Citrus Sinensis ID: 042014

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MQPFSEVSGLHYLLAPSLSQFLNPILNFHQIPPQVPEIINSQTSSFSSNNSTSDEAEEQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQLNSHYSSLKDLDDVPCCNAADLLG
cccccccccccccccccccccccccccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
cccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccHccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHcc
mqpfsevsglhyllapslsqflnpilnfhqippqvpeiinsqtssfssnnstsdeAEEQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQlnshysslkdlddvpccnaadllg
MQPFSEVSGLHYLLAPSLSQFLNPILNFHQIPPQVPEIINSQTSSFSSNNSTSDEAEEQQQQsmiinerkqrrmisnresarrsrmrkqKHLDELWSQVVWLRNENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQLNSHysslkdlddvpCCNAADLLG
MQPFSEVSGLHYLLAPSLSQFLNPILNFHQIPPQVPEIInsqtssfssnnstsDEAEEQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQLNSHYSSLKDLDDVPCCNAADLLG
********GLHYLLAPSLSQFLNPILNFHQIPP**********************************************************LDELWSQVVWLRNENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQLNSHYSSLKDLDDVPCCNA*****
*****E**********************************************************************NRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQ*N***********VPCCN******
********GLHYLLAPSLSQFLNPILNFHQIPPQVPEIINSQ********************SMIINERK********************HLDELWSQVVWLRNENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQLNSHYSSLKDLDDVPCCNAADLLG
*****EVSGLHYLLAPSLSQFLNPILNFHQIPPQ****************************************************RKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQLNSHYSSLKDLDDVPCCN******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQPFSEVSGLHYLLAPSLSQFLNPILNFHQIPPQVPEIINSQTSSFSSNNSTSDEAEEQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCxxxxxxxxxxxxxxxxxxxxxxxxxxxxSHYSSLKDLDDVPCCNAADLLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
P24068151 Ocs element-binding facto N/A no 0.550 0.615 0.387 2e-10
Q9FUD3277 Basic leucine zipper 9 OS no no 0.615 0.375 0.358 3e-08
P42774315 G-box-binding factor 1 OS no no 0.384 0.206 0.461 4e-07
P23922349 Transcription factor HBP- N/A no 0.384 0.186 0.4 9e-07
Q9M7Q4416 ABSCISIC ACID-INSENSITIVE no no 0.390 0.158 0.434 1e-06
P42776382 G-box-binding factor 3 OS no no 0.408 0.180 0.444 3e-06
Q99091296 Light-inducible protein C N/A no 0.384 0.219 0.461 8e-06
Q99089411 Common plant regulatory f N/A no 0.443 0.182 0.369 9e-06
Q9SJN0442 Protein ABSCISIC ACID-INS no no 0.260 0.099 0.568 1e-05
Q9LES3297 ABSCISIC ACID-INSENSITIVE no no 0.520 0.296 0.339 2e-05
>sp|P24068|OCS1_MAIZE Ocs element-binding factor 1 OS=Zea mays GN=OBF1 PE=2 SV=2 Back     alignment and function desciption
 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 55/93 (59%)

Query: 45  SFSSNNSTSDEAEEQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRN 104
           S SS + T+         S     R+++R +SNRESARRSR+RKQ+HLDEL  +V  L+ 
Sbjct: 2   SSSSLSPTAGRTSGSDGDSAADTHRREKRRLSNRESARRSRLRKQQHLDELVQEVARLQA 61

