSSSSSSPCASL 61
           HFFK L +    R       I  +PR  +    PS +    L  V    S+SSS P    
Sbjct: 5   HFFKHLSFISSWR-------ISSQPRRLIHGVFPSPLSQRRLSSVFRNFSTSSSLPTTH- 56

Query: 62  SSIYPPSVESPYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSI 121
                 S+ SPY  VRI C K + DM SEA LCFGASSTS+DE    +DE +D+I IDSI
Sbjct: 57  ------SLTSPYFSVRISCPKDSADMLSEALLCFGASSTSMDEQG--SDEGNDKICIDSI 108

Query: 122 FPECKDVDECILNTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEW- 180
           F + +DVD CI + A+S+GLKE+P YEV++GEQ +WIKK QESF PVEVT+GLWIVPEW 
Sbjct: 109 FSDRQDVDVCISHAADSVGLKELPSYEVRVGEQYDWIKKTQESFCPVEVTEGLWIVPEWR 168

Query: 181 ---NVQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGT------------ 225
              +  ATNIILNPG AFGTGEH TTKLCLLLL  LIKGGE FLDYGT            
Sbjct: 169 TPPDAHATNIILNPGFAFGTGEHPTTKLCLLLLHGLIKGGERFLDYGTGSGILAIAALKF 228

Query: 226 -------VDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLSSH 278
                  +D+DPQ I +A QNAALN I P KM+L LVP        + R   +VE  S +
Sbjct: 229 GAASSVGIDVDPQAITAATQNAALNKISPNKMQLTLVPP-------DGRTHEVVEGQSPN 281

Query: 279 KIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ 327
            +   +E+E +D+VIANILLNPLL LAD IVS+AKPGAVV +SGI+SEQ
Sbjct: 282 SMGVTTESESFDIVIANILLNPLLDLADDIVSHAKPGAVVAVSGIISEQ 330




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356514667|ref|XP_003526025.1| PREDICTED: ribosomal protein L11 methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|388507954|gb|AFK42043.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449507116|ref|XP_004162937.1| PREDICTED: ribosomal protein L11 methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449456729|ref|XP_004146101.1| PREDICTED: ribosomal protein L11 methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297792815|ref|XP_002864292.1| hypothetical protein ARALYDRAFT_495472 [Arabidopsis lyrata subsp. lyrata] gi|297310127|gb|EFH40551.1| hypothetical protein ARALYDRAFT_495472 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15238878|ref|NP_200203.1| ribosomal protein L11 methyltransferase-like protein [Arabidopsis thaliana] gi|10177254|dbj|BAB10722.1| ribosomal protein L11 methyltransferase-like protein [Arabidopsis thaliana] gi|332009046|gb|AED96429.1| ribosomal protein L11 methyltransferase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224117126|ref|XP_002317484.1| predicted protein [Populus trichocarpa] gi|222860549|gb|EEE98096.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255584405|ref|XP_002532935.1| RNA methyltransferase, putative [Ricinus communis] gi|223527299|gb|EEF29451.1| RNA methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|413949759|gb|AFW82408.1| hypothetical protein ZEAMMB73_385495 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
TAIR|locus:2154739371 AT5G53920 [Arabidopsis thalian 0.969 0.854 0.438 4.3e-61
TIGR_CMR|CPS_0540293 CPS_0540 "ribosomal protein L1 0.752 0.839 0.284 1.9e-19
TIGR_CMR|VC_0293295 VC_0293 "ribosomal protein L11 0.532 0.589 0.302 2e-17
UNIPROTKB|P0A8T1293 prmA "methyltransferase for 50 0.724 0.808 0.284 7.9e-17
TIGR_CMR|SO_0395293 SO_0395 "ribosomal protein L11 0.752 0.839 0.269 1.4e-15
TIGR_CMR|BA_4537312 BA_4537 "ribosomal protein L11 0.623 0.653 0.258 1.4e-10
TIGR_CMR|GSU_0447299 GSU_0447 "ribosomal protein L1 0.730 0.799 0.244 9.3e-08
TIGR_CMR|CHY_0417305 CHY_0417 "ribosomal protein L1 0.636 0.681 0.262 5e-07
TIGR_CMR|CJE_1260281 CJE_1260 "ribosomal protein L1 0.324 0.377 0.258 0.00012
TIGR_CMR|SPO_3120292 SPO_3120 "ribosomal protein L1 0.119 0.133 0.487 0.00015
TAIR|locus:2154739 AT5G53920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 625 (225.1 bits), Expect = 4.3e-61, P = 4.3e-61
 Identities = 146/333 (43%), Positives = 189/333 (56%)

Query:     8 HFFKRLPYKQLTRHQNLFTLIKQKPRTQLTTPXXXXXXXXXXXXXXXXXXXXXXXXXYPP 67
             +F K  P K L+RH  +    + +P    T+                             
Sbjct:     5 NFIKHFPCKNLSRH--ILRDSRVRPLCFFTSSTPPSSFSIFASLSTSSSSSSSSSCFTDE 62

Query:    68 SVESPYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADEN-----SDEIYIDSIF 122
             S  +PYL VRI C KHALD FSEA LCFGASS +VDE   +AD++     S EI I+SIF
Sbjct:    63 SFAAPYLSVRIHCPKHALDPFSEALLCFGASSVAVDEAIEEADQDETSLASKEICIESIF 122

Query:   123 PECKDVDECILNTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEWN- 181
             P  ++V  CI   ANSIGLKEIP+++V+MG++ +WI K Q+ F PVE+ + LWIVPEW  
Sbjct:   123 PVHEEVKMCISQAANSIGLKEIPKFKVEMGDELDWITKNQDLFQPVEIAERLWIVPEWTS 182

Query:   182 ---VQATNIILNPGLAFGTGEHATTKXXXXXXXXXIKGGELFLDYGTVD--IDPQVIKSA 236
                 +A NIILNPG AFGTGEH TTK         IKGGE FLDYGT    +    +K  
Sbjct:   183 PPVAEAVNIILNPGFAFGTGEHPTTKLCLLLLQSLIKGGEAFLDYGTGSGILAIAALKFG 242

Query:   237 HQNAALNNIGPKKMK--LHLVPDRTFPSSMNERVDGIVEYLSSHKIRGISETEEYDVVIA 294
               ++   +I P  +   +H       P    E     +E  SS +   + + E++DVVIA
Sbjct:   243 AASSVGVDIDPLAINSAIHNAALNNIPLEKLELHLAPIENSSSGREIPLQK-EQFDVVIA 301

Query:   295 NILLNPLLQLADHIVSYAKPGAVVGISGILSEQ 327
             NILLNP++ LADHI+S+ KPGA +GISGILSEQ
Sbjct:   302 NILLNPVMNLADHILSFVKPGATIGISGILSEQ 334




GO:0005737 "cytoplasm" evidence=IEA
GO:0006479 "protein methylation" evidence=IEA
GO:0008276 "protein methyltransferase activity" evidence=IEA
GO:0006744 "ubiquinone biosynthetic process" evidence=RCA
TIGR_CMR|CPS_0540 CPS_0540 "ribosomal protein L11 methyltransferase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0293 VC_0293 "ribosomal protein L11 methyltransferase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0A8T1 prmA "methyltransferase for 50S ribosomal subunit protein L11" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0395 SO_0395 "ribosomal protein L11 methyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4537 BA_4537 "ribosomal protein L11 methyltransferase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0447 GSU_0447 "ribosomal protein L11 methyltransferase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0417 CHY_0417 "ribosomal protein L11 methyltransferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_1260 CJE_1260 "ribosomal protein L11 methyltransferase, putative" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3120 SPO_3120 "ribosomal protein L11 methyltransferase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
pfam06325294 pfam06325, PrmA, Ribosomal protein L11 methyltrans 7e-60
PRK00517250 PRK00517, prmA, ribosomal protein L11 methyltransf 2e-47
COG2264300 COG2264, PrmA, Ribosomal protein L11 methylase [Tr 3e-40
TIGR00406288 TIGR00406, prmA, ribosomal protein L11 methyltrans 1e-31
>gnl|CDD|218990 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
 Score =  193 bits (492), Expect = 7e-60
 Identities = 90/290 (31%), Positives = 131/290 (45%), Gaps = 61/290 (21%)

Query: 72  PYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADEN-----------SDEIYIDS 120
            +L + I   + A +  S A   FGA   ++++ D   D              D++ + +
Sbjct: 1   TWLELTIHTTREAAERVSNALEEFGALGVAIEDADTLNDRPIGEPGPGETRLWDDVRVKA 60

Query: 121 IFPECKDVDECILNTANSIGLKEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEW 180
           +F    D  E I   A  I   + P+  V+  E+ +W +  ++ FHPV + + L IVP W
Sbjct: 61  LFDVETDALELIAQLAELIPGLDSPKVTVEEVEEEDWARAWKKYFHPVRIGERLTIVPSW 120

Query: 181 N----VQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGT----------- 225
                  A NI L+PG+AFGTG H TT LCL  L SL+K GE  LD G            
Sbjct: 121 EDYPEPDAVNIELDPGMAFGTGTHPTTALCLEALESLVKPGETVLDVGCGSGILAIAALK 180

Query: 226 --------VDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLSS 277
                   VDIDP  +++A +NA LN +                         +  YL  
Sbjct: 181 LGAKKVVGVDIDPVAVRAAKENAELNGVE----------------------AQLEVYLP- 217

Query: 278 HKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ 327
                + E  + DVV+ANIL +PL++LA  I +  KPG  + +SGIL EQ
Sbjct: 218 ---GDLPE-GKADVVVANILADPLIELAPDIYALVKPGGYLILSGILEEQ 263


This family consists of several Ribosomal protein L11 methyltransferase (EC:2.1.1.-) sequences. Length = 294