Query: 105 ENHQLVDKLNHVSGCHDKVIQENAELKVEATEL 137
           +N ++  +   ++  + +V QEN  L+  A EL
Sbjct: 62  DNARVAARARDIASQYTRVEQENTVLRARAAEL 94
May contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites.
Zea mays (taxid: 4577)
>sp|Q9FUD3|BZIP9_ARATH Basic leucine zipper 9 OS=Arabidopsis thaliana GN=BZIP9 PE=1 SV=1 Back     alignment and function description
>sp|P42774|GBF1_ARATH G-box-binding factor 1 OS=Arabidopsis thaliana GN=GBF1 PE=2 SV=2 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|Q9M7Q4|AI5L5_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 5 OS=Arabidopsis thaliana GN=ABF2 PE=1 SV=1 Back     alignment and function description
>sp|P42776|GBF3_ARATH G-box-binding factor 3 OS=Arabidopsis thaliana GN=GBF3 PE=1 SV=2 Back     alignment and function description
>sp|Q99091|CPRF3_PETCR Light-inducible protein CPRF3 OS=Petroselinum crispum GN=CPRF3 PE=2 SV=1 Back     alignment and function description
>sp|Q99089|CPRF1_PETCR Common plant regulatory factor 1 OS=Petroselinum crispum GN=CPRF1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJN0|ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5 OS=Arabidopsis thaliana GN=ABI5 PE=1 SV=1 Back     alignment and function description
>sp|Q9LES3|AI5L2_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 2 OS=Arabidopsis thaliana GN=DPBF3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
225451875198 PREDICTED: ocs element-binding factor 1 0.899 0.767 0.659 4e-51
224112269196 predicted protein [Populus trichocarpa] 0.934 0.806 0.612 2e-49
255579930195 Ocs element-binding factor, putative [Ri 0.923 0.8 0.640 5e-48
224127306165 predicted protein [Populus trichocarpa] 0.881 0.903 0.637 1e-45
449447450178 PREDICTED: transcription factor HBP-1a-l 0.899 0.853 0.586 2e-45
307136478179 bZIP transcription factor [Cucumis melo 0.905 0.854 0.586 5e-45
90657603172 hypothetical protein [Cleome spinosa] 0.893 0.877 0.591 2e-42
449438745161 PREDICTED: ocs element-binding factor 1- 0.828 0.869 0.603 4e-41
90657558183 hypothetical protein [Cleome spinosa] 0.899 0.830 0.580 7e-41
356499972199 PREDICTED: ocs element-binding factor 1- 0.946 0.804 0.546 7e-41
>gi|225451875|ref|XP_002278738.1| PREDICTED: ocs element-binding factor 1 [Vitis vinifera] gi|147765608|emb|CAN66938.1| hypothetical protein VITISV_030756 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 116/176 (65%), Positives = 133/176 (75%), Gaps = 24/176 (13%)

Query: 5   SEVSGLHYLL-----------------APSL--SQFLN-PILNFHQIPPQVPEIINSQTS 44
           SEV+GLHY +                 APS+  S F + P+ NFH + PQV E  N Q S
Sbjct: 4   SEVTGLHYFVPSNPTPYPAHFSMAGNNAPSIHFSGFSSSPLSNFHVVSPQVHEF-NPQIS 62

Query: 45  SFSSNNSTSDEAEEQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRN 104
            FSSN STSDEA+EQQ    +INERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRN
Sbjct: 63  CFSSN-STSDEADEQQLS--LINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRN 119

Query: 105 ENHQLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQLNSHYSSLKDLDDVP 160
           ENHQL+DKLNHVS CHD+V+QEN +LK EA+ELRQM+TDLQLNS Y +L+DL+D P
Sbjct: 120 ENHQLIDKLNHVSECHDRVLQENVQLKEEASELRQMVTDLQLNSPYPNLRDLEDEP 175

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224112269|ref|XP_002332801.1| predicted protein [Populus trichocarpa] gi|222834236|gb|EEE72713.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255579930|ref|XP_002530800.1| Ocs element-binding factor, putative [Ricinus communis] gi|223529621|gb|EEF31568.1| Ocs element-binding factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224127306|ref|XP_002329245.1| predicted protein [Populus trichocarpa] gi|222870699|gb|EEF07830.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449447450|ref|XP_004141481.1| PREDICTED: transcription factor HBP-1a-like [Cucumis sativus] gi|449481413|ref|XP_004156175.1| PREDICTED: transcription factor HBP-1a-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307136478|gb|ADN34279.1| bZIP transcription factor [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|90657603|gb|ABD96902.1| hypothetical protein [Cleome spinosa] Back     alignment and taxonomy information
>gi|449438745|ref|XP_004137148.1| PREDICTED: ocs element-binding factor 1-like [Cucumis sativus] gi|449476417|ref|XP_004154731.1| PREDICTED: ocs element-binding factor 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|90657558|gb|ABD96858.1| hypothetical protein [Cleome spinosa] Back     alignment and taxonomy information
>gi|356499972|ref|XP_003518809.1| PREDICTED: ocs element-binding factor 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
TAIR|locus:2092595173 bZIP42 "AT3G30530" [Arabidopsi 0.934 0.913 0.520 2.7e-36
TAIR|locus:2166650165 bZIP43 "AT5G38800" [Arabidopsi 0.899 0.921 0.479 1.1e-30
TAIR|locus:2009932196 bZIP58 "AT1G13600" [Arabidopsi 0.609 0.525 0.590 5.6e-29
TAIR|locus:2143191186 bZIP3 "AT5G15830" [Arabidopsis 0.881 0.801 0.472 7.1e-29
TAIR|locus:2827461166 bZIP48 "AT2G04038" [Arabidopsi 0.550 0.560 0.612 1.2e-26
TAIR|locus:2012413138 bZIP "AT1G68880" [Arabidopsis 0.502 0.615 0.541 1.7e-20
TAIR|locus:2053124171 bZIP2 "AT2G18160" [Arabidopsis 0.538 0.532 0.434 8.8e-15
TAIR|locus:2096024146 BZIP53 "AT3G62420" [Arabidopsi 0.615 0.712 0.363 7.9e-14
TAIR|locus:2018411173 bZIP44 "AT1G75390" [Arabidopsi 0.520 0.508 0.488 1e-13
TAIR|locus:2159325206 bZIP70 "AT5G60830" [Arabidopsi 0.520 0.427 0.411 2.1e-13
TAIR|locus:2092595 bZIP42 "AT3G30530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 391 (142.7 bits), Expect = 2.7e-36, P = 2.7e-36
 Identities = 90/173 (52%), Positives = 112/173 (64%)