>gnl|CDD|234786 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|225173 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232960 TIGR00406, prmA, ribosomal protein L11 methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 327
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 100.0
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 100.0
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 100.0
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 100.0
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.43
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.25
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.13
PRK12335287 tellurite resistance protein TehB; Provisional 99.13
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.11
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.06
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.05
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.03
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.0
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.97
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.95
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.92
COG2890280 HemK Methylase of polypeptide chain release factor 98.92
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.88
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.86
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.86
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.85
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.85
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.83
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.81
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.8
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.8
PRK14967223 putative methyltransferase; Provisional 98.79
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.76
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.75
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.75
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.73
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 98.73
COG4123248 Predicted O-methyltransferase [General function pr 98.72
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 98.71
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.7
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.68
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.67
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.67
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.67
PLN02244 340 tocopherol O-methyltransferase 98.64
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.63
PRK14968188 putative methyltransferase; Provisional 98.62
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.61
PRK11207197 tellurite resistance protein TehB; Provisional 98.59
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.59
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.57
PLN02672 1082 methionine S-methyltransferase 98.57
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.57
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.57
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.53
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 98.52
PLN02336 475 phosphoethanolamine N-methyltransferase 98.5
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.49
KOG2904328 consensus Predicted methyltransferase [General fun 98.49
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.48
PLN03075296 nicotianamine synthase; Provisional 98.48
PLN02476278 O-methyltransferase 98.47
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.46
COG4122219 Predicted O-methyltransferase [General function pr 98.45
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.43
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.42
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.4
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.4
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.4
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 98.37
PLN02233261 ubiquinone biosynthesis methyltransferase 98.36
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.35
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 98.34
PRK07402196 precorrin-6B methylase; Provisional 98.33
PRK10901427 16S rRNA methyltransferase B; Provisional 98.31
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.31
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 98.31
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 98.29
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.27
PRK04457262 spermidine synthase; Provisional 98.27
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.27
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.26
PRK10258 251 biotin biosynthesis protein BioC; Provisional 98.25
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.24
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.22
PRK14902444 16S rRNA methyltransferase B; Provisional 98.22
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 98.22
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.21
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.21
PRK06922 677 hypothetical protein; Provisional 98.2
PRK14904445 16S rRNA methyltransferase B; Provisional 98.19
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.18
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.18
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.15
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.15
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.15
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.14
PRK14901434 16S rRNA methyltransferase B; Provisional 98.13
PLN02490 340 MPBQ/MSBQ methyltransferase 98.12
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.09
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.09
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.07
PRK14903431 16S rRNA methyltransferase B; Provisional 98.06
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.05
PLN02589247 caffeoyl-CoA O-methyltransferase 98.05
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.02
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.02
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.01
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 98.0
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.0
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.0
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 97.99
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 97.98
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.98
TIGR00452314 methyltransferase, putative. Known examples to dat 97.96
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 97.95
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 97.91
PRK08317 241 hypothetical protein; Provisional 97.9
PRK00811283 spermidine synthase; Provisional 97.9
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 97.9
KOG2899288 consensus Predicted methyltransferase [General fun 97.9
PHA03412241 putative methyltransferase; Provisional 97.88
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.86
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.83
PLN02585315 magnesium protoporphyrin IX methyltransferase 97.82
PRK04266226 fibrillarin; Provisional 97.8
PRK01581 374 speE spermidine synthase; Validated 97.79
PLN02366308 spermidine synthase 97.79
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 97.78
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.78
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.78
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.77
smart00650169 rADc Ribosomal RNA adenine dimethylases. 97.76
COG2263198 Predicted RNA methylase [Translation, ribosomal st 97.75
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.73
PHA03411279 putative methyltransferase; Provisional 97.73
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 97.69
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 97.69
PRK06202232 hypothetical protein; Provisional 97.67
PRK03612 521 spermidine synthase; Provisional 97.67
PLN02336 475 phosphoethanolamine N-methyltransferase 97.66
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 97.61
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.58
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 97.57
KOG1271227 consensus Methyltransferases [General function pre 97.57
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.54
COG2520341 Predicted methyltransferase [General function pred 97.53
PRK05785226 hypothetical protein; Provisional 97.5
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.48
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 97.45
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 97.44
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.44
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 97.43
TIGR03438 301 probable methyltransferase. This model represents 97.43
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.37
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 97.32
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.31
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.28
KOG1663237 consensus O-methyltransferase [Secondary metabolit 97.21
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.17
PLN02823 336 spermine synthase 97.11
COG4976287 Predicted methyltransferase (contains TPR repeat) 97.11
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.09
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.07
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.06
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.04
PTZ00146293 fibrillarin; Provisional 97.02
COG3897218 Predicted methyltransferase [General function pred 97.0
PLN02232160 ubiquinone biosynthesis methyltransferase 96.98
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 96.97
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 96.97
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 96.95
TIGR00438188 rrmJ cell division protein FtsJ. 96.91
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 96.88
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 96.88
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 96.87
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 96.87
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 96.85
KOG4300252 consensus Predicted methyltransferase [General fun 96.78
COG2384 226 Predicted SAM-dependent methyltransferase [General 96.77
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 96.74
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 96.68
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.62
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 96.58
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 96.57
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 96.52
KOG3420185 consensus Predicted RNA methylase [Translation, ri 96.52
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.49
KOG1541 270 consensus Predicted protein carboxyl methylase [Ge 96.43
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.42
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 96.42
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 96.31
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 96.21
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 96.14
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 96.12
PRK10611287 chemotaxis methyltransferase CheR; Provisional 96.1
COG1041347 Predicted DNA modification methylase [DNA replicat 96.06
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 96.05
PRK00536262 speE spermidine synthase; Provisional 95.99
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 95.93
KOG2361264 consensus Predicted methyltransferase [General fun 95.81
COG3129292 Predicted SAM-dependent methyltransferase [General 95.76
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 95.59
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 95.54
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 95.48
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 94.9
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 94.82
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 94.48
COG0421282 SpeE Spermidine synthase [Amino acid transport and 94.36
COG2521287 Predicted archaeal methyltransferase [General func 94.33
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 94.27
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 94.25
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 94.22
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 93.78
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 93.71
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 93.66
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 93.61
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 93.08
COG4262508 Predicted spermidine synthase with an N-terminal m 91.9
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 91.71
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 91.58
COG4076 252 Predicted RNA methylase [General function predicti 91.15
KOG2912 419 consensus Predicted DNA methylase [Function unknow 90.84
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 90.62
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 90.58
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 90.47
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 90.29
PRK04148134 hypothetical protein; Provisional 89.87
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 89.69
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 89.33
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 89.31
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 89.09
KOG3010 261 consensus Methyltransferase [General function pred 88.3
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 88.29
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 87.84
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 87.59
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 86.65
KOG2671421 consensus Putative RNA methylase [Replication, rec 86.13
KOG2730263 consensus Methylase [General function prediction o 84.76
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 84.52
KOG1269 364 consensus SAM-dependent methyltransferases [Lipid 84.0
KOG2940 325 consensus Predicted methyltransferase [General fun 83.94
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 83.85
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 82.63
PRK15001 378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 82.07
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 81.68
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 80.13
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=100.00  E-value=1.8e-59  Score=446.49  Aligned_cols=234  Identities=32%  Similarity=0.511  Sum_probs=197.1

Q ss_pred             CCCcEEEEEEeCCchHHHHHHHHHhcCCceEEEEcCC--CC-------CCCCCCcEEEEEEcCCCCCHHHHHHhhhhhcC
Q 041970           70 ESPYLLVRICCQKHALDMFSEAPLCFGASSTSVDEHD--ND-------ADENSDEIYIDSIFPECKDVDECILNTANSIG  140 (327)
Q Consensus        70 ~m~w~ei~i~~~~e~~d~v~~~L~e~Ga~gv~ied~~--~~-------~~~~~~~~~v~ayfp~~~~~~~~l~~~~~~~~  140 (327)
                      +|+|+|++|.|+++++|.++++|.+.|+.||.++|..  .+       ....|+.+.+.+||+.+.+.+..++.+.+.+.
T Consensus         1 ~m~w~el~i~~~~~~aE~~~~~l~e~G~~~v~~eD~~~~~~~~~~~~~e~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~   80 (300)
T COG2264           1 MMPWIELSLITTGEAAERVSDALEEAGAVGVAIEDAKLDTPSFEPVFGEPRLWDGVKVKALFPADTDLALLLAELEALLA   80 (300)
T ss_pred             CCceEEEEEEeCHHHHHHHHHHHHhcCcceeeeecccccCcccccccCCCcccccceeEeeecccchHHHHHHHHHHHhc
Confidence            5899999999999999999999999999999999883  11       11236788999999999988888887766543


Q ss_pred             C-CCCCcceeeeccchhhHHHHhhcCceEEEcCcEEEEcCCC----C-CceeEEEccCcccCCCchhhHHHHHHHHHhhh
Q 041970          141 L-KEIPRYEVKMGEQCNWIKKAQESFHPVEVTKGLWIVPEWN----V-QATNIILNPGLAFGTGEHATTKLCLLLLRSLI  214 (327)
Q Consensus       141 l-~~~~~~~~~~~ee~DW~~~Wk~~f~P~~vg~~l~I~P~W~----~-~~~~I~idPG~AFGTG~H~TT~lcLe~Le~~~  214 (327)
                      . ...-.+.....+|+||.++||+||+|+++|++|+|+|+|.    + ++++|+||||||||||+||||+|||++|++++
T Consensus        81 ~~~~~~~~~~~~~~e~DW~~~wk~~~~P~rig~~f~I~Psw~~~~~~~~~~~i~lDPGlAFGTG~HpTT~lcL~~Le~~~  160 (300)
T COG2264          81 LLELFAHVIEQEEDEEDWEREWKKYFHPVRIGERFVIVPSWREYPEPSDELNIELDPGLAFGTGTHPTTSLCLEALEKLL  160 (300)
T ss_pred             ccccccceeEeecChHHHHHHHHhcCCcEEeeeeEEECCCCccCCCCCCceEEEEccccccCCCCChhHHHHHHHHHHhh
Confidence            2 2111234455668899999999999999999999999998    2 36789999999999999999999999999999


Q ss_pred             cCCCeeeeeee-------------------ecCCHHHHHHHHHHHHhcCCCCCcEEEEecCCCCCCCCccccccchhhhc
Q 041970          215 KGGELFLDYGT-------------------VDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYL  275 (327)
Q Consensus       215 ~~g~~VLDvGc-------------------VDIDp~AV~~A~eNa~lNgv~~~~v~v~~~~~d~~~~~~~g~~~~l~~~~  275 (327)
                      ++|++|||+||                   +||||.||++|++|+++|++.. .+.+.  ..+.         .      
T Consensus       161 ~~g~~vlDvGcGSGILaIAa~kLGA~~v~g~DiDp~AV~aa~eNa~~N~v~~-~~~~~--~~~~---------~------  222 (300)
T COG2264         161 KKGKTVLDVGCGSGILAIAAAKLGAKKVVGVDIDPQAVEAARENARLNGVEL-LVQAK--GFLL---------L------  222 (300)
T ss_pred             cCCCEEEEecCChhHHHHHHHHcCCceEEEecCCHHHHHHHHHHHHHcCCch-hhhcc--cccc---------h------
Confidence            99999999999                   9999999999999999999973 22221  1111         0      


Q ss_pred             ccccccCCCCCCCeeEEEEcCChHHHHHHHHHHhhccCCCcEEEEeeccCCC
Q 041970          276 SSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ  327 (327)
Q Consensus       276 ~~~~~~~~~~~~~fDlVvANIla~vL~~L~p~i~~~LkpGG~LIlSGIl~~Q  327 (327)
                            .....++||+|||||+|+++..|+|++.+++||||++|+||||.+|
T Consensus       223 ------~~~~~~~~DvIVANILA~vl~~La~~~~~~lkpgg~lIlSGIl~~q  268 (300)
T COG2264         223 ------EVPENGPFDVIVANILAEVLVELAPDIKRLLKPGGRLILSGILEDQ  268 (300)
T ss_pred             ------hhcccCcccEEEehhhHHHHHHHHHHHHHHcCCCceEEEEeehHhH
Confidence                  1112469999999999999999999999999999999999999886