Query:     1 MQPFSEVSGLHYLLAPSLSQFLNPILNFHQIPP-----QVPEIIXXXXX--------XXX 47
             MQP ++V  LH  L  S+ Q   P  NF    P     Q P ++                
Sbjct:     1 MQPQTDVFSLHNYLNSSILQSPYPS-NFPISTPFPTNGQNPYLLYGFQSPTNNPQSMSLS 59

Query:    48 XXXXXXDEAEEQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENH 107
                   DEAEEQQ  + IINERKQRRMISNRESARRSRMRKQ+HLDELWSQV+WLR ENH
Sbjct:    60 SNNSTSDEAEEQQTNNNIINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENH 119

Query:   108 QLVDKLNHVSGCHDKVIQENAELKVEATELRQMLTDLQLNSHYSSLKDLDDVP 160
             QL+DKLN++S  HDKV+QENA+LK E  EL+Q+++D+Q+ S +S  +D D +P
Sbjct:   120 QLLDKLNNLSESHDKVLQENAQLKEETFELKQVISDMQIQSPFSCFRD-DIIP 171
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0046982 "protein heterodimerization activity" evidence=IPI
TAIR|locus:2166650 bZIP43 "AT5G38800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009932 bZIP58 "AT1G13600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143191 bZIP3 "AT5G15830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827461 bZIP48 "AT2G04038" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012413 bZIP "AT1G68880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053124 bZIP2 "AT2G18160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096024 BZIP53 "AT3G62420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018411 bZIP44 "AT1G75390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159325 bZIP70 "AT5G60830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
smart0033865 smart00338, BRLZ, basic region leucin zipper 5e-13
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 2e-08
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 4e-06
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 0.003
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 60.3 bits (147), Expect = 5e-13
 Identities = 23/62 (37%), Positives = 37/62 (59%)

Query: 68  ERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCHDKVIQEN 127
           E+++RR   NRE+ARRSR RK+  ++EL  +V  L  EN +L  ++  +    +K+  E 
Sbjct: 4   EKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL 63