>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>KOG2912 consensus Predicted DNA methylase [Function unknown] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
1ufk_A254 Crystal Structure Of Tt0836 Length = 254 2e-06
3grz_A205 Crystal Structure Of Ribosomal Protein L11 Methylas 2e-06
3cjt_A254 Ribosomal Protein L11 Methyltransferase (prma) In C 2e-05
>pdb|1UFK|A Chain A, Crystal Structure Of Tt0836 Length = 254 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 20/116 (17%) Query: 156 NWIKKAQESFHPVEVTKGLWIVP--EWNVQATNIILNPGLAFGTGEHATTKXXXXXXXXX 213 +W++ + P + + P W +++ PG+AFGTG H TT+ Sbjct: 58 DWLEAWRRDLKPALAPPFVVLAPWHTWEGAEIPLVIEPGMAFGTGHHETTRLALKALARH 117 Query: 214 IKGGELFLDYGT------------------VDIDPQVIKSAHQNAALNNIGPKKMK 251 ++ G+ LD GT VDIDP V+ A NA N + P+ ++ Sbjct: 118 LRPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEANAKRNGVRPRFLE 173
>pdb|3GRZ|A Chain A, Crystal Structure Of Ribosomal Protein L11 Methylase From Lactobacillus Delbrueckii Subsp. Bulgaricus Length = 205 Back     alignment and structure
>pdb|3CJT|A Chain A, Ribosomal Protein L11 Methyltransferase (prma) In Complex With Dimethylated Ribosomal Protein L11 Length = 254 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 3e-50
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 2e-48
1ne2_A200 Hypothetical protein TA1320; structural genomics, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Length = 205 Back     alignment and structure
 Score =  165 bits (419), Expect = 3e-50
 Identities = 48/188 (25%), Positives = 72/188 (38%), Gaps = 51/188 (27%)

Query: 165 FHPVEVTKGLWIVPEW------NVQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGE 218
           +H + +++ L IVPEW            I L+PGLAFGTG H TT+L +L +   +    
Sbjct: 3   YHVINLSRHLAIVPEWEDYQPVFKDQEIIRLDPGLAFGTGNHQTTQLAMLGIERAMVKPL 62

Query: 219 LFLDYGT-------------------VDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRT 259
              D GT                    DI  + + +A +NAALN I    ++   +    
Sbjct: 63  TVADVGTGSGILAIAAHKLGAKSVLATDISDESMTAAEENAALNGIYDIALQKTSLLA-- 120

Query: 260 FPSSMNERVDGIVEYLSSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVG 319
                                       ++D+++ANIL   LL L   + S+      V 
Sbjct: 121 ------------------------DVDGKFDLIVANILAEILLDLIPQLDSHLNEDGQVI 156

Query: 320 ISGILSEQ 327
            SGI   Q
Sbjct: 157 FSGIDYLQ 164


>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Length = 254 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Length = 200 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 100.0
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.86
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.41
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.4
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.37
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 99.35
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.25
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.25
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.21
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.19
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.19
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.19
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.18
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.17
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.15
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.13
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.12
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.12
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.1
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.09
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.09
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.07
3k6r_A278 Putative transferase PH0793; structural genomics, 99.06
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.05
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.04
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.04
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.04
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.03
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.01
3lpm_A259 Putative methyltransferase; structural genomics, p 99.01
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.01
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.98
3f4k_A 257 Putative methyltransferase; structural genomics, P 98.97
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.95
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.95
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 98.95
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.94
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.94
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.92
2b25_A 336 Hypothetical protein; structural genomics, methyl 98.91
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.91
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.9
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 98.89
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.89
1ws6_A171 Methyltransferase; structural genomics, riken stru 98.89
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.89
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.88
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.87
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.87
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.87
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.84
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.84
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.83
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.83
3ocj_A305 Putative exported protein; structural genomics, PS 98.82
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.82
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.81
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.81
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.81
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.81
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.8
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.8
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.8
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 98.79
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.79
3lcc_A235 Putative methyl chloride transferase; halide methy 98.79
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.77
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.76
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.75
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.75
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.74
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 98.74
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.74
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.74
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.74
1xxl_A 239 YCGJ protein; structural genomics, protein structu 98.73
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.73
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 98.73
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.73
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.73
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 98.72
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.72
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 98.72
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 98.72
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.72
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.71
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.71
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.7
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.69
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 98.69
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.68
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.68
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.68
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.67
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.67
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.67
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.67
2h00_A254 Methyltransferase 10 domain containing protein; st 98.65
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.65
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.64
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.64
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.63
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.63
3ldu_A 385 Putative methylase; structural genomics, PSI-2, pr 98.63
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 98.62
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.62
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.62
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.62
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.62
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.62
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.6
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.6
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.6
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.6
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.6
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.6
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 98.59
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.58
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.58
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.57
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.56
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 98.56
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.56
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.55
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.55
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.55
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.54
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.54
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.54
2p7i_A 250 Hypothetical protein; putative methyltransferase, 98.54
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.53
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.53
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.53
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.53
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.52
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.52
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.52
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.52
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.51
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.51
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.51
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 98.51
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.5
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.5
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 98.49
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.49
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.49
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.48
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.48
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.48
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.48
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.48
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.48
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 98.47
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.47
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.47
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.47
2pt6_A321 Spermidine synthase; transferase, structural genom 98.47
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.47
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.47
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.46
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 98.45
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.45
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.45
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.44
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.43
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.43
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.42
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.42
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.42
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.42
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.42
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 98.42
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.41
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.41
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.41
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.41
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.4
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.4
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.39
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 98.39
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.39
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.39
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.37
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.37
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.36
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 98.36
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.36
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.36
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.36
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.35
2o07_A304 Spermidine synthase; structural genomics, structur 98.35
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.35
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.33
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.33
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.33
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.32
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.32
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.32
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 98.3
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.29
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.28
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.28
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.28
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.27
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.26
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 98.25
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.24
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.23
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.21
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.21
2i7c_A283 Spermidine synthase; transferase, structural genom 98.21
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.19
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.19
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.18
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 98.18
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.17
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.17
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.16
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.15
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.14
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.12
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.09
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.09
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.08
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 98.06
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.05
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.05
3ege_A 261 Putative methyltransferase from antibiotic biosyn 98.02
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 97.97
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 97.96
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 97.95
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 97.92
3cc8_A230 Putative methyltransferase; structural genomics, j 97.91
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.85
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 97.8
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 97.78
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 97.76
3lkd_A 542 Type I restriction-modification system methyltrans 97.74
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 97.73
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.71
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 97.7
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 97.69
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.69
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.69
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 97.66
3khk_A 544 Type I restriction-modification system methylation 97.61
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.59
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.56
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 97.51
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 97.51
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 97.51
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 97.5
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 97.42
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 97.41
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 97.38
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 97.38
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 97.36
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 97.33
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 97.31
3ll7_A 410 Putative methyltransferase; methytransferase, stru 97.31
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.25
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 97.24
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.22
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.22
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 97.2
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 97.1
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 96.95
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 96.92
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 96.84
3ufb_A 530 Type I restriction-modification system methyltran 96.8
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 96.77
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 96.76
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 96.43
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 96.33
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 96.16
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 95.87
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 95.79
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 95.68
2zig_A297 TTHA0409, putative modification methylase; methylt 95.67
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 95.65
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 95.52
3cjs_A59 L11 mtase, ribosomal protein L11 methyltransferase 95.35
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 95.3
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 94.24
4dcm_A 375 Ribosomal RNA large subunit methyltransferase G; 2 92.5
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 91.58
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 91.38
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 89.63
3trk_A324 Nonstructural polyprotein; hydrolase; 2.40A {Chiku 89.49
2px2_A269 Genome polyprotein [contains: capsid protein C (co 89.38
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 88.95
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 88.28
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 87.78
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 85.48
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 83.75
4gua_A 670 Non-structural polyprotein; viral precursor polypr 82.56
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 81.07
2zig_A 297 TTHA0409, putative modification methylase; methylt 80.14
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
Probab=100.00  E-value=3.1e-38  Score=291.16  Aligned_cols=201  Identities=26%  Similarity=0.397  Sum_probs=169.2

Q ss_pred             EEEEEEeCCchHHHHHHHHHhcCCceEEEEcCCCCCCCCCCcEEEEEEcCCCCCHHHHHHhhhhhcCCCCCCcceeeecc
Q 041970           74 LLVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSIFPECKDVDECILNTANSIGLKEIPRYEVKMGE  153 (327)
Q Consensus        74 ~ei~i~~~~e~~d~v~~~L~e~Ga~gv~ied~~~~~~~~~~~~~v~ayfp~~~~~~~~l~~~~~~~~l~~~~~~~~~~~e  153 (327)
                      ++|+|.|+++++|+++++|.+.|+.|++++|.           .|++||+++.+..        .++       .++..+
T Consensus         2 ~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~-----------~~~~~~~~~~~~~--------~~~-------~~~~~~   55 (254)
T 2nxc_A            2 WVYRLKGTLEALDPILPGLFDGGARGLWEREG-----------EVWAFFPAPVDLP--------YEG-------VWEEVG   55 (254)
T ss_dssp             EEEEEESCHHHHGGGHHHHHHTTCCEEEEETT-----------EEEEEESSCCCCS--------SCC-------EEEECC
T ss_pred             EEEEEEcCHHHHHHHHHHHHhhCCCEEEEECC-----------eEEEEEcCCcchh--------hcC-------ceeecC
Confidence            68999999999999999999999999998752           7899999876543        111       566678


Q ss_pred             chhhHHHHhhcCceEEEcCcEEEEcCCCC---CceeEEEccCcccCCCchhhHHHHHHHHHhhhcCCCeeeeeee-----
Q 041970          154 QCNWIKKAQESFHPVEVTKGLWIVPEWNV---QATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGT-----  225 (327)
Q Consensus       154 e~DW~~~Wk~~f~P~~vg~~l~I~P~W~~---~~~~I~idPG~AFGTG~H~TT~lcLe~Le~~~~~g~~VLDvGc-----  225 (327)
                      ++||++.||++|+|+++|+ ++|+|+|+.   +...+.|+||||||||+|+||++|+++|+++++++++|||+||     
T Consensus        56 ~~dw~~~~~~~~~p~~~~~-~~i~~~w~~~~~~~~~~~l~p~~~fgtg~~~tt~~~~~~l~~~~~~~~~VLDiGcG~G~l  134 (254)
T 2nxc_A           56 DEDWLEAWRRDLKPALAPP-FVVLAPWHTWEGAEIPLVIEPGMAFGTGHHETTRLALKALARHLRPGDKVLDLGTGSGVL  134 (254)
T ss_dssp             HHHHHHHHHHHCCCEEETT-EEEECTTCCCCSSSEEEECCCC-----CCSHHHHHHHHHHHHHCCTTCEEEEETCTTSHH
T ss_pred             hhHHHHHHHhhCCCEEEec-EEEeCCCCCCCCCceEEEECCCccccCCCCHHHHHHHHHHHHhcCCCCEEEEecCCCcHH
Confidence            8899999999999999998 999999983   4577999999999999999999999999999889999999999     