Query: 128 AE 129
            E
Sbjct: 64  EE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 99.52
smart0033865 BRLZ basic region leucin zipper. 99.46
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.41
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.28
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.18
KOG0709 472 consensus CREB/ATF family transcription factor [Tr 98.95
KOG3584348 consensus cAMP response element binding protein an 98.82
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.11
KOG4571294 consensus Activating transcription factor 4 [Trans 97.87
KOG0837279 consensus Transcriptional activator of the JUN fam 97.81
KOG4196135 consensus bZIP transcription factor MafK [Transcri 97.48
KOG3119269 consensus Basic region leucine zipper transcriptio 97.25
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 96.59
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.51
COG307479 Uncharacterized protein conserved in bacteria [Fun 96.48
TIGR0244965 conserved hypothetical protein TIGR02449. Members 96.43
PRK1542279 septal ring assembly protein ZapB; Provisional 96.33
PRK13169110 DNA replication intiation control protein YabA; Re 96.16
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 95.91
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.89
PRK13169110 DNA replication intiation control protein YabA; Re 95.68
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 95.51
TIGR0244965 conserved hypothetical protein TIGR02449. Members 95.5
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 94.82
COG4467114 Regulator of replication initiation timing [Replic 94.8
PRK10884206 SH3 domain-containing protein; Provisional 94.41
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.95
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 93.67
PRK10884206 SH3 domain-containing protein; Provisional 93.59
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 93.53
PF14662 193 CCDC155: Coiled-coil region of CCDC155 93.44
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 93.25
COG4026290 Uncharacterized protein containing TOPRIM domain, 92.73
COG4467114 Regulator of replication initiation timing [Replic 92.24
smart0034044 HALZ homeobox associated leucin zipper. 92.08
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 92.01
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 91.97
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 91.97
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.93
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 91.83
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.79
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 91.68
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 91.63
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 91.52
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 91.35
PRK0211973 hypothetical protein; Provisional 91.26
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 91.19
PRK0440675 hypothetical protein; Provisional 90.84
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 90.62
PRK1542279 septal ring assembly protein ZapB; Provisional 90.5
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 90.41
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 90.21
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 89.98
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 89.63
PRK11637 428 AmiB activator; Provisional 89.56
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 89.4
PF15058 200 Speriolin_N: Speriolin N terminus 89.28
PF15294278 Leu_zip: Leucine zipper 89.28
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 89.08
PRK0432574 hypothetical protein; Provisional 88.87
PRK0084677 hypothetical protein; Provisional 88.66
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 88.65
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 88.53
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 88.3
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 88.0
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 87.61
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 87.35
PRK0279372 phi X174 lysis protein; Provisional 87.02
PRK13922 276 rod shape-determining protein MreC; Provisional 86.93
PF14662 193 CCDC155: Coiled-coil region of CCDC155 86.88
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 86.73
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 86.58
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 86.37
PRK0029568 hypothetical protein; Provisional 86.33
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 86.22
PRK00888105 ftsB cell division protein FtsB; Reviewed 86.1
KOG1414 395 consensus Transcriptional activator FOSB/c-Fos and 86.06
PRK0211973 hypothetical protein; Provisional 85.7
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 85.61
PRK11637 428 AmiB activator; Provisional 85.54
PRK09039 343 hypothetical protein; Validated 85.08
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 85.05
KOG4196135 consensus bZIP transcription factor MafK [Transcri 84.86
KOG1962216 consensus B-cell receptor-associated protein and r 84.26
KOG3650120 consensus Predicted coiled-coil protein [General f 84.04
PRK00888105 ftsB cell division protein FtsB; Reviewed 83.99
PF09738 302 DUF2051: Double stranded RNA binding protein (DUF2 83.84
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 83.77
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 83.65
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 83.31
COG4026290 Uncharacterized protein containing TOPRIM domain, 83.0
PHA02562 562 46 endonuclease subunit; Provisional 82.88
TIGR0220985 ftsL_broad cell division protein FtsL. This model 82.5
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 82.35
PRK0279372 phi X174 lysis protein; Provisional 82.33
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 82.31
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 82.12
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 81.83
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 81.81
smart0033865 BRLZ basic region leucin zipper. 81.72
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 81.69
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 81.61
PF09789 319 DUF2353: Uncharacterized coiled-coil protein (DUF2 81.37
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 81.23
PF1374789 DUF4164: Domain of unknown function (DUF4164) 81.18
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 81.14
KOG3119269 consensus Basic region leucine zipper transcriptio 81.09
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 81.09
PRK10803 263 tol-pal system protein YbgF; Provisional 81.05
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 80.83
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 80.45
PRK09039 343 hypothetical protein; Validated 80.19
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 80.18
COG4942 420 Membrane-bound metallopeptidase [Cell division and 80.15
PF10186 302 Atg14: UV radiation resistance protein and autopha 80.03
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information 
Probab=99.52  E-value=2e-13  Score=117.11  Aligned_cols=90  Identities=27%  Similarity=0.391  Sum_probs=85.8