Q ss_pred             -------------ecCCHHHHHHHHHHHHhcCCCCCcEEEEecCCCCCCCCccccccchhhhcccccccCCCCCCCeeEE
Q 041970          226 -------------VDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLSSHKIRGISETEEYDVV  292 (327)
Q Consensus       226 -------------VDIDp~AV~~A~eNa~lNgv~~~~v~v~~~~~d~~~~~~~g~~~~l~~~~~~~~~~~~~~~~~fDlV  292 (327)
                                   +|+||.+++.|++|++.|++.   +++.  .+|..         +           .+ +.++||+|
T Consensus       135 ~~~la~~g~~v~gvDi~~~~v~~a~~n~~~~~~~---v~~~--~~d~~---------~-----------~~-~~~~fD~V  188 (254)
T 2nxc_A          135 AIAAEKLGGKALGVDIDPMVLPQAEANAKRNGVR---PRFL--EGSLE---------A-----------AL-PFGPFDLL  188 (254)
T ss_dssp             HHHHHHTTCEEEEEESCGGGHHHHHHHHHHTTCC---CEEE--ESCHH---------H-----------HG-GGCCEEEE
T ss_pred             HHHHHHhCCeEEEEECCHHHHHHHHHHHHHcCCc---EEEE--ECChh---------h-----------cC-cCCCCCEE
Confidence                         999999999999999999975   4543  34431         1           01 14689999


Q ss_pred             EEcCChHHHHHHHHHHhhccCCCcEEEEeeccCCC
Q 041970          293 IANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ  327 (327)
Q Consensus       293 vANIla~vL~~L~p~i~~~LkpGG~LIlSGIl~~Q  327 (327)
                      ++|++.+.+..+++.+.++|+|||++++||++.+|
T Consensus       189 v~n~~~~~~~~~l~~~~~~LkpgG~lils~~~~~~  223 (254)
T 2nxc_A          189 VANLYAELHAALAPRYREALVPGGRALLTGILKDR  223 (254)
T ss_dssp             EEECCHHHHHHHHHHHHHHEEEEEEEEEEEEEGGG
T ss_pred             EECCcHHHHHHHHHHHHHHcCCCCEEEEEeeccCC
Confidence            99999999999999999999999999999998653



>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3cjs_A L11 mtase, ribosomal protein L11 methyltransferase; S-adenosyl-L-methionine dependent methyltransferase; 1.37A {Thermus thermophilus} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3trk_A Nonstructural polyprotein; hydrolase; 2.40A {Chikungunya virus} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 327
d2nxca1254 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT 8e-14
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Ribosomal protein L11 methyltransferase PrmA
domain: PrmA-like protein TTHA0656 (TT0836)
species: Thermus thermophilus [TaxId: 274]
 Score = 68.0 bits (165), Expect = 8e-14
 Identities = 37/178 (20%), Positives = 70/178 (39%), Gaps = 12/178 (6%)

Query: 153 EQCNWIKKAQESFHPVEVTKGLWIVPEWNVQ---ATNIILNPGLAFGTGEHATTKLCLLL 209
              +W++  +    P        ++  W+        +++ PG+AFGTG H TT+L L  
Sbjct: 55  GDEDWLEAWRRDLKPALAPP-FVVLAPWHTWEGAEIPLVIEPGMAFGTGHHETTRLALKA 113

Query: 210 LRSLIKGGELFLDYGTVDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVD 269
           L   ++ G+  LD GT               A   +G K + + + P     +  N + +
Sbjct: 114 LARHLRPGDKVLDLGTGSG--------VLAIAAEKLGGKALGVDIDPMVLPQAEANAKRN 165

Query: 270 GIVEYLSSHKIRGISETEEYDVVIANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ 327
           G+        +        +D+++AN+       LA        PG    ++GIL ++
Sbjct: 166 GVRPRFLEGSLEAALPFGPFDLLVANLYAELHAALAPRYREALVPGGRALLTGILKDR 223


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 100.0
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.44
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.3
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.22
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.21
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.21
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.09
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.08
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.04
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.02
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.0
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.0
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.96
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.95
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.95
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.92
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.92
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 98.91
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.83
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.81
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.81
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.81
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.77
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.74
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.72
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.72
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.71
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.69
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.68
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.65
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.65
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 98.63
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.62
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.55
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.49
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.49
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.48
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.48
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.47
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.45
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.43
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.42
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.4
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.38
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.38
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.38
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.37
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.35
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.35
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.33
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.33
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.31
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.28
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.28
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.26
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.25
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.24
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.19
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.18
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.14
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.12
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.12
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.09
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.99
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.92
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 97.92
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 97.87
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 97.85
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 97.82
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.75
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 97.72
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.43
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 97.32
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.17
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 97.14
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 97.01
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.93
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 96.65
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 96.57
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 96.5
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 96.4
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 96.24
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.11
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 95.84
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 95.77
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 95.7
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 95.53
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 95.35
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 94.06
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 93.79
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 93.3
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 92.99
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 92.8
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 92.44
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 91.68
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 91.43
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 87.81
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 86.21
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 82.35
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 81.84
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 80.68
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Ribosomal protein L11 methyltransferase PrmA
domain: PrmA-like protein TTHA0656 (TT0836)
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=1.2e-47  Score=355.94  Aligned_cols=200  Identities=26%  Similarity=0.391  Sum_probs=166.3