Q ss_pred             HHHhhhccHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHH
Q 042014           58 EQQQQSMIINERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCHDKVIQENAELKVEATEL  137 (169)
Q Consensus        58 eq~~~~~~~deRR~RR~isNRESARRSR~RKq~~leeLe~qV~~L~~eN~~L~~~l~~l~~~~~~l~~EN~~Lr~e~~~L  137 (169)
                      -+.+.+++.|||-+|||++||.+|+.+|.|||+++++++.+|.+|..||+.|+.+...|.++.+.|..+|..|+.++..+
T Consensus        58 r~RL~HLS~EEK~~RrKLKNRVAAQtaRDrKKaRm~eme~~i~dL~een~~L~~en~~Lr~~n~~L~~~n~el~~~le~~  137 (292)
T KOG4005|consen   58 RRRLDHLSWEEKVQRRKLKNRVAAQTARDRKKARMEEMEYEIKDLTEENEILQNENDSLRAINESLLAKNHELDSELELL  137 (292)
T ss_pred             HHhhcccCHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHH
Confidence            35688999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhc
Q 042014          138 RQMLTDLQLN  147 (169)
Q Consensus       138 r~~L~~l~~~  147 (169)
                      ++.|.+++.+
T Consensus       138 ~~~l~~~~~~  147 (292)
T KOG4005|consen  138 RQELAELKQQ  147 (292)
T ss_pred             HHHHHhhHHH
Confidence            9999887754

>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF15058 Speriolin_N: Speriolin N terminus Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>KOG3650 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR02209 ftsL_broad cell division protein FtsL Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 8e-13
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 5e-09
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 3e-08
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 6e-07
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 8e-07
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 3e-06
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 1e-05
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 3e-05
2wt7_B90 Transcription factor MAFB; transcription, transcri 1e-04
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 2e-04
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 2e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 8e-04
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
 Score = 59.0 bits (143), Expect = 8e-13
 Identities = 16/47 (34%), Positives = 33/47 (70%)

Query: 69  RKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNH 115
           +++ R++ NRE+AR SR +K++++  L ++V  L N+N  L+++L  
Sbjct: 1   KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKA 47
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.61
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.42
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.31
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.3
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.24
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 99.07
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.07
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.66
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.64
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.6
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.32
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 96.75
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 96.56
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 96.49
1deb_A54 APC protein, adenomatous polyposis coli protein; c 96.11
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.67
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.58
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 94.42
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 94.42
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 94.2
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 93.29
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 92.91
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 92.57
3m48_A33 General control protein GCN4; leucine zipper, synt 91.54
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 91.42
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 91.13
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 91.04
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 90.23
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 89.4
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 89.39
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 89.36
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 88.98
3cve_A72 Homer protein homolog 1; coiled coil, alternative 88.87
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 88.77
2zxx_A79 Geminin; coiled-coil, cell cycle, coiled coil, DNA 88.62
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 88.55
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 88.15
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 88.02
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 87.91
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 87.88
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 87.34
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 86.47
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 86.41
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 86.04
2bni_A34 General control protein GCN4; four helix bundle, a 86.01
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 85.99
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 85.98
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 85.82
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 85.62
3m48_A33 General control protein GCN4; leucine zipper, synt 85.28
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 84.9
2hy6_A34 General control protein GCN4; protein design, para 84.83
1uo4_A34 General control protein GCN4; four helix bundle, c 84.68
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 84.64
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 84.49
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 84.48
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 84.43
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 84.06
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 83.87
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 83.86
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 83.19
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 82.87
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 82.6
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 82.55
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 81.96
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 81.87
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 81.65
3m9b_A 251 Proteasome-associated ATPase; coil COIL with 5 bet 81.45
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 81.29
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 80.99
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 80.98
1p9i_A31 Cortexillin I/GCN4 hybrid peptide; coiled-coil, un 80.64
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 80.15
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 80.13
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.61  E-value=1.1e-15  Score=102.71  Aligned_cols=52  Identities=31%  Similarity=0.518  Sum_probs=48.2

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHH
Q 042014           69 RKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCH  120 (169)
Q Consensus        69 RR~RR~isNRESARRSR~RKq~~leeLe~qV~~L~~eN~~L~~~l~~l~~~~  120 (169)
                      ||.+||++||+||++||+||++|+++|+.+|..|..+|..|..++..|.+.+
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5889999999999999999999999999999999999999999988877654
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 94.02
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=94.02  E-value=0.012  Score=39.96  Aligned_cols=28  Identities=36%  Similarity=0.457  Sum_probs=23.5

Q ss_pred             HHHHHHHHHhHHHHHHHHHHHHHHHHHH
Q 042014           68 ERKQRRMISNRESARRSRMRKQKHLDEL   95 (169)
Q Consensus        68 eRR~RR~isNRESARRSR~RKq~~leeL   95 (169)
                      -|-.||.=+||.+|+++|+||-...++|
T Consensus        47 irDIRRRGKNKvAAqnCRKRKld~~d~l   74 (74)
T d1sknp_          47 IRKIRRRGKNKVAARTCRQRRTDRHDKM   74 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHhcccHHHHHHHHHhhhhhhccC
Confidence            3567889999999999999998876653