Q ss_pred             EEEEEeCCchHHHHHHHHHhcCCceEEEEcCCCCCCCCCCcEEEEEEcCCCCCHHHHHHhhhhhcCCCCCCcceeeeccc
Q 041970           75 LVRICCQKHALDMFSEAPLCFGASSTSVDEHDNDADENSDEIYIDSIFPECKDVDECILNTANSIGLKEIPRYEVKMGEQ  154 (327)
Q Consensus        75 ei~i~~~~e~~d~v~~~L~e~Ga~gv~ied~~~~~~~~~~~~~v~ayfp~~~~~~~~l~~~~~~~~l~~~~~~~~~~~ee  154 (327)
                      -.++.++.++.|++.+.|.++|+.|+..++.           .+.+||+++.+.             .  ..+.++.+++
T Consensus         3 ~~~l~~~~e~~d~~~~~l~e~g~~g~~e~~~-----------~~~a~~~~~~~~-------------~--~~~~~~~i~~   56 (254)
T d2nxca1           3 VYRLKGTLEALDPILPGLFDGGARGLWEREG-----------EVWAFFPAPVDL-------------P--YEGVWEEVGD   56 (254)
T ss_dssp             EEEEESCHHHHGGGHHHHHHTTCCEEEEETT-----------EEEEEESSCCCC-------------S--SCCEEEECCH
T ss_pred             EEEecCCcchhhHHHHHHHhcCCceEEEEcC-----------eEEEEecCCCCC-------------c--cccEEEEcCc
Confidence            4678999999999999999999999875431           367999986432             1  1345677889


Q ss_pred             hhhHHHHhhcCceEEEcCcEEEEcCCC---CCceeEEEccCcccCCCchhhHHHHHHHHHhhhcCCCeeeeeee------
Q 041970          155 CNWIKKAQESFHPVEVTKGLWIVPEWN---VQATNIILNPGLAFGTGEHATTKLCLLLLRSLIKGGELFLDYGT------  225 (327)
Q Consensus       155 ~DW~~~Wk~~f~P~~vg~~l~I~P~W~---~~~~~I~idPG~AFGTG~H~TT~lcLe~Le~~~~~g~~VLDvGc------  225 (327)
                      +||+++||++|+|+++| +++|+|+|+   +++++|.||||||||||+||||+|||++|+++.++|++|||+||      
T Consensus        57 ~dW~~~w~~~~~p~~~~-~~~v~~~~~~~~~~~~~i~i~pg~aFGTG~H~TT~l~l~~l~~~~~~g~~VLDiGcGsG~l~  135 (254)
T d2nxca1          57 EDWLEAWRRDLKPALAP-PFVVLAPWHTWEGAEIPLVIEPGMAFGTGHHETTRLALKALARHLRPGDKVLDLGTGSGVLA  135 (254)
T ss_dssp             HHHHHHHHHHCCCEEET-TEEEECTTCCCCSSSEEEECCCC-----CCSHHHHHHHHHHHHHCCTTCEEEEETCTTSHHH
T ss_pred             chHHHHHHhhCCCEEEC-CEEEEeccccCCCcceEEEEccccccCccccchhhHHHHHHHhhcCccCEEEEcccchhHHH
Confidence            99999999999999997 688999998   34688999999999999999999999999999999999999999      


Q ss_pred             ------------ecCCHHHHHHHHHHHHhcCCCCCcEEEEecCCCCCCCCccccccchhhhcccccccCCCCCCCeeEEE
Q 041970          226 ------------VDIDPQVIKSAHQNAALNNIGPKKMKLHLVPDRTFPSSMNERVDGIVEYLSSHKIRGISETEEYDVVI  293 (327)
Q Consensus       226 ------------VDIDp~AV~~A~eNa~lNgv~~~~v~v~~~~~d~~~~~~~g~~~~l~~~~~~~~~~~~~~~~~fDlVv  293 (327)
                                  +|+||.|++.|++|+++|++. .+  +.  .++.         .+.           . +.++||+|+
T Consensus       136 i~aa~~g~~V~gvDis~~av~~A~~na~~n~~~-~~--~~--~~d~---------~~~-----------~-~~~~fD~V~  189 (254)
T d2nxca1         136 IAAEKLGGKALGVDIDPMVLPQAEANAKRNGVR-PR--FL--EGSL---------EAA-----------L-PFGPFDLLV  189 (254)
T ss_dssp             HHHHHTTCEEEEEESCGGGHHHHHHHHHHTTCC-CE--EE--ESCH---------HHH-----------G-GGCCEEEEE
T ss_pred             HHHHhcCCEEEEEECChHHHHHHHHHHHHcCCc-ee--EE--eccc---------ccc-----------c-cccccchhh
Confidence                        999999999999999999996 33  32  2443         111           1 257899999


Q ss_pred             EcCChHHHHHHHHHHhhccCCCcEEEEeeccCCC
Q 041970          294 ANILLNPLLQLADHIVSYAKPGAVVGISGILSEQ  327 (327)
Q Consensus       294 ANIla~vL~~L~p~i~~~LkpGG~LIlSGIl~~Q  327 (327)
                      ||++++++..+++.+.++|||||+|++|||+.+|
T Consensus       190 ani~~~~l~~l~~~~~~~LkpGG~lilSgil~~~  223 (254)
T d2nxca1         190 ANLYAELHAALAPRYREALVPGGRALLTGILKDR  223 (254)
T ss_dssp             EECCHHHHHHHHHHHHHHEEEEEEEEEEEEEGGG
T ss_pred             hccccccHHHHHHHHHHhcCCCcEEEEEecchhh
Confidence            9999999999999999999999999999998765



>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure